Psyllid ID: psy13064

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190--
MEKQKDKPYTIRKDILDDLSSRFVINIPHEERGDVIRICFQMELAYWFYLDFYCTQDESLFKAGLKEFFFQMFHHIPSLTHFARKIDTVLDDWRHYKQSVPTFGAILIDKSLTQVLLFLRQGLTVLDDWRHYKQSVPTFGAILIDKSLTQVLLVQSFFARASWGFPKGKVNQDEPPMTCAIREVKIIFCQHS
ccccccccccccHHHHHHHHHHHHccccccccccHHHHHHHHHHcEEEEEEcccccccccccccHHHHHHHHHHHcccccccHHcHHHHHHHHHHccccccccEEEEEcccHHHHHHHHccHHHHHHHHHHHccccccccEEEEcccccEEEEEEEcccccccccccccccccccccccHHHHEEEEccccc
ccHHccccccccHHHHHHHHHHHEEcccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHccHHHHHHHcHHHHHHHHHHHHccccEEEEEEEcccccEEEEEHcccccccccccccccccccHHHHHHHHHcccEEEEEccccccccccccccccccccccHcEEEEEEEEEEccc
mekqkdkpytIRKDILddlssrfvinipheergdvIRICFQMELAYWFYLDFYCTQDESLFKAGLKEFFFQMfhhipsltHFARKIDTVLDDWrhykqsvptfgaILIDKSLTQVLLFLRQGltvlddwrhykqsvptfgaILIDKSLTQVLLVQSFFAraswgfpkgkvnqdeppmtcaiREVKIIFCQHS
mekqkdkpytirkdilddlssrfvinipheergdviRICFQMELAYWFYLDFYCTQDESLFKAGLKEFFFQMFHHIPSLTHFARKIDTVLDDWRHYKQSVPTFGAILIDKSLTQVLLFLRQGLTVLDDWRHYKQSVPTFGAILIDKSLTQVLLVQSFFARaswgfpkgkvnqdeppmtcAIREVKIIFCQHS
MEKQKDKPYTIRKDILDDLSSRFVINIPHEERGDVIRICFQMELAYWFYLDFYCTQDESLFKAGLKEFFFQMFHHIPSLTHFARKIDTVLDDWRHYKQSVPTFGAILIDKSLTQVLLFLRQGLTVLDDWRHYKQSVPTFGAILIDKSLTQVLLVQSFFARASWGFPKGKVNQDEPPMTCAIREVKIIFCQHS
*********TIRKDILDDLSSRFVINIPHEERGDVIRICFQMELAYWFYLDFYCTQDESLFKAGLKEFFFQMFHHIPSLTHFARKIDTVLDDWRHYKQSVPTFGAILIDKSLTQVLLFLRQGLTVLDDWRHYKQSVPTFGAILIDKSLTQVLLVQSFFARASWGFPKGKVNQDEPPMTCAIREVKIIFC***
***************LDDLSSRFVINIPHEERGDVIRICFQMELAYWFYLDFYCTQDESLFKAGLKEFFFQMFHHIPSLTHFARKIDTVLDDWRHYKQSVPTFGAILIDKSLTQVLLFLRQGLTVLDDWRHYKQSVPTFGAILIDKSLTQVLLVQSFFARASWGFPKGKVNQDEPPMTCAIREVKIIFCQH*
********YTIRKDILDDLSSRFVINIPHEERGDVIRICFQMELAYWFYLDFYCTQDESLFKAGLKEFFFQMFHHIPSLTHFARKIDTVLDDWRHYKQSVPTFGAILIDKSLTQVLLFLRQGLTVLDDWRHYKQSVPTFGAILIDKSLTQVLLVQSFFARASWGFPKGKVNQDEPPMTCAIREVKIIFCQHS
*******PYTIRKDILDDLSSRFVINIPHEERGDVIRICFQMELAYWFYLDFYCTQDESLFKAGLKEFFFQMFHHIPSLTHFARKIDTVLDDWRHYKQSVPTFGAILIDKSLTQVLLFLRQGLTVLDDWRHYKQSVPTFGAILIDKSLTQVLLVQSFFARASWGFPKGKVNQDEPPMTCAIREVKIIFCQH*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEKQKDKPYTIRKDILDDLSSRFVINIPHEERGDVIRICFQMELAYWFYLDFYCTQDESLFKAGLKEFFFQMFHHIPSLTHFARKIDTVLDDWRHYKQSVPTFGAILIDKSLTQVLLFLRQGLTVLDDWRHYKQSVPTFGAILIDKSLTQVLLVQSFFARASWGFPKGKVNQDEPPMTCAIREVKIIFCQHS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query192 2.2.26 [Sep-21-2011]
Q5REQ8 385 m7GpppN-mRNA hydrolase OS yes N/A 0.718 0.358 0.408 2e-34
Q9CYC6 422 m7GpppN-mRNA hydrolase OS yes N/A 0.718 0.327 0.402 3e-34
Q8IU60 420 m7GpppN-mRNA hydrolase OS yes N/A 0.718 0.328 0.402 6e-34
O62255 786 mRNA-decapping enzyme 2 O yes N/A 0.713 0.174 0.380 1e-26
O13828 741 mRNA decapping complex su yes N/A 0.697 0.180 0.358 1e-26
Q8GW31 373 mRNA-decapping enzyme sub yes N/A 0.703 0.361 0.331 4e-19
P53550 970 mRNA-decapping enzyme sub yes N/A 0.697 0.138 0.298 2e-15
A6ZRW5 970 mRNA-decapping enzyme sub N/A N/A 0.697 0.138 0.298 2e-15
Q75BK1 880 mRNA-decapping enzyme sub yes N/A 0.687 0.15 0.282 6e-11
>sp|Q5REQ8|DCP2_PONAB m7GpppN-mRNA hydrolase OS=Pongo abelii GN=DCP2 PE=2 SV=1 Back     alignment and function desciption
 Score =  145 bits (365), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 71/174 (40%), Positives = 98/174 (56%), Gaps = 36/174 (20%)

Query: 11  IRKDILDDLSSRFVINIPHEERGDVIRICFQMELAYWFYLDFYCTQDESLFKAGLKEFFF 70
           I   +LDDL SRF+++IP EER + IR+CFQ+ELA+WFYLDFY      L + G+++F  
Sbjct: 8   IPGSVLDDLCSRFILHIPSEERDNAIRVCFQIELAHWFYLDFYMQNTPGLSQCGIRDFAK 67

Query: 71  QMFHHIPSLTHFARKIDTVLDDWRHYKQSVPTFGAILIDKSLTQVLLFLRQGLTVLDDWR 130
            +F H P L      ++ VLD+W+ YK  VPT+GAI++D++L                  
Sbjct: 68  AVFSHCPFLLPEGEDVEKVLDEWKEYKMGVPTYGAIILDETL------------------ 109

Query: 131 HYKQSVPTFGAILIDKSLTQVLLVQSFFARASWGFPKGKVNQDEPPMTCAIREV 184
                               VLLVQ + A++ WGFPKGKVN++E P  CA REV
Sbjct: 110 ------------------ENVLLVQGYLAKSGWGFPKGKVNKEEAPHDCAAREV 145
Necessary for the degradation of mRNAs, both in normal mRNA turnover and in nonsense-mediated mRNA decay. Plays a role in replication-dependent histone mRNA degradation. Removes the 7-methyl guanine cap structure from mRNA molecules, yielding a 5'-phosphorylated mRNA fragment and 7m-GDP. Has higher activity towards mRNAs that lack a poly(A) tail. Has no activity towards a cap structure lacking an RNA moiety.
Pongo abelii (taxid: 9601)
EC: 3EC: .EC: 6EC: .EC: 1EC: .EC: 6EC: 2
>sp|Q9CYC6|DCP2_MOUSE m7GpppN-mRNA hydrolase OS=Mus musculus GN=Dcp2 PE=1 SV=2 Back     alignment and function description
>sp|Q8IU60|DCP2_HUMAN m7GpppN-mRNA hydrolase OS=Homo sapiens GN=DCP2 PE=1 SV=2 Back     alignment and function description
>sp|O62255|DCP2_CAEEL mRNA-decapping enzyme 2 OS=Caenorhabditis elegans GN=dcap-2 PE=2 SV=4 Back     alignment and function description
>sp|O13828|DCP2_SCHPO mRNA decapping complex subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dcp2 PE=1 SV=1 Back     alignment and function description
>sp|Q8GW31|DCP2_ARATH mRNA-decapping enzyme subunit 2 OS=Arabidopsis thaliana GN=DCP2 PE=1 SV=1 Back     alignment and function description
>sp|P53550|DCP2_YEAST mRNA-decapping enzyme subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DCP2 PE=1 SV=1 Back     alignment and function description
>sp|A6ZRW5|DCP2_YEAS7 mRNA-decapping enzyme subunit 2 OS=Saccharomyces cerevisiae (strain YJM789) GN=DCP2 PE=3 SV=1 Back     alignment and function description
>sp|Q75BK1|DCP2_ASHGO mRNA-decapping enzyme subunit 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DCP2 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query192
242010962 307 mRNA decapping enzyme, putative [Pedicul 0.718 0.449 0.494 2e-43
307180787 461 mRNA-decapping enzyme 2 [Camponotus flor 0.729 0.303 0.485 2e-41
170052990 491 conserved hypothetical protein [Culex qu 0.744 0.291 0.464 2e-41
170072102 426 mRNA-decapping enzyme 2 [Culex quinquefa 0.744 0.335 0.464 2e-41
332029289 460 mRNA-decapping enzyme 2 [Acromyrmex echi 0.729 0.304 0.491 3e-41
383855990 458 PREDICTED: mRNA-decapping enzyme 2-like 0.729 0.305 0.480 4e-41
357624398 370 hypothetical protein KGM_19785 [Danaus p 0.723 0.375 0.488 5e-41
307203421 457 mRNA-decapping enzyme 2 [Harpegnathos sa 0.729 0.306 0.480 6e-41
322784387 431 hypothetical protein SINV_07044 [Solenop 0.729 0.324 0.480 2e-40
158287530 294 AGAP011114-PA [Anopheles gambiae str. PE 0.744 0.486 0.475 2e-40
>gi|242010962|ref|XP_002426226.1| mRNA decapping enzyme, putative [Pediculus humanus corporis] gi|212510289|gb|EEB13488.1| mRNA decapping enzyme, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  180 bits (457), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 112/174 (64%), Gaps = 36/174 (20%)

Query: 11  IRKDILDDLSSRFVINIPHEERGDVIRICFQMELAYWFYLDFYCTQDESLFKAGLKEFFF 70
           I  +ILDDLSSRF++N+P EER + IR+CFQ+ELAYWFYLDF+CT+D +L   G+KEF  
Sbjct: 10  IPSEILDDLSSRFIVNVPEEERKEPIRLCFQVELAYWFYLDFFCTEDPNLKTCGMKEFTA 69

Query: 71  QMFHHIPSLTHFARKIDTVLDDWRHYKQSVPTFGAILIDKSLTQVLLFLRQGLTVLDDWR 130
           Q+F HIP LT   + +D V+DDWR YK SVPT+GAI++++ LT                 
Sbjct: 70  QIFEHIPFLTPLLKNLDKVIDDWRMYKSSVPTYGAIVLNEDLT----------------- 112

Query: 131 HYKQSVPTFGAILIDKSLTQVLLVQSFFARASWGFPKGKVNQDEPPMTCAIREV 184
                              +VLLVQS+F ++SWGFPKGKVN+ E P  CA+REV
Sbjct: 113 -------------------KVLLVQSYFTKSSWGFPKGKVNELETPYNCAVREV 147

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|307180787|gb|EFN68651.1| mRNA-decapping enzyme 2 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|170052990|ref|XP_001862471.1| conserved hypothetical protein [Culex quinquefasciatus] gi|167873693|gb|EDS37076.1| conserved hypothetical protein [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|170072102|ref|XP_001870095.1| mRNA-decapping enzyme 2 [Culex quinquefasciatus] gi|167868185|gb|EDS31568.1| mRNA-decapping enzyme 2 [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|332029289|gb|EGI69272.1| mRNA-decapping enzyme 2 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|383855990|ref|XP_003703493.1| PREDICTED: mRNA-decapping enzyme 2-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|357624398|gb|EHJ75183.1| hypothetical protein KGM_19785 [Danaus plexippus] Back     alignment and taxonomy information
>gi|307203421|gb|EFN82496.1| mRNA-decapping enzyme 2 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|322784387|gb|EFZ11358.1| hypothetical protein SINV_07044 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|158287530|ref|XP_309532.4| AGAP011114-PA [Anopheles gambiae str. PEST] gi|157019695|gb|EAA05101.4| AGAP011114-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query192
UNIPROTKB|Q5REQ8 385 DCP2 "m7GpppN-mRNA hydrolase" 0.666 0.332 0.446 9.4e-27
UNIPROTKB|J9NVA8 422 DCP2 "Uncharacterized protein" 0.666 0.303 0.438 1.9e-26
MGI|MGI:1917890 422 Dcp2 "DCP2 decapping enzyme ho 0.666 0.303 0.438 1.9e-26
RGD|1562909 422 Dcp2 "DCP2 decapping enzyme ho 0.666 0.303 0.438 1.9e-26
UNIPROTKB|Q8IU60 420 DCP2 "m7GpppN-mRNA hydrolase" 0.666 0.304 0.438 4e-26
UNIPROTKB|G3MYZ4 428 DCP2 "Uncharacterized protein" 0.666 0.299 0.431 1.1e-25
UNIPROTKB|F1RLG6 427 DCP2 "Uncharacterized protein" 0.666 0.299 0.435 1.1e-25
UNIPROTKB|E2QVY2 427 DCP2 "Uncharacterized protein" 0.666 0.299 0.431 2.4e-25
ZFIN|ZDB-GENE-040426-851 397 dcp2 "DCP2 decapping enzyme ho 0.640 0.309 0.448 3.6e-25
FB|FBgn0036534 792 Dcp2 "Decapping protein 2" [Dr 0.552 0.133 0.475 5.6e-24
UNIPROTKB|Q5REQ8 DCP2 "m7GpppN-mRNA hydrolase" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
 Score = 301 (111.0 bits), Expect = 9.4e-27, P = 9.4e-27
 Identities = 58/130 (44%), Positives = 80/130 (61%)

Query:     7 KPYTIRKDILDDLSSRFVINIPHEERGDVIRICFQMELAYWFYLDFYCTQDESLFKAGLK 66
             K   I   +LDDL SRF+++IP EER + IR+CFQ+ELA+WFYLDFY      L + G++
Sbjct:     4 KRVEIPGSVLDDLCSRFILHIPSEERDNAIRVCFQIELAHWFYLDFYMQNTPGLSQCGIR 63

Query:    67 EFFFQMFHHIPSLTHFARKIDTVLDDWRHYKQSVPTFGAILIDKSLTQVLLFLRQGLTVL 126
             +F   +F H P L      ++ VLD+W+ YK  VPT+GAI++D++L  VLL   QG    
Sbjct:    64 DFAKAVFSHCPFLLPEGEDVEKVLDEWKEYKMGVPTYGAIILDETLENVLLV--QGYLAK 121

Query:   127 DDWRHYKQSV 136
               W   K  V
Sbjct:   122 SGWGFPKGKV 131
GO:0006402 "mRNA catabolic process" evidence=ISS
GO:0050072 "m7G(5')pppN diphosphatase activity" evidence=ISS
GO:0071044 "histone mRNA catabolic process" evidence=ISS
UNIPROTKB|J9NVA8 DCP2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1917890 Dcp2 "DCP2 decapping enzyme homolog (S. cerevisiae)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1562909 Dcp2 "DCP2 decapping enzyme homolog (S. cerevisiae)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q8IU60 DCP2 "m7GpppN-mRNA hydrolase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|G3MYZ4 DCP2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1RLG6 DCP2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E2QVY2 DCP2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-851 dcp2 "DCP2 decapping enzyme homolog (S. cerevisiae)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0036534 Dcp2 "Decapping protein 2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query192
pfam0502685 pfam05026, DCP2, Dcp2, box A domain 8e-33
cd03672145 cd03672, Dcp2p, mRNA decapping enzyme 2 (Dcp2p), t 1e-20
cd02883123 cd02883, Nudix_Hydrolase, Nudix hydrolase is a sup 2e-06
pfam00293133 pfam00293, NUDIX, NUDIX domain 4e-06
cd03428130 cd03428, Ap4A_hydrolase_human_like, Diadenosine te 1e-05
COG0494161 COG0494, MutT, NTP pyrophosphohydrolases including 1e-05
cd03673131 cd03673, Ap6A_hydrolase, Diadenosine hexaphosphate 1e-04
cd04673122 cd04673, Nudix_Hydrolase_15, Members of the Nudix 1e-04
cd03424137 cd03424, ADPRase_NUDT5, ADP-ribose pyrophosphatase 2e-04
cd03427137 cd03427, MTH1, MutT homolog-1 (MTH1) is a member o 4e-04
COG1051145 COG1051, COG1051, ADP-ribose pyrophosphatase [Nucl 5e-04
>gnl|CDD|191168 pfam05026, DCP2, Dcp2, box A domain Back     alignment and domain information 
 Score =  112 bits (282), Expect = 8e-33
 Identities = 38/85 (44%), Positives = 52/85 (61%)

Query: 13 KDILDDLSSRFVINIPHEERGDVIRICFQMELAYWFYLDFYCTQDESLFKAGLKEFFFQM 72
           DILDDL  RF+IN+P EE   V R+CFQ+E A+WFY DFY   + SL    L++F  Q+
Sbjct: 1  DDILDDLCVRFIINLPEEELSSVERVCFQIEEAHWFYEDFYRPLNPSLPSLSLRDFAQQI 60

Query: 73 FHHIPSLTHFARKIDTVLDDWRHYK 97
          F H P L  +    +  L+ ++ YK
Sbjct: 61 FEHCPLLWKWKEDHEEALEKFKRYK 85

This domain is always found to the amino terminal side of pfam00293. This domain is specific to mRNA decapping protein 2 and this region has been termed Box A. Removal of the cap structure is catalyzed by the Dcp1-Dcp2 complex. Length = 85
>gnl|CDD|239644 cd03672, Dcp2p, mRNA decapping enzyme 2 (Dcp2p), the catalytic subunit, and Dcp1p are the two components of the decapping enzyme complex Back     alignment and domain information
>gnl|CDD|239217 cd02883, Nudix_Hydrolase, Nudix hydrolase is a superfamily of enzymes found in all three kingdoms of life, and it catalyzes the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|215841 pfam00293, NUDIX, NUDIX domain Back     alignment and domain information
>gnl|CDD|239520 cd03428, Ap4A_hydrolase_human_like, Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>gnl|CDD|223568 COG0494, MutT, NTP pyrophosphohydrolases including oxidative damage repair enzymes [DNA replication, recombination, and repair / General function prediction only] Back     alignment and domain information
>gnl|CDD|239645 cd03673, Ap6A_hydrolase, Diadenosine hexaphosphate (Ap6A) hydrolase is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>gnl|CDD|240030 cd04673, Nudix_Hydrolase_15, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|239516 cd03424, ADPRase_NUDT5, ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose and a variety of additional ADP-sugar conjugates to AMP and ribose-5-phosphate Back     alignment and domain information
>gnl|CDD|239519 cd03427, MTH1, MutT homolog-1 (MTH1) is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>gnl|CDD|223979 COG1051, COG1051, ADP-ribose pyrophosphatase [Nucleotide transport and metabolism] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 192
PF0502685 DCP2: Dcp2, box A domain; InterPro: IPR007722 This 100.0
KOG2937|consensus 348 100.0
cd03672145 Dcp2p mRNA decapping enzyme 2 (Dcp2p), the catalyt 99.65
cd04679125 Nudix_Hydrolase_20 Members of the Nudix hydrolase 99.53
cd04696125 Nudix_Hydrolase_37 Members of the Nudix hydrolase 99.53
PRK09438148 nudB dihydroneopterin triphosphate pyrophosphatase 99.52
cd03673131 Ap6A_hydrolase Diadenosine hexaphosphate (Ap6A) hy 99.52
cd03674138 Nudix_Hydrolase_1 Members of the Nudix hydrolase s 99.5
cd03671147 Ap4A_hydrolase_plant_like Diadenosine tetraphospha 99.49
cd04670127 Nudix_Hydrolase_12 Members of the Nudix hydrolase 99.49
cd04684128 Nudix_Hydrolase_25 Contains a crystal structure of 99.49
cd04700142 DR1025_like DR1025 from Deinococcus radiodurans, a 99.49
cd03430144 GDPMH GDP-mannose glycosyl hydrolase (AKA GDP-mann 99.47
cd04680120 Nudix_Hydrolase_21 Members of the Nudix hydrolase 99.47
cd04669121 Nudix_Hydrolase_11 Members of the Nudix hydrolase 99.46
cd04666122 Nudix_Hydrolase_9 Members of the Nudix hydrolase s 99.45
cd04677132 Nudix_Hydrolase_18 Members of the Nudix hydrolase 99.45
cd04671123 Nudix_Hydrolase_13 Members of the Nudix hydrolase 99.43
cd04676129 Nudix_Hydrolase_17 Members of the Nudix hydrolase 99.43
cd04511130 Nudix_Hydrolase_4 Members of the Nudix hydrolase s 99.43
PF00293134 NUDIX: NUDIX domain; InterPro: IPR000086 The gener 99.43
cd04691117 Nudix_Hydrolase_32 Members of the Nudix hydrolase 99.43
PRK15434159 GDP-mannose mannosyl hydrolase NudD; Provisional 99.43
cd04673122 Nudix_Hydrolase_15 Members of the Nudix hydrolase 99.43
cd04678129 Nudix_Hydrolase_19 Members of the Nudix hydrolase 99.42
COG1051145 ADP-ribose pyrophosphatase [Nucleotide transport a 99.42
cd04672123 Nudix_Hydrolase_14 Members of the Nudix hydrolase 99.42
cd04687128 Nudix_Hydrolase_28 Members of the Nudix hydrolase 99.42
cd03428130 Ap4A_hydrolase_human_like Diadenosine tetraphospha 99.42
cd03427137 MTH1 MutT homolog-1 (MTH1) is a member of the Nudi 99.41
PLN02325144 nudix hydrolase 99.4
cd04686131 Nudix_Hydrolase_27 Members of the Nudix hydrolase 99.4
cd04681130 Nudix_Hydrolase_22 Members of the Nudix hydrolase 99.4
cd04690118 Nudix_Hydrolase_31 Members of the Nudix hydrolase 99.39
cd03424137 ADPRase_NUDT5 ADP-ribose pyrophosphatase (ADPRase) 99.39
PRK15472141 nucleoside triphosphatase NudI; Provisional 99.39
cd04699129 Nudix_Hydrolase_39 Members of the Nudix hydrolase 99.38
KOG0648|consensus 295 99.38
cd04683120 Nudix_Hydrolase_24 Members of the Nudix hydrolase 99.38
cd04682122 Nudix_Hydrolase_23 Members of the Nudix hydrolase 99.38
PRK00714156 RNA pyrophosphohydrolase; Reviewed 99.37
cd04695131 Nudix_Hydrolase_36 Members of the Nudix hydrolase 99.37
cd03675134 Nudix_Hydrolase_2 Contains a crystal structure of 99.36
cd04689125 Nudix_Hydrolase_30 Members of the Nudix hydrolase 99.36
cd04667112 Nudix_Hydrolase_10 Members of the Nudix hydrolase 99.35
cd04664129 Nudix_Hydrolase_7 Members of the Nudix hydrolase s 99.34
cd04688126 Nudix_Hydrolase_29 Members of the Nudix hydrolase 99.34
cd03429131 NADH_pyrophosphatase NADH pyrophosphatase, a membe 99.34
KOG2937|consensus348 99.32
cd04661132 MRP_L46 Mitochondrial ribosomal protein L46 (MRP L 99.31
cd04693127 Nudix_Hydrolase_34 Members of the Nudix hydrolase 99.3
cd04662126 Nudix_Hydrolase_5 Members of the Nudix hydrolase s 99.29
PRK10546135 pyrimidine (deoxy)nucleoside triphosphate pyrophos 99.28
cd03426157 CoAse Coenzyme A pyrophosphatase (CoAse), a member 99.27
PRK10776129 nucleoside triphosphate pyrophosphohydrolase; Prov 99.24
TIGR00052185 nudix-type nucleoside diphosphatase, YffH/AdpP fam 99.23
PRK11762185 nudE adenosine nucleotide hydrolase NudE; Provisio 99.22
cd04674118 Nudix_Hydrolase_16 Members of the Nudix hydrolase 99.21
cd04697126 Nudix_Hydrolase_38 Members of the Nudix hydrolase 99.21
cd02883123 Nudix_Hydrolase Nudix hydrolase is a superfamily o 99.2
TIGR00586128 mutt mutator mutT protein. All proteins in this fa 99.19
cd03425124 MutT_pyrophosphohydrolase The MutT pyrophosphohydr 99.18
cd04685133 Nudix_Hydrolase_26 Members of the Nudix hydrolase 99.18
PRK10729202 nudF ADP-ribose pyrophosphatase NudF; Provisional 99.17
PRK05379340 bifunctional nicotinamide mononucleotide adenylylt 99.17
cd04694143 Nudix_Hydrolase_35 Members of the Nudix hydrolase 99.16
KOG2839|consensus145 99.16
cd04665118 Nudix_Hydrolase_8 Members of the Nudix hydrolase s 99.16
cd02885165 IPP_Isomerase Isopentenyl diphosphate (IPP) isomer 99.16
PRK00241256 nudC NADH pyrophosphatase; Reviewed 99.15
cd04692144 Nudix_Hydrolase_33 Members of the Nudix hydrolase 99.11
TIGR02705156 nudix_YtkD nucleoside triphosphatase YtkD. The fun 99.11
COG0494161 MutT NTP pyrophosphohydrolases including oxidative 99.1
PRK15393180 NUDIX hydrolase YfcD; Provisional 99.1
PRK03759184 isopentenyl-diphosphate delta-isomerase; Provision 99.03
cd04663126 Nudix_Hydrolase_6 Members of the Nudix hydrolase s 99.0
PRK10707190 putative NUDIX hydrolase; Provisional 98.97
PRK15009191 GDP-mannose pyrophosphatase NudK; Provisional 98.95
TIGR02150158 IPP_isom_1 isopentenyl-diphosphate delta-isomerase 98.93
PRK08999 312 hypothetical protein; Provisional 98.88
PLN03143 291 nudix hydrolase; Provisional 98.82
cd03670186 ADPRase_NUDT9 ADP-ribose pyrophosphatase (ADPRase) 98.74
KOG3084|consensus 345 98.74
PLN02709 222 nudix hydrolase 98.73
cd03676180 Nudix_hydrolase_3 Members of the Nudix hydrolase s 98.69
KOG3041|consensus225 98.34
COG4119161 Predicted NTP pyrophosphohydrolase [DNA replicatio 98.15
PLN02791 770 Nudix hydrolase homolog 98.06
COG2816279 NPY1 NTP pyrophosphohydrolases containing a Zn-fin 98.03
PLN02552 247 isopentenyl-diphosphate delta-isomerase 97.83
KOG3069|consensus 246 97.79
cd03431118 DNA_Glycosylase_C DNA glycosylase (MutY in bacteri 97.54
PF13869188 NUDIX_2: Nucleotide hydrolase; PDB: 3MDG_B 2J8Q_B 96.87
KOG4195|consensus275 96.6
KOG1689|consensus221 94.09
PLN02839 372 nudix hydrolase 91.96
KOG4432|consensus 405 86.53
PF14815114 NUDIX_4: NUDIX domain; PDB: 1VRL_A 1RRQ_A 3G0Q_A 3 86.52
KOG4548|consensus263 84.79
COG1443185 Idi Isopentenyldiphosphate isomerase [Lipid metabo 84.48
COG4112203 Predicted phosphoesterase (MutT family) [General f 82.01
>PF05026 DCP2: Dcp2, box A domain; InterPro: IPR007722 This presumed domain is always found to the N-terminal side of the NUDIX hydrolase domain IPR000086 from INTERPRO Back     alignment and domain information 
Probab=100.00  E-value=1.4e-40  Score=246.98  Aligned_cols=85  Identities=48%  Similarity=0.850  Sum_probs=76.0

Q ss_pred             hHHHHhhhhhhcccCCcccccchhHHHHHHhhhhhhhhhcccccCccCcccCHHHHHHHHHhhCCcchhhhhhhhhHHHH
Q psy13064         13 KDILDDLSSRFVINIPHEERGDVIRICFQMELAYWFYLDFYCTQDESLFKAGLKEFFFQMFHHIPSLTHFARKIDTVLDD   92 (192)
Q Consensus        13 ~~ilddl~~RFiiN~P~ee~~~~~rl~fqie~A~WfY~Df~~~~~~~lp~~~~~~F~~~lf~~~p~l~~~~~~~~~~~~~   92 (192)
                      ++|||||++|||+|+|++|++|++|||||||+|||||+||+|+++|+||++++++|+++||+|||.|+++..++++++++
T Consensus         1 ~~iLdDL~~RFI~N~P~eel~~~eRl~FqiE~AhWfY~Df~~~~~p~Lp~~~lk~F~~~if~~cp~L~~~~~~~~~~~~~   80 (85)
T PF05026_consen    1 EEILDDLCSRFILNLPEEELSSFERLCFQIEEAHWFYEDFYREQNPSLPSMSLKEFAKQIFQHCPLLRPFTGNHDEALKK   80 (85)
T ss_dssp             -HHHHHHHHHHTTTS-CCCST-HHHHHHHHHHHHHHHHHTTTTTTTTS----HHHHHHHHHTT-GHHCCCCCHCHHHHHH
T ss_pred             CcHHHHHHHHHHhcCCHHHHccHHHHHHHHHHHHHHHHHHhhhhcCCCCCCCHHHHHHHHHHHCHhHHHhhccHHHHHHH
Confidence            58999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhcc
Q psy13064         93 WRHYK   97 (192)
Q Consensus        93 ~~~y~   97 (192)
                      |++||
T Consensus        81 f~~YK   85 (85)
T PF05026_consen   81 FKKYK   85 (85)
T ss_dssp             HHHHS
T ss_pred             HHccC
Confidence            99997

This domain appears to be specific to mRNA decapping protein 2 P53550 from SWISSPROT and its close homologues. This region has been termed Box A [].; GO: 0003723 RNA binding, 0016787 hydrolase activity, 0030145 manganese ion binding; PDB: 2QKM_H 2A6T_B 2QKL_B.
>KOG2937|consensus Back     alignment and domain information
>cd03672 Dcp2p mRNA decapping enzyme 2 (Dcp2p), the catalytic subunit, and Dcp1p are the two components of the decapping enzyme complex Back     alignment and domain information
>cd04679 Nudix_Hydrolase_20 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04696 Nudix_Hydrolase_37 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK09438 nudB dihydroneopterin triphosphate pyrophosphatase; Provisional Back     alignment and domain information
>cd03673 Ap6A_hydrolase Diadenosine hexaphosphate (Ap6A) hydrolase is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>cd03674 Nudix_Hydrolase_1 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03671 Ap4A_hydrolase_plant_like Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>cd04670 Nudix_Hydrolase_12 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04684 Nudix_Hydrolase_25 Contains a crystal structure of the Nudix hydrolase from Enterococcus faecalis, which has an unknown function Back     alignment and domain information
>cd04700 DR1025_like DR1025 from Deinococcus radiodurans, a member of the Nudix hydrolase superfamily, show nucleoside triphosphatase and dinucleoside polyphosphate pyrophosphatase activities Back     alignment and domain information
>cd03430 GDPMH GDP-mannose glycosyl hydrolase (AKA GDP-mannose mannosyl hydrolase (GDPMH)) is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>cd04680 Nudix_Hydrolase_21 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04669 Nudix_Hydrolase_11 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04666 Nudix_Hydrolase_9 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04677 Nudix_Hydrolase_18 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04671 Nudix_Hydrolase_13 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04676 Nudix_Hydrolase_17 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04511 Nudix_Hydrolase_4 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PF00293 NUDIX: NUDIX domain; InterPro: IPR000086 The generic name 'NUDIX hydrolases' (NUcleoside DIphosphate linked to some other moiety X) has been coined for this domain family [] Back     alignment and domain information
>cd04691 Nudix_Hydrolase_32 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK15434 GDP-mannose mannosyl hydrolase NudD; Provisional Back     alignment and domain information
>cd04673 Nudix_Hydrolase_15 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04678 Nudix_Hydrolase_19 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>COG1051 ADP-ribose pyrophosphatase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd04672 Nudix_Hydrolase_14 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04687 Nudix_Hydrolase_28 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03428 Ap4A_hydrolase_human_like Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>cd03427 MTH1 MutT homolog-1 (MTH1) is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>PLN02325 nudix hydrolase Back     alignment and domain information
>cd04686 Nudix_Hydrolase_27 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04681 Nudix_Hydrolase_22 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04690 Nudix_Hydrolase_31 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03424 ADPRase_NUDT5 ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose and a variety of additional ADP-sugar conjugates to AMP and ribose-5-phosphate Back     alignment and domain information
>PRK15472 nucleoside triphosphatase NudI; Provisional Back     alignment and domain information
>cd04699 Nudix_Hydrolase_39 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>KOG0648|consensus Back     alignment and domain information
>cd04683 Nudix_Hydrolase_24 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04682 Nudix_Hydrolase_23 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK00714 RNA pyrophosphohydrolase; Reviewed Back     alignment and domain information
>cd04695 Nudix_Hydrolase_36 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03675 Nudix_Hydrolase_2 Contains a crystal structure of the Nudix hydrolase from Nitrosomonas europaea, which has an unknown function Back     alignment and domain information
>cd04689 Nudix_Hydrolase_30 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04667 Nudix_Hydrolase_10 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04664 Nudix_Hydrolase_7 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04688 Nudix_Hydrolase_29 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03429 NADH_pyrophosphatase NADH pyrophosphatase, a member of the Nudix hydrolase superfamily, catalyzes the cleavage of NADH into reduced nicotinamide mononucleotide (NMNH) and AMP Back     alignment and domain information
>KOG2937|consensus Back     alignment and domain information
>cd04661 MRP_L46 Mitochondrial ribosomal protein L46 (MRP L46) is a component of the large subunit (39S) of the mammalian mitochondrial ribosome and a member of the Nudix hydrolase superfamily Back     alignment and domain information
>cd04693 Nudix_Hydrolase_34 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04662 Nudix_Hydrolase_5 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK10546 pyrimidine (deoxy)nucleoside triphosphate pyrophosphohydrolase; Provisional Back     alignment and domain information
>cd03426 CoAse Coenzyme A pyrophosphatase (CoAse), a member of the Nudix hydrolase superfamily, functions to catalyze the elimination of oxidized inactive CoA, which can inhibit CoA-utilizing enzymes Back     alignment and domain information
>PRK10776 nucleoside triphosphate pyrophosphohydrolase; Provisional Back     alignment and domain information
>TIGR00052 nudix-type nucleoside diphosphatase, YffH/AdpP family Back     alignment and domain information
>PRK11762 nudE adenosine nucleotide hydrolase NudE; Provisional Back     alignment and domain information
>cd04674 Nudix_Hydrolase_16 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04697 Nudix_Hydrolase_38 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd02883 Nudix_Hydrolase Nudix hydrolase is a superfamily of enzymes found in all three kingdoms of life, and it catalyzes the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>TIGR00586 mutt mutator mutT protein Back     alignment and domain information
>cd03425 MutT_pyrophosphohydrolase The MutT pyrophosphohydrolase is a prototypical Nudix hydrolase that catalyzes the hydrolysis of nucleoside and deoxynucleoside triphosphates (NTPs and dNTPs) by substitution at a beta-phosphorus to yield a nucleotide monophosphate (NMP) and inorganic pyrophosphate (PPi) Back     alignment and domain information
>cd04685 Nudix_Hydrolase_26 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK10729 nudF ADP-ribose pyrophosphatase NudF; Provisional Back     alignment and domain information
>PRK05379 bifunctional nicotinamide mononucleotide adenylyltransferase/ADP-ribose pyrophosphatase; Provisional Back     alignment and domain information
>cd04694 Nudix_Hydrolase_35 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>KOG2839|consensus Back     alignment and domain information
>cd04665 Nudix_Hydrolase_8 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd02885 IPP_Isomerase Isopentenyl diphosphate (IPP) isomerase, a member of the Nudix hydrolase superfamily, is a key enzyme in the isoprenoid biosynthetic pathway Back     alignment and domain information
>PRK00241 nudC NADH pyrophosphatase; Reviewed Back     alignment and domain information
>cd04692 Nudix_Hydrolase_33 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>TIGR02705 nudix_YtkD nucleoside triphosphatase YtkD Back     alignment and domain information
>COG0494 MutT NTP pyrophosphohydrolases including oxidative damage repair enzymes [DNA replication, recombination, and repair / General function prediction only] Back     alignment and domain information
>PRK15393 NUDIX hydrolase YfcD; Provisional Back     alignment and domain information
>PRK03759 isopentenyl-diphosphate delta-isomerase; Provisional Back     alignment and domain information
>cd04663 Nudix_Hydrolase_6 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK10707 putative NUDIX hydrolase; Provisional Back     alignment and domain information
>PRK15009 GDP-mannose pyrophosphatase NudK; Provisional Back     alignment and domain information
>TIGR02150 IPP_isom_1 isopentenyl-diphosphate delta-isomerase, type 1 Back     alignment and domain information
>PRK08999 hypothetical protein; Provisional Back     alignment and domain information
>PLN03143 nudix hydrolase; Provisional Back     alignment and domain information
>cd03670 ADPRase_NUDT9 ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose to AMP and ribose-5-P Back     alignment and domain information
>KOG3084|consensus Back     alignment and domain information
>PLN02709 nudix hydrolase Back     alignment and domain information
>cd03676 Nudix_hydrolase_3 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>KOG3041|consensus Back     alignment and domain information
>COG4119 Predicted NTP pyrophosphohydrolase [DNA replication, recombination, and repair / General function prediction only] Back     alignment and domain information
>PLN02791 Nudix hydrolase homolog Back     alignment and domain information
>COG2816 NPY1 NTP pyrophosphohydrolases containing a Zn-finger, probably nucleic-acid-binding [DNA replication, recombination, and repair] Back     alignment and domain information
>PLN02552 isopentenyl-diphosphate delta-isomerase Back     alignment and domain information
>KOG3069|consensus Back     alignment and domain information
>cd03431 DNA_Glycosylase_C DNA glycosylase (MutY in bacteria and hMYH in humans) is responsible for repairing misread A*oxoG residues to C*G by removing the inappropriately paired adenine base from the DNA backbone Back     alignment and domain information
>PF13869 NUDIX_2: Nucleotide hydrolase; PDB: 3MDG_B 2J8Q_B 3Q2S_A 3P5T_D 3BAP_A 2CL3_A 3P6Y_A 3Q2T_B 3BHO_A 3N9U_A Back     alignment and domain information
>KOG4195|consensus Back     alignment and domain information
>KOG1689|consensus Back     alignment and domain information
>PLN02839 nudix hydrolase Back     alignment and domain information
>KOG4432|consensus Back     alignment and domain information
>PF14815 NUDIX_4: NUDIX domain; PDB: 1VRL_A 1RRQ_A 3G0Q_A 3FSQ_A 1RRS_A 3FSP_A Back     alignment and domain information
>KOG4548|consensus Back     alignment and domain information
>COG1443 Idi Isopentenyldiphosphate isomerase [Lipid metabolism] Back     alignment and domain information
>COG4112 Predicted phosphoesterase (MutT family) [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query192
2qkm_B 266 The Crystal Structure Of Fission Yeast Mrna Decappi 4e-27
2a6t_A 271 Crystal Structure Of S.Pombe Mrna Decapping Enzyme 4e-27
2qkl_B95 The Crystal Structure Of Fission Yeast Mrna Decappi 4e-15
2jvb_A146 Solution Structure Of Catalytic Domain Of Ydcp2 Len 2e-08
>pdb|2QKM|B Chain B, The Crystal Structure Of Fission Yeast Mrna Decapping Enzyme Dcp1-Dcp2 Complex Length = 266 Back     alignment and structure 
Iteration: 1

 Score =  117 bits (293), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 61/170 (35%), Positives = 92/170 (54%), Gaps = 36/170 (21%)
Query: 15  ILDDLSSRFVINIPHEERGDVIRICFQMELAYWFYLDFYCTQDESLFKAGLKEFFFQMFH 74
           +LDDLS+RF++N+P EE+  V R+CFQ+E A+WFY DF   Q++ L   GL+ F  ++F 
Sbjct: 11  VLDDLSARFILNLPAEEQSSVERLCFQIEQAHWFYEDFIRAQNDQLPSLGLRVFSAKLFA 70
Query: 75  HIPSLTHFARKIDTVLDDWRHYKQSVPTFGAILIDKSLTQVLLFLRQGLTVLDDWRHYKQ 134
           H P L  +++  +   DD+  YK  +P  GAI++D                         
Sbjct: 71  HCPLLWKWSKVHEEAFDDFLRYKTRIPVRGAIMLD------------------------- 105
Query: 135 SVPTFGAILIDKSLTQVLLVQSFFARASWGFPKGKVNQDEPPMTCAIREV 184
                       S+ Q +LV+ + A + WGFPKGK+++DE  + CAIREV
Sbjct: 106 -----------MSMQQCVLVKGWKASSGWGFPKGKIDKDESDVDCAIREV 144
>pdb|2A6T|A Chain A, Crystal Structure Of S.Pombe Mrna Decapping Enzyme Dcp2p Length = 271 Back     alignment and structure
>pdb|2QKL|B Chain B, The Crystal Structure Of Fission Yeast Mrna Decapping Enzyme Dcp1-Dcp2 Complex Length = 95 Back     alignment and structure
>pdb|2JVB|A Chain A, Solution Structure Of Catalytic Domain Of Ydcp2 Length = 146 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query192
2a6t_A 271 SPAC19A8.12; alpha/beta/alpha, RNA binding protein 5e-48
2qkl_B95 SPAC19A8.12 protein, SPBC3B9.21 protein; protein-p 4e-32
2jvb_A146 Protein PSU1, mRNA-decapping enzyme subunit 2; DCP 5e-16
2pbt_A134 AP4A hydrolase; nudix protein, diadenosine polypho 1e-08
1vcd_A126 NDX1; nudix protein, diadenosine polyphosphate, AP 2e-07
1ktg_A138 Diadenosine tetraphosphate hydrolase; nudix, AMP, 5e-07
4dyw_A157 MUTT/nudix family protein; structural genomics, ni 6e-07
1xsa_A153 BIS(5'-nucleosyl)-tetraphosphatase; nudix enzyme, 1e-06
3h95_A 199 Nucleoside diphosphate-linked moiety X motif 6; NU 2e-06
1sjy_A159 MUTT/nudix family protein; nudix fold, alpha-beta- 2e-06
3id9_A171 MUTT/nudix family protein; hydrolase, protein stru 4e-06
3fjy_A 364 Probable MUTT1 protein; dimer, protein structure i 5e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
3f13_A163 Putative nudix hydrolase family member; structural 2e-05
2azw_A148 MUTT/nudix family protein; MUTT/nudix ,enterococcu 3e-05
2fvv_A194 Diphosphoinositol polyphosphate phosphohydrolase 1 3e-05
3grn_A153 MUTT related protein; structural genomics, hydrola 5e-05
3exq_A161 Nudix family hydrolase; protein structure initiati 6e-05
3gg6_A156 Nudix motif 18, nucleoside diphosphate-linked moie 9e-05
3eds_A153 MUTT/nudix family protein; MUT/nudix protein, prot 1e-04
3fk9_A 188 Mutator MUTT protein; structural genomics, hydrola 1e-04
3fcm_A197 Hydrolase, nudix family; protein structure initiat 1e-04
2dsc_A212 ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP 2e-04
2yyh_A139 MUTT domain, 8-OXO-DGTPase domain; nudix family pr 2e-04
1vhz_A198 ADP compounds hydrolase NUDE; structural genomics; 2e-04
3shd_A153 Phosphatase NUDJ; nudix fold, nudix motif, hydrola 3e-04
1rya_A160 GDP-mannose mannosyl hydrolase; GDP-glucose, nudix 5e-04
2yvp_A182 NDX2, MUTT/nudix family protein; nudix protein, AD 5e-04
3q93_A176 7,8-dihydro-8-oxoguanine triphosphatase; structura 6e-04
2pqv_A154 MUTT/nudix family protein; structu genomics, PSI-2 6e-04
1k2e_A 156 Nudix homolog; nudix/MUTT-like fold, mixed alpha/b 6e-04
3son_A149 Hypothetical nudix hydrolase; structural genomics, 6e-04
>2a6t_A SPAC19A8.12; alpha/beta/alpha, RNA binding protein,hydrolase; 2.50A {Schizosaccharomyces pombe} SCOP: a.242.1.1 d.113.1.7 PDB: 2qkm_B* Length = 271 Back     alignment and structure
 Score =  156 bits (396), Expect = 5e-48
 Identities = 61/172 (35%), Positives = 92/172 (53%), Gaps = 36/172 (20%)

Query: 14  DILDDLSSRFVINIPHEERGDVIRICFQMELAYWFYLDFYCTQDESLFKAGLKEFFFQMF 73
            +LDDLS+RF++N+P EE+  V R+CFQ+E A+WFY DF   Q++ L   GL+ F  ++F
Sbjct: 15  QVLDDLSARFILNLPAEEQSSVERLCFQIEQAHWFYEDFIRAQNDQLPSLGLRVFSAKLF 74

Query: 74  HHIPSLTHFARKIDTVLDDWRHYKQSVPTFGAILIDKSLTQVLLFLRQGLTVLDDWRHYK 133
            H P L  +++  +   DD+  YK  +P  GAI++D S+ Q +L                
Sbjct: 75  AHCPLLWKWSKVHEEAFDDFLRYKTRIPVRGAIMLDMSMQQCVL---------------- 118

Query: 134 QSVPTFGAILIDKSLTQVLLVQSFFARASWGFPKGKVNQDEPPMTCAIREVK 185
                               V+ + A + WGFPKGK+++DE  + CAIREV 
Sbjct: 119 --------------------VKGWKASSGWGFPKGKIDKDESDVDCAIREVY 150
>2qkl_B SPAC19A8.12 protein, SPBC3B9.21 protein; protein-protein complex, hydrolase; 2.33A {Schizosaccharomyces pombe} SCOP: a.242.1.1 Length = 95 Back     alignment and structure
>2jvb_A Protein PSU1, mRNA-decapping enzyme subunit 2; DCP2, mRNA decay, cytoplasm, hydrolase, manganese, metal-binding, mRNA processing; NMR {Saccharomyces cerevisiae} Length = 146 Back     alignment and structure
>1vcd_A NDX1; nudix protein, diadenosine polyphosphate, AP6A, thermus THER HB8, hydrolase, riken structural genomics/proteomics initia RSGI; 1.70A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1vc8_A 1vc9_A* Length = 126 Back     alignment and structure
>1ktg_A Diadenosine tetraphosphate hydrolase; nudix, AMP, magnesium cluster; HET: AMP; 1.80A {Caenorhabditis elegans} SCOP: d.113.1.1 PDB: 1kt9_A* Length = 138 Back     alignment and structure
>4dyw_A MUTT/nudix family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Burkholderia pseudomallei} Length = 157 Back     alignment and structure
>1xsa_A BIS(5'-nucleosyl)-tetraphosphatase; nudix enzyme, human AP4A hydrolase, alpha-beta; NMR {Homo sapiens} SCOP: d.113.1.1 PDB: 1xsb_A 1xsc_A* Length = 153 Back     alignment and structure
>3h95_A Nucleoside diphosphate-linked moiety X motif 6; NUDT6, nudix, hydrolase, GFG, GFG-1, FGF2AS, structural GENO structural genomics consortium, SGC; HET: FLC; 1.70A {Homo sapiens} Length = 199 Back     alignment and structure
>1sjy_A MUTT/nudix family protein; nudix fold, alpha-beta-alpha sandwich, structural genomics, BSGC structure funded by NIH; 1.39A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1soi_A 1su2_A* 1sz3_A* Length = 159 Back     alignment and structure
>3id9_A MUTT/nudix family protein; hydrolase, protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.55A {Bacillus thuringiensis str} Length = 171 Back     alignment and structure
>3fjy_A Probable MUTT1 protein; dimer, protein structure initiative II), NYSGXRC, 11181H, structural genomics; 2.15A {Bifidobacterium adolescentis atcc 1570ORGANISM_TAXID} Length = 364 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3f13_A Putative nudix hydrolase family member; structural genomics, PSI-2, protein structure initiative; 1.70A {Chromobacterium violaceum} Length = 163 Back     alignment and structure
>2azw_A MUTT/nudix family protein; MUTT/nudix ,enterococcus faecalis, structural genomics, PSI, structure initiative; HET: 1PE; 1.90A {Enterococcus faecalis} SCOP: d.113.1.1 Length = 148 Back     alignment and structure
>2fvv_A Diphosphoinositol polyphosphate phosphohydrolase 1; nudix, inositol polyphosphate metabolism, structural genomics, structural genomics consortium; HET: IHP; 1.25A {Homo sapiens} SCOP: d.113.1.1 PDB: 2q9p_A* 2duk_A 3mcf_A* Length = 194 Back     alignment and structure
>3grn_A MUTT related protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 1.70A {Methanosarcina mazei} Length = 153 Back     alignment and structure
>3exq_A Nudix family hydrolase; protein structure initiative II(PSI II), NYSGXRC, 11180K, structural genomics; 2.00A {Lactobacillus brevis atcc 367} Length = 161 Back     alignment and structure
>3gg6_A Nudix motif 18, nucleoside diphosphate-linked moiety X motif 18; NUDT18, NXR1, nucleotide hydrolase, hydrolase, structural genomics; 2.10A {Homo sapiens} Length = 156 Back     alignment and structure
>3fk9_A Mutator MUTT protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.50A {Bacillus halodurans} Length = 188 Back     alignment and structure
>3fcm_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, 11180J, structural genomics; 2.20A {Clostridium perfringens atcc 13124} Length = 197 Back     alignment and structure
>2dsc_A ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP-ribose pyrophosphatase, NUDT5, hydrolase; HET: APR; 2.00A {Homo sapiens} PDB: 2dsd_A* 3bm4_A* 2dsb_A 3aca_A* 3ac9_A* 3l85_A* Length = 212 Back     alignment and structure
>2yyh_A MUTT domain, 8-OXO-DGTPase domain; nudix family protein, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.80A {Aquifex aeolicus} Length = 139 Back     alignment and structure
>1vhz_A ADP compounds hydrolase NUDE; structural genomics; HET: APR; 2.32A {Escherichia coli} SCOP: d.113.1.1 PDB: 1vhg_A* Length = 198 Back     alignment and structure
>3shd_A Phosphatase NUDJ; nudix fold, nudix motif, hydrolase, (D)NDP/(D)NTP binding, dephosphorylation; 2.50A {Escherichia coli} PDB: 3dku_A Length = 153 Back     alignment and structure
>1rya_A GDP-mannose mannosyl hydrolase; GDP-glucose, nudix, nudix Mg-complex; HET: GDP; 1.30A {Escherichia coli} SCOP: d.113.1.5 PDB: 2gt2_A 2gt4_A* 2i8t_A* 2i8u_A* Length = 160 Back     alignment and structure
>2yvp_A NDX2, MUTT/nudix family protein; nudix protein, ADP-ribose, FAD, hydrol structural genomics, NPPSFA; HET: RBY; 1.66A {Thermus thermophilus} PDB: 2yvn_A 2yvm_A* 2yvo_A* Length = 182 Back     alignment and structure
>3q93_A 7,8-dihydro-8-oxoguanine triphosphatase; structural genomics, structural genomics consortium, SGC, NU MUTT-like, hydrolase, magnesium binding; 1.80A {Homo sapiens} PDB: 1iry_A 3zr0_A* 3zr1_A Length = 176 Back     alignment and structure
>2pqv_A MUTT/nudix family protein; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 1.63A {Streptococcus pneumoniae} Length = 154 Back     alignment and structure
>1k2e_A Nudix homolog; nudix/MUTT-like fold, mixed alpha/beta, dimer, putative NUDI hydrolase, structural genomics, unknown function; 1.80A {Pyrobaculum aerophilum} SCOP: d.113.1.1 PDB: 1jrk_A 1k26_A Length = 156 Back     alignment and structure
>3son_A Hypothetical nudix hydrolase; structural genomics, joint center for structural GENO JCSG, protein structure initiative, PSI-biology; HET: MSE; 1.71A {Listeria monocytogenes} Length = 149 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query192
2a6t_A 271 SPAC19A8.12; alpha/beta/alpha, RNA binding protein 100.0
2qkl_B95 SPAC19A8.12 protein, SPBC3B9.21 protein; protein-p 100.0
3i7u_A134 AP4A hydrolase; nudix protein, diadenosine polypho 99.61
3u53_A155 BIS(5'-nucleosyl)-tetraphosphatase [asymmetrical]; 99.61
3q1p_A205 Phosphohydrolase (MUTT/nudix family protein); asym 99.58
2yyh_A139 MUTT domain, 8-OXO-DGTPase domain; nudix family pr 99.58
2jvb_A146 Protein PSU1, mRNA-decapping enzyme subunit 2; DCP 99.56
2o1c_A150 DATP pyrophosphohydrolase; nudix NTP hydrolase NTP 99.54
1ktg_A138 Diadenosine tetraphosphate hydrolase; nudix, AMP, 99.5
2pbt_A134 AP4A hydrolase; nudix protein, diadenosine polypho 99.49
3f6a_A159 Hydrolase, nudix family; protein structure initiat 99.49
3o8s_A206 Nudix hydrolase, ADP-ribose pyrophosphatase; struc 99.49
3fcm_A197 Hydrolase, nudix family; protein structure initiat 99.48
3i9x_A187 MUTT/nudix family protein; structural genomics, hy 99.47
1k2e_A 156 Nudix homolog; nudix/MUTT-like fold, mixed alpha/b 99.47
2w4e_A145 MUTT/nudix family protein; ADP-ribose pyrophosphat 99.47
1f3y_A165 Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase 99.47
3gwy_A140 Putative CTP pyrophosphohydrolase; structural geno 99.47
2azw_A148 MUTT/nudix family protein; MUTT/nudix ,enterococcu 99.46
3h95_A 199 Nucleoside diphosphate-linked moiety X motif 6; NU 99.45
3grn_A153 MUTT related protein; structural genomics, hydrola 99.45
1rya_A160 GDP-mannose mannosyl hydrolase; GDP-glucose, nudix 99.45
2fvv_A194 Diphosphoinositol polyphosphate phosphohydrolase 1 99.45
1vcd_A126 NDX1; nudix protein, diadenosine polyphosphate, AP 99.44
3id9_A171 MUTT/nudix family protein; hydrolase, protein stru 99.44
3son_A149 Hypothetical nudix hydrolase; structural genomics, 99.43
3eds_A153 MUTT/nudix family protein; MUT/nudix protein, prot 99.43
3gg6_A156 Nudix motif 18, nucleoside diphosphate-linked moie 99.43
1sjy_A159 MUTT/nudix family protein; nudix fold, alpha-beta- 99.43
3cng_A189 Nudix hydrolase; structural genomics, APC7497, PSI 99.42
4dyw_A157 MUTT/nudix family protein; structural genomics, ni 99.42
2fb1_A 226 Conserved hypothetical protein; structural genomic 99.42
1v8y_A170 ADP-ribose pyrophosphatase; nudix motif, loop-heli 99.42
3o6z_A191 GDP-mannose pyrophosphatase NUDK; nudix, hydrolase 99.39
2yvp_A182 NDX2, MUTT/nudix family protein; nudix protein, AD 99.39
3r03_A144 Nudix hydrolase; structural genomics, PSI2, protei 99.39
3shd_A153 Phosphatase NUDJ; nudix fold, nudix motif, hydrola 99.39
2kdv_A 164 RNA pyrophosphohydrolase; nudix family, magnesium, 99.39
3exq_A161 Nudix family hydrolase; protein structure initiati 99.39
2b0v_A153 Nudix hydrolase; structural genomics, PSI, protein 99.37
1g0s_A209 Hypothetical 23.7 kDa protein in ICC-TOLC intergen 99.37
1mut_A129 MUTT, nucleoside triphosphate pyrophosphohydrolase 99.36
3ees_A153 Probable pyrophosphohydrolase; nudix, RNA pyrophos 99.35
3f13_A163 Putative nudix hydrolase family member; structural 99.35
3q93_A176 7,8-dihydro-8-oxoguanine triphosphatase; structura 99.35
2rrk_A140 ORF135, CTP pyrophosphohydrolase; NMR {Escherichia 99.34
2b06_A155 MUTT/nudix family protein; structural genomics, P 99.34
3oga_A165 Nucleoside triphosphatase NUDI; salmonella enteric 99.34
3hhj_A158 Mutator MUTT protein; niaid, ssgcid, decode, UW, S 99.34
2pqv_A154 MUTT/nudix family protein; structu genomics, PSI-2 99.33
2fkb_A180 Putative nudix hydrolase YFCD; putative protein, M 99.31
1vhz_A198 ADP compounds hydrolase NUDE; structural genomics; 99.31
2fml_A 273 MUTT/nudix family protein; structural genomics, PS 99.31
1hzt_A190 Isopentenyl diphosphate delta-isomerase; dimethyla 99.3
2qjt_B352 Nicotinamide-nucleotide adenylyltransferase; two i 99.3
3q91_A218 Uridine diphosphate glucose pyrophosphatase; struc 99.3
1nqz_A194 COA pyrophosphatase (MUTT/nudix family protein); D 99.29
1q27_A171 Putative nudix hydrolase DR0079; radiation resista 99.28
2qjo_A341 Bifunctional NMN adenylyltransferase/nudix hydrol; 99.28
3gz5_A 240 MUTT/nudix family protein; DNA binding protein, nu 99.28
1mk1_A 207 ADPR pyrophosphatase; nudix hydrolase, adprase, ad 99.27
2dsc_A212 ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP 99.22
1vk6_A269 NADH pyrophosphatase; 1790429, structural genomics 99.2
1x51_A155 A/G-specific adenine DNA glycosylase; nudix domain 99.16
3bho_A208 Cleavage and polyadenylation specificity factor su 99.12
1u20_A 212 U8 snoRNA-binding protein X29; modified nudix hydr 99.1
3e57_A211 Uncharacterized protein TM1382; structural genomic 99.07
3fjy_A 364 Probable MUTT1 protein; dimer, protein structure i 99.04
1q33_A 292 Pyrophosphatase, ADP-ribose pyrophosphatase; nudix 98.99
3qsj_A 232 Nudix hydrolase; structural genomics, PSI-biology, 98.95
2xsq_A 217 U8 snoRNA-decapping enzyme; hydrolase, mRNA decapp 98.9
3fsp_A369 A/G-specific adenine glycosylase; protein-DNA comp 98.84
2dho_A 235 Isopentenyl-diphosphate delta-isomerase 1; alpha/b 98.66
2pny_A 246 Isopentenyl-diphosphate delta-isomerase 2; caroten 98.64
3kvh_A 214 Protein syndesmos; NUDT16-like, NUDT16L1, nudix, R 98.61
3rh7_A321 Hypothetical oxidoreductase; FMN-binding split bar 98.22
3dup_A 300 MUTT/nudix family protein; nudix superfamily hydro 98.19
3fxt_A113 Nucleoside diphosphate-linked moiety X motif 6; nu 96.49
>2a6t_A SPAC19A8.12; alpha/beta/alpha, RNA binding protein,hydrolase; 2.50A {Schizosaccharomyces pombe} SCOP: a.242.1.1 d.113.1.7 PDB: 2qkm_B* Back     alignment and structure
Probab=100.00  E-value=1.7e-47  Score=329.85  Aligned_cols=148  Identities=41%  Similarity=0.748  Sum_probs=134.6

Q ss_pred             CCCCCchHHHHhhhhhhcccCCcccccchhHHHHHHhhhhhhhhhcccccCccCcccCHHHHHHHHHhhCCcchhhhhhh
Q psy13064          7 KPYTIRKDILDDLSSRFVINIPHEERGDVIRICFQMELAYWFYLDFYCTQDESLFKAGLKEFFFQMFHHIPSLTHFARKI   86 (192)
Q Consensus         7 ~~~~~~~~ilddl~~RFiiN~P~ee~~~~~rl~fqie~A~WfY~Df~~~~~~~lp~~~~~~F~~~lf~~~p~l~~~~~~~   86 (192)
                      .....++++|||||+|||+|+|++|+++++|||||||+|||||+||++.++|++|+++++.|+.++|+|||.+.+|....
T Consensus         8 ~~~~~~~~~l~dl~~rfi~n~p~~~~~~~~~~~f~ie~a~wfy~d~~~~~~~~~p~~~~~~f~~~~f~~~~~l~~~~~~~   87 (271)
T 2a6t_A            8 FTNATFSQVLDDLSARFILNLPAEEQSSVERLCFQIEQAHWFYEDFIRAQNDQLPSLGLRVFSAKLFAHCPLLWKWSKVH   87 (271)
T ss_dssp             CSCCCTHHHHHHHHHHHTTTSCGGGTTCHHHHHHHHHHHHHHHHHTHHHHCSSSCCCCHHHHHHHHHTTCHHHHHC---C
T ss_pred             cCCCCHHHHHHHHHHHHhhcCCHHHhccHHHHHHHHHHHHHHHHHhhhhcccCCCcccHHHHHHHHhhhhhhhhcccccc
Confidence            34568899999999999999999999999999999999999999999999999999999999999999999999998877


Q ss_pred             hhHHHHhhhccccccccceeeeccchhhhhHhhhhhhhhhhhhhhcccccceEEEEEEeCCCCEEEEEEEeCCCCcEEcC
Q psy13064         87 DTVLDDWRHYKQSVPTFGAILIDKSLTQVLLFLRQGLTVLDDWRHYKQSVPTFGAILIDKSLTQVLLVQSFFARASWGFP  166 (192)
Q Consensus        87 ~~~~~~~~~y~~~vp~~~~i~~~~~~~~~~~v~~~~~~~l~~~~~Y~~~ip~~GaIi~n~~~~kVLLVk~~~~~~~W~fP  166 (192)
                      +..+.+|+.|+..|++                                    +|||+++++.++|||++++..++.|+||
T Consensus        88 ~~~~~~~~~~~~~v~~------------------------------------v~avv~~~~~~~vLLv~r~~~~g~W~lP  131 (271)
T 2a6t_A           88 EEAFDDFLRYKTRIPV------------------------------------RGAIMLDMSMQQCVLVKGWKASSGWGFP  131 (271)
T ss_dssp             CHHHHHHHHHSCCCCE------------------------------------EEEEEBCSSSSEEEEEEESSTTCCCBCS
T ss_pred             hhHHHHHHhcCCCCCe------------------------------------EEEEEEECCCCEEEEEEEeCCCCeEECC
Confidence            8888888888777776                                    9999999766899999987556889999


Q ss_pred             ceecCCCCCHHHHHHHHHHHHhcc
Q psy13064        167 KGKVNQDEPPMTCAIREVKIIFCQ  190 (192)
Q Consensus       167 kGkie~gEs~~ecAiREv~EE~g~  190 (192)
                      ||+++.|||+.+||+||++||||=
T Consensus       132 gG~ve~gEs~~eAA~REl~EEtGl  155 (271)
T 2a6t_A          132 KGKIDKDESDVDCAIREVYEETGF  155 (271)
T ss_dssp             EEECCTTCCHHHHHHHHHHHHHCC
T ss_pred             cccCCCCcCHHHHHHHHHHHHhCC
Confidence            999999999999999999999994
>2qkl_B SPAC19A8.12 protein, SPBC3B9.21 protein; protein-protein complex, hydrolase; 2.33A {Schizosaccharomyces pombe} SCOP: a.242.1.1 Back     alignment and structure
>3i7u_A AP4A hydrolase; nudix protein, diadenosine polyphosphate, S genomics, NPPSFA, national project on protein structural AN functional analyses; HET: PGE PG4; 1.80A {Aquifex aeolicus} PDB: 3i7v_A* Back     alignment and structure
>3u53_A BIS(5'-nucleosyl)-tetraphosphatase [asymmetrical]; hydrolase; 2.71A {Homo sapiens} PDB: 1xsa_A 1xsb_A 1xsc_A* Back     alignment and structure
>3q1p_A Phosphohydrolase (MUTT/nudix family protein); asymmetric dimer, RNA exonuclease, CDP-CHO pyrophosphatase; 1.80A {Bacillus cereus} PDB: 3q4i_A Back     alignment and structure
>2yyh_A MUTT domain, 8-OXO-DGTPase domain; nudix family protein, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.80A {Aquifex aeolicus} Back     alignment and structure
>2jvb_A Protein PSU1, mRNA-decapping enzyme subunit 2; DCP2, mRNA decay, cytoplasm, hydrolase, manganese, metal-binding, mRNA processing; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2o1c_A DATP pyrophosphohydrolase; nudix NTP hydrolase NTP pyrophosphohydrolase MUTT dihydroneo triphosphate pyrophosphohydrolase folate biosynthesis; 1.80A {Escherichia coli} PDB: 2o5w_A Back     alignment and structure
>1ktg_A Diadenosine tetraphosphate hydrolase; nudix, AMP, magnesium cluster; HET: AMP; 1.80A {Caenorhabditis elegans} SCOP: d.113.1.1 PDB: 1kt9_A* Back     alignment and structure
>3f6a_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.02A {Clostridium perfringens atcc 13124} Back     alignment and structure
>3o8s_A Nudix hydrolase, ADP-ribose pyrophosphatase; structural genomics, joint center for structural genomics, J protein structure initiative; 2.27A {Streptococcus suis} Back     alignment and structure
>3fcm_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, 11180J, structural genomics; 2.20A {Clostridium perfringens atcc 13124} Back     alignment and structure
>3i9x_A MUTT/nudix family protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 2.20A {Listeria innocua} Back     alignment and structure
>1k2e_A Nudix homolog; nudix/MUTT-like fold, mixed alpha/beta, dimer, putative NUDI hydrolase, structural genomics, unknown function; 1.80A {Pyrobaculum aerophilum} SCOP: d.113.1.1 PDB: 1jrk_A 1k26_A Back     alignment and structure
>2w4e_A MUTT/nudix family protein; ADP-ribose pyrophosphatase, hydrolase; 2.00A {Deinococcus radiodurans} Back     alignment and structure
>1f3y_A Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase; enzyme,mixed 4-stranded beta sheet, 2-stranded antiparallel sheet; NMR {Lupinus angustifolius} SCOP: d.113.1.1 PDB: 1jkn_A* Back     alignment and structure
>3gwy_A Putative CTP pyrophosphohydrolase; structural genomics, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Bacteroides fragilis} SCOP: d.113.1.0 Back     alignment and structure
>2azw_A MUTT/nudix family protein; MUTT/nudix ,enterococcus faecalis, structural genomics, PSI, structure initiative; HET: 1PE; 1.90A {Enterococcus faecalis} SCOP: d.113.1.1 Back     alignment and structure
>3h95_A Nucleoside diphosphate-linked moiety X motif 6; NUDT6, nudix, hydrolase, GFG, GFG-1, FGF2AS, structural GENO structural genomics consortium, SGC; HET: FLC; 1.70A {Homo sapiens} Back     alignment and structure
>3grn_A MUTT related protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 1.70A {Methanosarcina mazei} Back     alignment and structure
>1rya_A GDP-mannose mannosyl hydrolase; GDP-glucose, nudix, nudix Mg-complex; HET: GDP; 1.30A {Escherichia coli} SCOP: d.113.1.5 PDB: 2gt2_A 2gt4_A* 2i8t_A* 2i8u_A* Back     alignment and structure
>2fvv_A Diphosphoinositol polyphosphate phosphohydrolase 1; nudix, inositol polyphosphate metabolism, structural genomics, structural genomics consortium; HET: IHP; 1.25A {Homo sapiens} SCOP: d.113.1.1 PDB: 2q9p_A* 2duk_A 3mcf_A* Back     alignment and structure
>1vcd_A NDX1; nudix protein, diadenosine polyphosphate, AP6A, thermus THER HB8, hydrolase, riken structural genomics/proteomics initia RSGI; 1.70A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1vc8_A 1vc9_A* Back     alignment and structure
>3id9_A MUTT/nudix family protein; hydrolase, protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.55A {Bacillus thuringiensis str} Back     alignment and structure
>3son_A Hypothetical nudix hydrolase; structural genomics, joint center for structural GENO JCSG, protein structure initiative, PSI-biology; HET: MSE; 1.71A {Listeria monocytogenes} Back     alignment and structure
>3gg6_A Nudix motif 18, nucleoside diphosphate-linked moiety X motif 18; NUDT18, NXR1, nucleotide hydrolase, hydrolase, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>1sjy_A MUTT/nudix family protein; nudix fold, alpha-beta-alpha sandwich, structural genomics, BSGC structure funded by NIH; 1.39A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1soi_A 1su2_A* 1sz3_A* Back     alignment and structure
>3cng_A Nudix hydrolase; structural genomics, APC7497, PSI-2, protei structure initiative; 2.00A {Nitrosomonas europaea atcc 19718} Back     alignment and structure
>4dyw_A MUTT/nudix family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Burkholderia pseudomallei} Back     alignment and structure
>2fb1_A Conserved hypothetical protein; structural genomics, PSI, protein STRU initiative, midwest center for structural genomics, MCSG; 2.50A {Bacteroides thetaiotaomicron} SCOP: a.4.5.68 d.113.1.6 Back     alignment and structure
>1v8y_A ADP-ribose pyrophosphatase; nudix motif, loop-helix-loop, MUTT family, riken structural genomics/proteomics initiative, RSGI; HET: APR; 1.65A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1v8v_A* 1v8n_A 1v8l_A* 1v8m_A* 1v8i_A 1v8r_A* 1v8s_A* 1v8t_A* 1v8w_A 1v8u_A Back     alignment and structure
>3o6z_A GDP-mannose pyrophosphatase NUDK; nudix, hydrolase, biofilm; 2.05A {Escherichia coli} SCOP: d.113.1.1 PDB: 3o52_A* 1viu_A 3o69_A 3o61_A Back     alignment and structure
>2yvp_A NDX2, MUTT/nudix family protein; nudix protein, ADP-ribose, FAD, hydrol structural genomics, NPPSFA; HET: RBY; 1.66A {Thermus thermophilus} PDB: 2yvn_A 2yvm_A* 2yvo_A* Back     alignment and structure
>3r03_A Nudix hydrolase; structural genomics, PSI2, protein structure INIT NEW YORK SGX research center for structural genomics, nysgx; HET: ADP; 2.49A {Rhodospirillum rubrum} SCOP: d.113.1.0 Back     alignment and structure
>3shd_A Phosphatase NUDJ; nudix fold, nudix motif, hydrolase, (D)NDP/(D)NTP binding, dephosphorylation; 2.50A {Escherichia coli} PDB: 3dku_A Back     alignment and structure
>2kdv_A RNA pyrophosphohydrolase; nudix family, magnesium, manganese, zinc; NMR {Escherichia coli} PDB: 2kdw_A Back     alignment and structure
>3exq_A Nudix family hydrolase; protein structure initiative II(PSI II), NYSGXRC, 11180K, structural genomics; 2.00A {Lactobacillus brevis atcc 367} Back     alignment and structure
>2b0v_A Nudix hydrolase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, U function; 1.55A {Nitrosomonas europaea} SCOP: d.113.1.1 Back     alignment and structure
>1g0s_A Hypothetical 23.7 kDa protein in ICC-TOLC intergenic region; nudix fold, hydrolase; 1.90A {Escherichia coli} SCOP: d.113.1.1 PDB: 1g9q_A* 1ga7_A 1khz_A* 1viq_A Back     alignment and structure
>1mut_A MUTT, nucleoside triphosphate pyrophosphohydrolase; DNA repair; NMR {Escherichia coli} SCOP: d.113.1.1 PDB: 1ppx_A* 1pun_A* 1puq_A* 1pus_A* 1tum_A* 3a6s_A* 3a6t_A* 3a6u_A* 3a6v_A* Back     alignment and structure
>3ees_A Probable pyrophosphohydrolase; nudix, RNA pyrophosphohydrolase; 1.90A {Bdellovibrio bacteriovorus} PDB: 3eeu_A 3ef5_A* 3ffu_A* Back     alignment and structure
>3f13_A Putative nudix hydrolase family member; structural genomics, PSI-2, protein structure initiative; 1.70A {Chromobacterium violaceum} Back     alignment and structure
>3q93_A 7,8-dihydro-8-oxoguanine triphosphatase; structural genomics, structural genomics consortium, SGC, NU MUTT-like, hydrolase, magnesium binding; 1.80A {Homo sapiens} PDB: 1iry_A 3zr0_A* 3zr1_A Back     alignment and structure
>2rrk_A ORF135, CTP pyrophosphohydrolase; NMR {Escherichia coli} Back     alignment and structure
>2b06_A MUTT/nudix family protein; structural genomics, P protein structure initiative, midwest center for structural genomics, MCSG; 1.40A {Streptococcus pneumoniae} SCOP: d.113.1.1 Back     alignment and structure
>3oga_A Nucleoside triphosphatase NUDI; salmonella enterica subsp. enterica serovar typhimurium STR. unknown function; HET: PO4; 1.75A {Salmonella enterica subsp} PDB: 3n77_A Back     alignment and structure
>3hhj_A Mutator MUTT protein; niaid, ssgcid, decode, UW, SBRI, infectious diseases, hydrol structural genomics; 2.10A {Bartonella henselae} Back     alignment and structure
>2pqv_A MUTT/nudix family protein; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 1.63A {Streptococcus pneumoniae} Back     alignment and structure
>2fkb_A Putative nudix hydrolase YFCD; putative protein, MAD, structural genomics, escherichia coli putative nudix hydrolase, PSI; HET: MSE; 2.00A {Escherichia coli K12} SCOP: d.113.1.2 Back     alignment and structure
>1vhz_A ADP compounds hydrolase NUDE; structural genomics; HET: APR; 2.32A {Escherichia coli} SCOP: d.113.1.1 PDB: 1vhg_A* Back     alignment and structure
>2fml_A MUTT/nudix family protein; structural genomics, PSI, protein structure initiative, midwest center structural genomics, MCSG; 2.26A {Enterococcus faecalis} SCOP: a.4.5.68 d.113.1.6 Back     alignment and structure
>1hzt_A Isopentenyl diphosphate delta-isomerase; dimethylallyl, isoprenoids; 1.45A {Escherichia coli} SCOP: d.113.1.2 PDB: 1hx3_A 1r67_A 1x84_A* 1x83_A* 1ppv_A* 1nfz_A* 1nfs_A* 1ppw_A* 1pvf_A 2veh_A* 2vej_A 2vnp_A* 2vnq_A 2g74_A 2g73_A* 2b2k_A 1i9a_A 1q54_A* 1ow2_A* 3hyq_A* Back     alignment and structure
>2qjt_B Nicotinamide-nucleotide adenylyltransferase; two individual domains, hydrolase; HET: AMP; 2.30A {Francisella tularensis} PDB: 2r5w_B Back     alignment and structure
>3q91_A Uridine diphosphate glucose pyrophosphatase; structural genomics, structural genomics consortium, SGC, NU MUTT-like, hydrolase, magnesium binding; 2.70A {Homo sapiens} Back     alignment and structure
>1nqz_A COA pyrophosphatase (MUTT/nudix family protein); D.radiodurans, hydrolase; 1.70A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1nqy_A Back     alignment and structure
>1q27_A Putative nudix hydrolase DR0079; radiation resistance; NMR {Deinococcus radiodurans} SCOP: d.113.1.2 PDB: 2o5f_A Back     alignment and structure
>2qjo_A Bifunctional NMN adenylyltransferase/nudix hydrol; two individual domains, hydrolase; HET: APR NAD; 2.60A {Synechocystis SP} Back     alignment and structure
>3gz5_A MUTT/nudix family protein; DNA binding protein, nudix domain, WHTH domain; 2.20A {Shewanella oneidensis} PDB: 3gz6_A* 3gz8_A* Back     alignment and structure
>1mk1_A ADPR pyrophosphatase; nudix hydrolase, adprase, adenosine DI ribose, RV1700, hydrolase; HET: APR; 2.00A {Mycobacterium tuberculosis} SCOP: d.113.1.1 PDB: 1mp2_A 1mqe_A* 1mqw_A* 1mr2_A* Back     alignment and structure
>2dsc_A ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP-ribose pyrophosphatase, NUDT5, hydrolase; HET: APR; 2.00A {Homo sapiens} PDB: 2dsd_A* 3bm4_A* 2dsb_A 3aca_A* 3ac9_A* 3l85_A* Back     alignment and structure
>1vk6_A NADH pyrophosphatase; 1790429, structural genomics, JCSG, PS protein structure initiative, joint center for structural G hydrolase; HET: MSE; 2.20A {Escherichia coli} SCOP: d.113.1.4 d.113.1.4 g.41.14.1 PDB: 2gb5_A Back     alignment and structure
>1x51_A A/G-specific adenine DNA glycosylase; nudix domain, DNA repair, alpha-3 isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.113.1.3 Back     alignment and structure
>3bho_A Cleavage and polyadenylation specificity factor subunit 5; CPSF5, RNA processing, cleavage factor, diadenosine tetraphosphate, mRNA processing; HET: B4P; 1.80A {Homo sapiens} PDB: 3bap_A 3mdg_A 3mdi_A 2cl3_A 3n9u_A 3q2s_A 3q2t_A 2j8q_A 3p5t_A 3p6y_A Back     alignment and structure
>1u20_A U8 snoRNA-binding protein X29; modified nudix hydrolase fold, hydrolase; 2.10A {Xenopus laevis} SCOP: d.113.1.1 PDB: 2a8t_A* 2a8q_A* 2a8p_A* 2a8r_A* 2a8s_A* Back     alignment and structure
>3e57_A Uncharacterized protein TM1382; structural genomics, nudix hydrolase, PSI-2, protein structure initiative; 1.89A {Thermotoga maritima} Back     alignment and structure
>3fjy_A Probable MUTT1 protein; dimer, protein structure initiative II), NYSGXRC, 11181H, structural genomics; 2.15A {Bifidobacterium adolescentis atcc 1570ORGANISM_TAXID} Back     alignment and structure
>1q33_A Pyrophosphatase, ADP-ribose pyrophosphatase; nudix fold, hydrolase; HET: BGC; 1.81A {Homo sapiens} SCOP: d.113.1.1 PDB: 1qvj_A* Back     alignment and structure
>3qsj_A Nudix hydrolase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 1.70A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>2xsq_A U8 snoRNA-decapping enzyme; hydrolase, mRNA decapping, mRNA turnover, structural genomic consortium, SGC; HET: IMP; 1.72A {Homo sapiens} PDB: 3cou_A 3mgm_A Back     alignment and structure
>3fsp_A A/G-specific adenine glycosylase; protein-DNA complex, DNA glycosylase, transition state analog, DNA repair; HET: NRI; 2.20A {Geobacillus stearothermophilus} PDB: 3fsq_A* 1rrs_A* 1vrl_A* 1rrq_A* 3g0q_A* Back     alignment and structure
>2dho_A Isopentenyl-diphosphate delta-isomerase 1; alpha/beta protein; 1.60A {Homo sapiens} PDB: 2i6k_A* 2icj_A 2ick_A* Back     alignment and structure
>2pny_A Isopentenyl-diphosphate delta-isomerase 2; carotenoid biosynthesis, cholesterol biosynthesis, isomerase isoprene biosynthesis, lipid synthesis; HET: GOL; 1.81A {Homo sapiens} Back     alignment and structure
>3kvh_A Protein syndesmos; NUDT16-like, NUDT16L1, nudix, RNA regulation, RNA structural genomics consortium, SGC, RNA degradation, RNA B protein; 1.70A {Homo sapiens} Back     alignment and structure
>3rh7_A Hypothetical oxidoreductase; FMN-binding split barrel, nudix, structural genomics, joint for structural genomics, JCSG; HET: FMN; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>3dup_A MUTT/nudix family protein; nudix superfamily hydrolase, hydrolase 3 family, structural protein structure initiative, PSI; HET: MSE; 1.80A {Rhodospirillum rubrum atcc 11170} Back     alignment and structure
>3fxt_A Nucleoside diphosphate-linked moiety X motif 6; nudix, NUDT6, GFG, FGF2AS, antisense basic fibroblast growth FGF-2 regulation, hydrolase; 2.30A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 192
d2qklb190 a.242.1.1 (B:2-91) mRNA decapping enzyme Dcp2p, N- 9e-30
d2a6ta2151 d.113.1.7 (A:95-245) mRNA decapping enzyme Dcp2p c 2e-11
d1xsba_153 d.113.1.1 (A:) Diadenosine tetraphosphate hydrolas 4e-07
d1vcda1126 d.113.1.1 (A:1-126) AP6A hydrolase Ndx1 {Thermus t 2e-06
d2azwa1147 d.113.1.1 (A:2-148) Hypothetical protein EF1141 {E 5e-06
d1sjya_158 d.113.1.1 (A:) Hypothetical protein DR1025 {Deinoc 3e-05
d1jkna_165 d.113.1.1 (A:) Diadenosine tetraphosphate hydrolas 4e-05
d2fvva1135 d.113.1.1 (A:8-142) Diphosphoinositol polyphosphat 1e-04
d1irya_156 d.113.1.1 (A:) 7,8-dihydro-8-oxoguanine triphospha 5e-04
d1q33a_ 292 d.113.1.1 (A:) NUDT9 (mitochondrial ADP-ribose pyr 7e-04
d1nqza_187 d.113.1.1 (A:) Coenzyme A pyrophosphatase {Deinoco 0.004
>d2qklb1 a.242.1.1 (B:2-91) mRNA decapping enzyme Dcp2p, N-terminal domain {Schizosaccharomyces pombe [TaxId: 4896]} Length = 90 Back     information, alignment and structure

class: All alpha proteins
fold: Dcp2 domain-like
superfamily: Dcp2 domain-like
family: Dcp2 box A domain
domain: mRNA decapping enzyme Dcp2p, N-terminal domain
species: Schizosaccharomyces pombe [TaxId: 4896]

 Score =  103 bits (258), Expect = 9e-30
 Identities = 34/82 (41%), Positives = 53/82 (64%)

Query: 13 KDILDDLSSRFVINIPHEERGDVIRICFQMELAYWFYLDFYCTQDESLFKAGLKEFFFQM 72
            +LDDLS+RF++N+P EE+  V R+CFQ+E A+WFY DF   Q++ L   GL+ F  ++
Sbjct: 8  SQVLDDLSARFILNLPAEEQSSVERLCFQIEQAHWFYEDFIRAQNDQLPSLGLRVFSAKL 67

Query: 73 FHHIPSLTHFARKIDTVLDDWR 94
          F H P L  +++  +   DD+ 
Sbjct: 68 FAHCPLLWKWSKVHEEAFDDFL 89
>d2a6ta2 d.113.1.7 (A:95-245) mRNA decapping enzyme Dcp2p catalytic domain {Schizosaccharomyces pombe [TaxId: 4896]} Length = 151 Back     information, alignment and structure
>d1xsba_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Human (Homo sapiens) [TaxId: 9606]} Length = 153 Back     information, alignment and structure
>d1vcda1 d.113.1.1 (A:1-126) AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: 274]} Length = 126 Back     information, alignment and structure
>d2azwa1 d.113.1.1 (A:2-148) Hypothetical protein EF1141 {Enterococcus faecalis [TaxId: 1351]} Length = 147 Back     information, alignment and structure
>d1sjya_ d.113.1.1 (A:) Hypothetical protein DR1025 {Deinococcus radiodurans [TaxId: 1299]} Length = 158 Back     information, alignment and structure
>d1jkna_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Narrow-leaved blue lupine (Lupinus angustifolius) [TaxId: 3871]} Length = 165 Back     information, alignment and structure
>d2fvva1 d.113.1.1 (A:8-142) Diphosphoinositol polyphosphate phosphohydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 135 Back     information, alignment and structure
>d1irya_ d.113.1.1 (A:) 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1q33a_ d.113.1.1 (A:) NUDT9 (mitochondrial ADP-ribose pyrophosphatase) {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d1nqza_ d.113.1.1 (A:) Coenzyme A pyrophosphatase {Deinococcus radiodurans [TaxId: 1299]} Length = 187 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query192
d2qklb190 mRNA decapping enzyme Dcp2p, N-terminal domain {Sc 100.0
d2a6ta2151 mRNA decapping enzyme Dcp2p catalytic domain {Schi 99.76
d1jkna_165 Diadenosine tetraphosphate hydrolase (Ap4A hydrola 99.63
d1vcda1126 AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: 99.61
d1ktga_137 Diadenosine tetraphosphate hydrolase (Ap4A hydrola 99.58
d1sjya_158 Hypothetical protein DR1025 {Deinococcus radiodura 99.55
d2azwa1147 Hypothetical protein EF1141 {Enterococcus faecalis 99.54
d2fvva1135 Diphosphoinositol polyphosphate phosphohydrolase { 99.53
d2b06a1155 Hypothetical protein SP1235 (spr1115) {Streptococc 99.52
d1k2ea_152 Hypothetical protein PAE3301 {Archaeon Pyrobaculum 99.52
d2b0va1146 Hypothetical protein NE0184 {Nitrosomonas europaea 99.52
d1puna_129 Nucleoside triphosphate pyrophosphorylase (MutT) { 99.51
d1ryaa_160 GDP-mannose mannosyl hydrolase NudD {Escherichia c 99.5
d1xsba_153 Diadenosine tetraphosphate hydrolase (Ap4A hydrola 99.48
d1vk6a2131 NADH pyrophosphatase {Escherichia coli [TaxId: 562 99.48
d1irya_156 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Hum 99.44
d2fb1a2147 Hypothetical protein BT0354, N-terminal domain {Ba 99.44
d1v8ya_158 ADP-ribose pyrophosphatase {Thermus thermophilus [ 99.4
d2fmla2 202 Hypothetical protein EF2700, N-terminal domain {En 99.38
d1vhza_186 ADP compounds hydrolase NudE {Escherichia coli [Ta 99.34
d1hzta_153 Isopentenyl diphosphate isomerase {Escherichia col 99.3
d1nqza_187 Coenzyme A pyrophosphatase {Deinococcus radioduran 99.29
d1mqea_ 202 ADP-ribose pyrophosphatase {Mycobacterium tubercul 99.27
d2fkba1161 Hypothetical protein YfcD {Escherichia coli [TaxId 99.23
d1g0sa_209 ADP-ribose pyrophosphatase {Escherichia coli [TaxI 99.2
d2o5fa1162 Hypothetical protein DR0079 {Deinococcus radiodura 99.19
d1rrqa2127 Adenine glycosylase MutY, C-terminal domain {Bacil 98.96
d1u20a1 196 U8 snorna-binding protein x29 {African clawed frog 98.91
d1viua_189 ADP-ribose pyrophosphatase homologue YffH {Escheri 98.9
d1q33a_ 292 NUDT9 (mitochondrial ADP-ribose pyrophosphatase) { 98.81
d1x51a1142 A/G-specific adenine DNA glycosylase {Human (Homo 98.06
>d2qklb1 a.242.1.1 (B:2-91) mRNA decapping enzyme Dcp2p, N-terminal domain {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
class: All alpha proteins
fold: Dcp2 domain-like
superfamily: Dcp2 domain-like
family: Dcp2 box A domain
domain: mRNA decapping enzyme Dcp2p, N-terminal domain
species: Schizosaccharomyces pombe [TaxId: 4896]

Probab=100.00  E-value=9e-39  Score=236.60  Aligned_cols=88  Identities=39%  Similarity=0.729  Sum_probs=84.7

Q ss_pred             CCCCchHHHHhhhhhhcccCCcccccchhHHHHHHhhhhhhhhhcccccCccCcccCHHHHHHHHHhhCCcchhhhhhhh
Q psy13064          8 PYTIRKDILDDLSSRFVINIPHEERGDVIRICFQMELAYWFYLDFYCTQDESLFKAGLKEFFFQMFHHIPSLTHFARKID   87 (192)
Q Consensus         8 ~~~~~~~ilddl~~RFiiN~P~ee~~~~~rl~fqie~A~WfY~Df~~~~~~~lp~~~~~~F~~~lf~~~p~l~~~~~~~~   87 (192)
                      ...+.++|||||++|||+|+|++|++|++|||||||+|||||+||+|+.+|+||++++++|+++||+|||.|+|+..+++
T Consensus         3 ~~~~~~eiLdDL~~RFilN~P~eel~~~~rl~FqiE~A~WfY~Df~~~~~p~Lp~~~~~~Fa~~if~~cp~L~~~~~~~~   82 (90)
T d2qklb1           3 TNATFSQVLDDLSARFILNLPAEEQSSVERLCFQIEQAHWFYEDFIRAQNDQLPSLGLRVFSAKLFAHCPLLWKWSKVHE   82 (90)
T ss_dssp             TTCCHHHHHHHHHHHHTTTCCGGGSSCHHHHHHHHHHHHHHHHHTTTTTCTTSCCCCHHHHHHHHHHHCTHHHHHHTCCH
T ss_pred             ccccHHHHHHHHHHHHHHcCCHHHhccHHHHHHHHHHHHHHHHHHhhhccCCCCCCcHHHHHHHHHHHCHHHHhhhhhHH
Confidence            35688999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hHHHHhhh
Q psy13064         88 TVLDDWRH   95 (192)
Q Consensus        88 ~~~~~~~~   95 (192)
                      +++++|.+
T Consensus        83 ~~~~~F~~   90 (90)
T d2qklb1          83 EAFDDFLR   90 (90)
T ss_dssp             HHHHHHHC
T ss_pred             HHHHHHhC
Confidence            99999863
>d2a6ta2 d.113.1.7 (A:95-245) mRNA decapping enzyme Dcp2p catalytic domain {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1jkna_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Narrow-leaved blue lupine (Lupinus angustifolius) [TaxId: 3871]} Back     information, alignment and structure
>d1vcda1 d.113.1.1 (A:1-126) AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ktga_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1sjya_ d.113.1.1 (A:) Hypothetical protein DR1025 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d2azwa1 d.113.1.1 (A:2-148) Hypothetical protein EF1141 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2fvva1 d.113.1.1 (A:8-142) Diphosphoinositol polyphosphate phosphohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b06a1 d.113.1.1 (A:1-155) Hypothetical protein SP1235 (spr1115) {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1k2ea_ d.113.1.1 (A:) Hypothetical protein PAE3301 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2b0va1 d.113.1.1 (A:4-149) Hypothetical protein NE0184 {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d1puna_ d.113.1.1 (A:) Nucleoside triphosphate pyrophosphorylase (MutT) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ryaa_ d.113.1.5 (A:) GDP-mannose mannosyl hydrolase NudD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xsba_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vk6a2 d.113.1.4 (A:126-256) NADH pyrophosphatase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1irya_ d.113.1.1 (A:) 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fb1a2 d.113.1.6 (A:3-149) Hypothetical protein BT0354, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1v8ya_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2fmla2 d.113.1.6 (A:3-204) Hypothetical protein EF2700, N-terminal domain {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1vhza_ d.113.1.1 (A:) ADP compounds hydrolase NudE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hzta_ d.113.1.2 (A:) Isopentenyl diphosphate isomerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nqza_ d.113.1.1 (A:) Coenzyme A pyrophosphatase {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1mqea_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2fkba1 d.113.1.2 (A:8-168) Hypothetical protein YfcD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g0sa_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2o5fa1 d.113.1.2 (A:7-168) Hypothetical protein DR0079 {Deinococcus radiodurans str. R1 (Deinococcus radiodurans R1) [TaxId: 243230]} Back     information, alignment and structure
>d1rrqa2 d.113.1.3 (A:234-360) Adenine glycosylase MutY, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1u20a1 d.113.1.1 (A:14-209) U8 snorna-binding protein x29 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1viua_ d.113.1.1 (A:) ADP-ribose pyrophosphatase homologue YffH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q33a_ d.113.1.1 (A:) NUDT9 (mitochondrial ADP-ribose pyrophosphatase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x51a1 d.113.1.3 (A:8-149) A/G-specific adenine DNA glycosylase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure