Psyllid ID: psy13065


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110----
MMEEIMMNIISEAKQVLEETGFDSSHLIAEDSYLETTYNDQLTRLYLIPGVPIDFKFAPQTRGEIKACQWFPIGDLPSSRKEIKTVLINGTPVGTNAFFMIMPFINSINIAGKL
cccccccccccHHEEHHHHHcccccccccccccEEEEEccEEEEEEEEcccccccccccccccccccEEEEEccccccccccccEEEccccccccccEEEEcccHHHHHHcccc
ccccccccHHHHHHHHHHHHccccccccccccEEEEEEcccEEEEEEEccccccccccccHHHHHHHcEEEEHHHccccccccccccccccccccccEEEEEcccccccccccc
MMEEIMMNIISEAKQVLEetgfdsshliaedsylettyndqltrlylipgvpidfkfapqtrgeikacqwfpigdlpssrKEIKTVLIngtpvgtnaFFMIMPFINSINIAGKL
MMEEIMMNIISEAKQVLEETGFDSSHLIAEDSYLETTYNDQLTRLYLIPGVPIDFKFAPQTRGEIKACQWFPIGDLPSSRKEIKTVLINGTPVGTNAFFMIMPFINSINIAGKL
mmeeimmniiseAKQVLEETGFDSSHLIAEDSYLETTYNDQLTRLYLIPGVPIDFKFAPQTRGEIKACQWFPIGDLPSSRKEIKTVLINGTPVGTNAFFMIMPFINSINIAGKL
*********I****QVLEETGFDSSHLIAEDSYLETTYNDQLTRLYLIPGVPIDFKFAPQTRGEIKACQWFPIGDLPSSRKEIKTVLINGTPVGTNAFFMIMPFINSINI****
**EEIMMNIISEAKQVLEETGFDSSHLIAEDSYLETTYNDQLTRLYLIPGVPIDFKFAPQTRGEIKACQWFPIGDLPS*****************NAFFMIMPFINSINIAG**
MMEEIMMNIISEAKQVLEETGFDSSHLIAEDSYLETTYNDQLTRLYLIPGVPIDFKFAPQTRGEIKACQWFPIGDLPSSRKEIKTVLINGTPVGTNAFFMIMPFINSINIAGKL
****IMMNIISEAKQVLEETGFDSSHLIAEDSYLETTYNDQLTRLYLIPGVPIDFKFAPQTRGEIKACQWFPIGDLPSSR************VGTNAFFMIMPFINSINIA***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMEEIMMNIISEAKQVLEETGFDSSHLIAEDSYLETTYNDQLTRLYLIPGVPIDFKFAPQTRGEIKACQWFPIGDLPSSRKEIKTVLINGTPVGTNAFFMIMPFINSINIAGKL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query114 2.2.26 [Sep-21-2011]
Q9CYC6 422 m7GpppN-mRNA hydrolase OS yes N/A 0.824 0.222 0.479 2e-19
Q5REQ8 385 m7GpppN-mRNA hydrolase OS yes N/A 0.824 0.244 0.468 4e-19
Q8IU60 420 m7GpppN-mRNA hydrolase OS yes N/A 0.824 0.223 0.468 4e-19
O62255 786 mRNA-decapping enzyme 2 O yes N/A 0.807 0.117 0.391 4e-15
O13828 741 mRNA decapping complex su yes N/A 0.745 0.114 0.369 4e-12
Q8GW31 373 mRNA-decapping enzyme sub yes N/A 0.789 0.241 0.357 1e-11
Q75BK1 880 mRNA-decapping enzyme sub yes N/A 0.5 0.064 0.421 1e-08
P53550 970 mRNA-decapping enzyme sub yes N/A 0.675 0.079 0.329 1e-05
A6ZRW5 970 mRNA-decapping enzyme sub N/A N/A 0.675 0.079 0.329 1e-05
>sp|Q9CYC6|DCP2_MOUSE m7GpppN-mRNA hydrolase OS=Mus musculus GN=Dcp2 PE=1 SV=2 Back     alignment and function desciption
 Score = 94.7 bits (234), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 46/96 (47%), Positives = 59/96 (61%), Gaps = 2/96 (2%)

Query: 13  AKQVLEETGFDSSHLIAEDSYLETTYNDQLTRLYLIPGVPIDFKFAPQTRGEIKACQWFP 72
           A++V EETGFD    I +D Y+E   NDQL RLY+IPGVP D KF P+TR EI+  +WF 
Sbjct: 142 AREVFEETGFDIKDYICKDDYIELRINDQLARLYIIPGVPKDTKFNPKTRREIRNIEWFS 201

Query: 73  IGDLPSSRKEIKTVLINGTPVGTNAFFMIMPFINSI 108
           I  LP  R ++      G  +  N FFM +PFI  +
Sbjct: 202 IEKLPCHRNDMTPKSKLG--LAPNKFFMAIPFIRPL 235




Necessary for the degradation of mRNAs, both in normal mRNA turnover and in nonsense-mediated mRNA decay. Plays a role in replication-dependent histone mRNA degradation. Removes the 7-methyl guanine cap structure from mRNA molecules, yielding a 5'-phosphorylated mRNA fragment and 7m-GDP. Has higher activity towards mRNAs that lack a poly(A) tail. Has no activity towards a cap structure lacking an RNA moiety.
Mus musculus (taxid: 10090)
EC: 3EC: .EC: 6EC: .EC: 1EC: .EC: 6EC: 2
>sp|Q5REQ8|DCP2_PONAB m7GpppN-mRNA hydrolase OS=Pongo abelii GN=DCP2 PE=2 SV=1 Back     alignment and function description
>sp|Q8IU60|DCP2_HUMAN m7GpppN-mRNA hydrolase OS=Homo sapiens GN=DCP2 PE=1 SV=2 Back     alignment and function description
>sp|O62255|DCP2_CAEEL mRNA-decapping enzyme 2 OS=Caenorhabditis elegans GN=dcap-2 PE=2 SV=4 Back     alignment and function description
>sp|O13828|DCP2_SCHPO mRNA decapping complex subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dcp2 PE=1 SV=1 Back     alignment and function description
>sp|Q8GW31|DCP2_ARATH mRNA-decapping enzyme subunit 2 OS=Arabidopsis thaliana GN=DCP2 PE=1 SV=1 Back     alignment and function description
>sp|Q75BK1|DCP2_ASHGO mRNA-decapping enzyme subunit 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DCP2 PE=3 SV=1 Back     alignment and function description
>sp|P53550|DCP2_YEAST mRNA-decapping enzyme subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DCP2 PE=1 SV=1 Back     alignment and function description
>sp|A6ZRW5|DCP2_YEAS7 mRNA-decapping enzyme subunit 2 OS=Saccharomyces cerevisiae (strain YJM789) GN=DCP2 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query114
321475287 407 hypothetical protein DAPPUDRAFT_222252 [ 0.815 0.228 0.578 6e-25
91078200 321 PREDICTED: similar to Decapping protein 0.833 0.295 0.515 2e-24
357624398 370 hypothetical protein KGM_19785 [Danaus p 0.824 0.254 0.520 7e-23
328780137 458 PREDICTED: mRNA-decapping enzyme 2 [Apis 0.815 0.203 0.515 4e-21
380022990 453 PREDICTED: mRNA-decapping enzyme 2-like 0.815 0.205 0.515 5e-21
383855990 458 PREDICTED: mRNA-decapping enzyme 2-like 0.789 0.196 0.521 9e-21
350416367 461 PREDICTED: mRNA-decapping enzyme 2-like 0.789 0.195 0.521 9e-21
350416370 451 PREDICTED: mRNA-decapping enzyme 2-like 0.789 0.199 0.521 9e-21
340717104 461 PREDICTED: mRNA-decapping enzyme 2-like 0.789 0.195 0.521 1e-20
340717106 451 PREDICTED: mRNA-decapping enzyme 2-like 0.789 0.199 0.521 1e-20
>gi|321475287|gb|EFX86250.1| hypothetical protein DAPPUDRAFT_222252 [Daphnia pulex] Back     alignment and taxonomy information
 Score =  117 bits (294), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 55/95 (57%), Positives = 74/95 (77%), Gaps = 2/95 (2%)

Query: 14  KQVLEETGFDSSHLIAEDSYLETTYNDQLTRLYLIPGVPIDFKFAPQTRGEIKACQWFPI 73
           ++VLEETGFD SHLI+   +LETT NDQLTRLY+IPGVP + KF P+TR +I+A QWFPI
Sbjct: 159 REVLEETGFDISHLISVKEFLETTVNDQLTRLYIIPGVPHETKFIPRTRNDIRALQWFPI 218

Query: 74  GDLPSSRKEIKTVLINGTPVGTNAFFMIMPFINSI 108
            DLP+S+K+  T +  G  +G+++FFM+ PF+  I
Sbjct: 219 ADLPNSKKDAMTKVRLG--IGSSSFFMVFPFVRLI 251




Source: Daphnia pulex

Species: Daphnia pulex

Genus: Daphnia

Family: Daphniidae

Order: Diplostraca

Class: Branchiopoda

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|91078200|ref|XP_968428.1| PREDICTED: similar to Decapping protein 2 CG6169-PA [Tribolium castaneum] gi|270001356|gb|EEZ97803.1| hypothetical protein TcasGA2_TC000167 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|357624398|gb|EHJ75183.1| hypothetical protein KGM_19785 [Danaus plexippus] Back     alignment and taxonomy information
>gi|328780137|ref|XP_395977.2| PREDICTED: mRNA-decapping enzyme 2 [Apis mellifera] Back     alignment and taxonomy information
>gi|380022990|ref|XP_003695315.1| PREDICTED: mRNA-decapping enzyme 2-like [Apis florea] Back     alignment and taxonomy information
>gi|383855990|ref|XP_003703493.1| PREDICTED: mRNA-decapping enzyme 2-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|350416367|ref|XP_003490925.1| PREDICTED: mRNA-decapping enzyme 2-like isoform 1 [Bombus impatiens] Back     alignment and taxonomy information
>gi|350416370|ref|XP_003490926.1| PREDICTED: mRNA-decapping enzyme 2-like isoform 2 [Bombus impatiens] Back     alignment and taxonomy information
>gi|340717104|ref|XP_003397028.1| PREDICTED: mRNA-decapping enzyme 2-like isoform 1 [Bombus terrestris] Back     alignment and taxonomy information
>gi|340717106|ref|XP_003397029.1| PREDICTED: mRNA-decapping enzyme 2-like isoform 2 [Bombus terrestris] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query114
UNIPROTKB|Q5REQ8 385 DCP2 "m7GpppN-mRNA hydrolase" 0.824 0.244 0.468 5.5e-18
MGI|MGI:1917890 422 Dcp2 "DCP2 decapping enzyme ho 0.824 0.222 0.479 6.2e-18
RGD|1562909 422 Dcp2 "DCP2 decapping enzyme ho 0.824 0.222 0.479 6.2e-18
UNIPROTKB|H0Y9T5 402 DCP2 "m7GpppN-mRNA hydrolase" 0.824 0.233 0.468 6.7e-18
UNIPROTKB|J9NXF9 410 DCP2 "Uncharacterized protein" 0.824 0.229 0.468 7.2e-18
UNIPROTKB|F6Y2G7 412 DCP2 "Uncharacterized protein" 0.824 0.228 0.468 7.3e-18
UNIPROTKB|Q8IU60 420 DCP2 "m7GpppN-mRNA hydrolase" 0.824 0.223 0.468 7.9e-18
UNIPROTKB|J9NVA8 422 DCP2 "Uncharacterized protein" 0.824 0.222 0.468 8e-18
UNIPROTKB|E2QVY2 427 DCP2 "Uncharacterized protein" 0.824 0.220 0.468 8.3e-18
UNIPROTKB|F1RLG6 427 DCP2 "Uncharacterized protein" 0.824 0.220 0.468 8.3e-18
UNIPROTKB|Q5REQ8 DCP2 "m7GpppN-mRNA hydrolase" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
 Score = 222 (83.2 bits), Expect = 5.5e-18, P = 5.5e-18
 Identities = 45/96 (46%), Positives = 59/96 (61%)

Query:    13 AKQVLEETGFDSSHLIAEDSYLETTYNDQLTRLYLIPGVPIDFKFAPQTRGEIKACQWFP 72
             A++V EETGFD    I +D Y+E   NDQL RLY+IPG+P D KF P+TR EI+  +WF 
Sbjct:   142 AREVFEETGFDIKDYICKDDYIELRINDQLARLYIIPGIPKDTKFNPKTRREIRNIEWFS 201

Query:    73 IGDLPSSRKEIKTVLINGTPVGTNAFFMIMPFINSI 108
             I  LP  R ++      G  +  N FFM +PFI  +
Sbjct:   202 IEKLPCHRNDMTPKSKLG--LAPNKFFMAIPFIRPL 235




GO:0006402 "mRNA catabolic process" evidence=ISS
GO:0050072 "m7G(5')pppN diphosphatase activity" evidence=ISS
GO:0071044 "histone mRNA catabolic process" evidence=ISS
MGI|MGI:1917890 Dcp2 "DCP2 decapping enzyme homolog (S. cerevisiae)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1562909 Dcp2 "DCP2 decapping enzyme homolog (S. cerevisiae)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|H0Y9T5 DCP2 "m7GpppN-mRNA hydrolase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J9NXF9 DCP2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F6Y2G7 DCP2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q8IU60 DCP2 "m7GpppN-mRNA hydrolase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J9NVA8 DCP2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E2QVY2 DCP2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1RLG6 DCP2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query114
cd03672145 cd03672, Dcp2p, mRNA decapping enzyme 2 (Dcp2p), t 5e-31
pfam00293133 pfam00293, NUDIX, NUDIX domain 0.002
>gnl|CDD|239644 cd03672, Dcp2p, mRNA decapping enzyme 2 (Dcp2p), the catalytic subunit, and Dcp1p are the two components of the decapping enzyme complex Back     alignment and domain information
 Score =  106 bits (268), Expect = 5e-31
 Identities = 39/96 (40%), Positives = 55/96 (57%), Gaps = 6/96 (6%)

Query: 13  AKQVLEETGFDSSHLIAEDSYLETTYNDQLTRLYLIPGVPIDFKFAPQTRGEIKACQWFP 72
            ++V EETGFD S  I +D Y+E     Q  +LY++PGVP D  F P+TR EI   +WF 
Sbjct: 45  IREVYEETGFDISKYIDKDDYIELIIRGQNVKLYIVPGVPEDTPFEPKTRKEISKIEWFD 104

Query: 73  IGDLPSSRKEIKTVLINGTPVGTNAFFMIMPFINSI 108
           I DLP+ +            + +N FFM++PFI  +
Sbjct: 105 IKDLPTKKN------KKIPGLNSNKFFMVIPFIKPL 134


Decapping is a key step in both general and nonsense-mediated 5'->3' mRNA-decay pathways. Dcp2p contains an all-alpha helical N-terminal domain and a C-terminal domain which has the Nudix fold. While decapping is not dependent on the N-terminus of Dcp2p, it does affect its efficiency. Dcp1p binds the N-terminal domain of Dcp2p stimulating the decapping activity of Dcp2p. Decapping permits the degradation of the transcript and is a site of numerous control inputs. It is responsible for nonsense-mediated decay as well as AU-rich element (ARE)-mediated decay. In addition, it may also play a role in the levels of mRNA. Enzymes belonging to the Nudix superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and are recognized by a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V). Length = 145

>gnl|CDD|215841 pfam00293, NUDIX, NUDIX domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 114
cd03672145 Dcp2p mRNA decapping enzyme 2 (Dcp2p), the catalyt 99.73
cd04679125 Nudix_Hydrolase_20 Members of the Nudix hydrolase 99.38
KOG2937|consensus 348 99.34
cd04680120 Nudix_Hydrolase_21 Members of the Nudix hydrolase 99.32
cd04700142 DR1025_like DR1025 from Deinococcus radiodurans, a 99.31
cd04691117 Nudix_Hydrolase_32 Members of the Nudix hydrolase 99.29
cd04683120 Nudix_Hydrolase_24 Members of the Nudix hydrolase 99.25
cd04678129 Nudix_Hydrolase_19 Members of the Nudix hydrolase 99.24
cd04671123 Nudix_Hydrolase_13 Members of the Nudix hydrolase 99.24
PLN02325144 nudix hydrolase 99.22
cd03427137 MTH1 MutT homolog-1 (MTH1) is a member of the Nudi 99.22
cd04684128 Nudix_Hydrolase_25 Contains a crystal structure of 99.21
cd04661132 MRP_L46 Mitochondrial ribosomal protein L46 (MRP L 99.19
cd04689125 Nudix_Hydrolase_30 Members of the Nudix hydrolase 99.19
cd04672123 Nudix_Hydrolase_14 Members of the Nudix hydrolase 99.18
cd03426157 CoAse Coenzyme A pyrophosphatase (CoAse), a member 99.18
cd03673131 Ap6A_hydrolase Diadenosine hexaphosphate (Ap6A) hy 99.17
cd04673122 Nudix_Hydrolase_15 Members of the Nudix hydrolase 99.17
cd04681130 Nudix_Hydrolase_22 Members of the Nudix hydrolase 99.17
cd04687128 Nudix_Hydrolase_28 Members of the Nudix hydrolase 99.16
cd04670127 Nudix_Hydrolase_12 Members of the Nudix hydrolase 99.15
cd03671147 Ap4A_hydrolase_plant_like Diadenosine tetraphospha 99.15
cd04688126 Nudix_Hydrolase_29 Members of the Nudix hydrolase 99.14
cd04682122 Nudix_Hydrolase_23 Members of the Nudix hydrolase 99.14
cd04669121 Nudix_Hydrolase_11 Members of the Nudix hydrolase 99.14
cd04667112 Nudix_Hydrolase_10 Members of the Nudix hydrolase 99.13
cd04696125 Nudix_Hydrolase_37 Members of the Nudix hydrolase 99.13
cd03430144 GDPMH GDP-mannose glycosyl hydrolase (AKA GDP-mann 99.13
cd03675134 Nudix_Hydrolase_2 Contains a crystal structure of 99.12
cd03424137 ADPRase_NUDT5 ADP-ribose pyrophosphatase (ADPRase) 99.11
cd03674138 Nudix_Hydrolase_1 Members of the Nudix hydrolase s 99.1
PRK15434159 GDP-mannose mannosyl hydrolase NudD; Provisional 99.08
cd04677132 Nudix_Hydrolase_18 Members of the Nudix hydrolase 99.08
cd04690118 Nudix_Hydrolase_31 Members of the Nudix hydrolase 99.08
cd04692144 Nudix_Hydrolase_33 Members of the Nudix hydrolase 99.08
cd04693127 Nudix_Hydrolase_34 Members of the Nudix hydrolase 99.07
PRK00241256 nudC NADH pyrophosphatase; Reviewed 99.06
COG1051145 ADP-ribose pyrophosphatase [Nucleotide transport a 99.06
PRK15393180 NUDIX hydrolase YfcD; Provisional 99.05
cd04697126 Nudix_Hydrolase_38 Members of the Nudix hydrolase 99.04
cd04666122 Nudix_Hydrolase_9 Members of the Nudix hydrolase s 99.03
PRK15472141 nucleoside triphosphatase NudI; Provisional 99.03
cd04695131 Nudix_Hydrolase_36 Members of the Nudix hydrolase 99.02
PF00293134 NUDIX: NUDIX domain; InterPro: IPR000086 The gener 99.0
cd04664129 Nudix_Hydrolase_7 Members of the Nudix hydrolase s 99.0
cd03428130 Ap4A_hydrolase_human_like Diadenosine tetraphospha 99.0
PRK00714156 RNA pyrophosphohydrolase; Reviewed 98.99
cd03429131 NADH_pyrophosphatase NADH pyrophosphatase, a membe 98.99
cd02885165 IPP_Isomerase Isopentenyl diphosphate (IPP) isomer 98.96
cd04699129 Nudix_Hydrolase_39 Members of the Nudix hydrolase 98.95
PRK09438148 nudB dihydroneopterin triphosphate pyrophosphatase 98.94
cd04511130 Nudix_Hydrolase_4 Members of the Nudix hydrolase s 98.93
cd04676129 Nudix_Hydrolase_17 Members of the Nudix hydrolase 98.92
PRK11762185 nudE adenosine nucleotide hydrolase NudE; Provisio 98.87
PRK03759184 isopentenyl-diphosphate delta-isomerase; Provision 98.83
cd04686131 Nudix_Hydrolase_27 Members of the Nudix hydrolase 98.81
cd02883123 Nudix_Hydrolase Nudix hydrolase is a superfamily o 98.8
PRK10546135 pyrimidine (deoxy)nucleoside triphosphate pyrophos 98.8
COG2816279 NPY1 NTP pyrophosphohydrolases containing a Zn-fin 98.8
cd03425124 MutT_pyrophosphohydrolase The MutT pyrophosphohydr 98.79
PRK10729202 nudF ADP-ribose pyrophosphatase NudF; Provisional 98.79
cd04662126 Nudix_Hydrolase_5 Members of the Nudix hydrolase s 98.78
PRK05379340 bifunctional nicotinamide mononucleotide adenylylt 98.77
cd04685133 Nudix_Hydrolase_26 Members of the Nudix hydrolase 98.75
PRK10776129 nucleoside triphosphate pyrophosphohydrolase; Prov 98.73
PRK15009191 GDP-mannose pyrophosphatase NudK; Provisional 98.73
cd04665118 Nudix_Hydrolase_8 Members of the Nudix hydrolase s 98.71
TIGR00052185 nudix-type nucleoside diphosphatase, YffH/AdpP fam 98.69
TIGR00586128 mutt mutator mutT protein. All proteins in this fa 98.68
cd03676180 Nudix_hydrolase_3 Members of the Nudix hydrolase s 98.67
TIGR02150158 IPP_isom_1 isopentenyl-diphosphate delta-isomerase 98.67
PRK08999 312 hypothetical protein; Provisional 98.63
PRK10707190 putative NUDIX hydrolase; Provisional 98.63
cd03670186 ADPRase_NUDT9 ADP-ribose pyrophosphatase (ADPRase) 98.6
cd04663126 Nudix_Hydrolase_6 Members of the Nudix hydrolase s 98.57
cd04694143 Nudix_Hydrolase_35 Members of the Nudix hydrolase 98.54
PLN02552247 isopentenyl-diphosphate delta-isomerase 98.51
PLN03143291 nudix hydrolase; Provisional 98.51
cd04674118 Nudix_Hydrolase_16 Members of the Nudix hydrolase 98.5
COG0494161 MutT NTP pyrophosphohydrolases including oxidative 98.47
TIGR02705156 nudix_YtkD nucleoside triphosphatase YtkD. The fun 98.41
PLN02709222 nudix hydrolase 98.28
KOG3041|consensus225 97.96
KOG2839|consensus145 97.87
PLN02791 770 Nudix hydrolase homolog 97.79
KOG3084|consensus345 97.53
KOG0648|consensus295 97.29
COG4119161 Predicted NTP pyrophosphohydrolase [DNA replicatio 96.91
KOG3069|consensus246 96.91
PLN02839372 nudix hydrolase 96.83
COG1443185 Idi Isopentenyldiphosphate isomerase [Lipid metabo 96.11
KOG4432|consensus405 89.22
KOG4432|consensus 405 86.17
cd03431118 DNA_Glycosylase_C DNA glycosylase (MutY in bacteri 83.55
KOG0142|consensus225 83.37
>cd03672 Dcp2p mRNA decapping enzyme 2 (Dcp2p), the catalytic subunit, and Dcp1p are the two components of the decapping enzyme complex Back     alignment and domain information
Probab=99.73  E-value=1.1e-17  Score=118.06  Aligned_cols=105  Identities=38%  Similarity=0.681  Sum_probs=77.7

Q ss_pred             cccCCCHHHHHHHHhhhhhCceeeeeeecceeeeeccCCeEEEEEEEeccCCCCccCcCCcCcccceEEEeCCCCCCCch
Q psy13065          2 MEEIMMNIISEAKQVLEETGFDSSHLIAEDSYLETTYNDQLTRLYLIPGVPIDFKFAPQTRGEIKACQWFPIGDLPSSRK   81 (114)
Q Consensus         2 ~~~~es~~eaAvREv~EETGl~v~~li~~~~y~~~~~~~~~~~lfv~~~~~~~~~~~p~~~~EI~~i~Wf~id~lp~~~~   81 (114)
                      .+..||+.+||+||++||||+++..+.....|......++.+++|++..+.......+...+|+.+++||++++++.+..
T Consensus        34 ve~gEs~~~AA~REl~EETGl~v~~~~~~~~~~~~~~~~~~~~~f~~~~~~~~~~~~~~~~~E~~~~~Wv~~~el~~~~~  113 (145)
T cd03672          34 INKDEDDHDCAIREVYEETGFDISKYIDKDDYIELIIRGQNVKLYIVPGVPEDTPFEPKTRKEISKIEWFDIKDLPTKKN  113 (145)
T ss_pred             CCCCcCHHHHHHHHHHHhhCccceeccccceeeecccCCcEEEEEEEecCCCCcccCcCChhhhheEEEeeHHHhhhhhh
Confidence            47789999999999999999999875433344443334556777877766544333444567999999999999998776


Q ss_pred             hhhhhhccCCCCCCCceEEEccchHhHHhhc
Q psy13065         82 EIKTVLINGTPVGTNAFFMIMPFINSINIAG  112 (114)
Q Consensus        82 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  112 (114)
                      ..    +.  -..+.+|.++.||+-||+=|.
T Consensus       114 ~~----~~--~~~~~~~~~~~~~~~~~~~~~  138 (145)
T cd03672         114 KK----IP--GLNSNKFFMVIPFIKPLKKWI  138 (145)
T ss_pred             hc----cc--cccccceEEEhHHHHHHHHHH
Confidence            22    11  135789999999999998773



Decapping is a key step in both general and nonsense-mediated 5'-3' mRNA-decay pathways. Dcp2p contains an all-alpha helical N-terminal domain and a C-terminal domain which has the Nudix fold. While decapping is not dependent on the N-terminus of Dcp2p, it does affect its efficiency. Dcp1p binds the N-terminal domain of Dcp2p stimulating the decapping activity of Dcp2p. Decapping permits the degradation of the transcript and is a site of numerous control inputs. It is responsible for nonsense-mediated decay as well as AU-rich element (ARE)-mediated decay. In addition, it may also play a role in the levels of mRNA. Enzymes belonging to the Nudix superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and are recognized by a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V).

>cd04679 Nudix_Hydrolase_20 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>KOG2937|consensus Back     alignment and domain information
>cd04680 Nudix_Hydrolase_21 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04700 DR1025_like DR1025 from Deinococcus radiodurans, a member of the Nudix hydrolase superfamily, show nucleoside triphosphatase and dinucleoside polyphosphate pyrophosphatase activities Back     alignment and domain information
>cd04691 Nudix_Hydrolase_32 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04683 Nudix_Hydrolase_24 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04678 Nudix_Hydrolase_19 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04671 Nudix_Hydrolase_13 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PLN02325 nudix hydrolase Back     alignment and domain information
>cd03427 MTH1 MutT homolog-1 (MTH1) is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>cd04684 Nudix_Hydrolase_25 Contains a crystal structure of the Nudix hydrolase from Enterococcus faecalis, which has an unknown function Back     alignment and domain information
>cd04661 MRP_L46 Mitochondrial ribosomal protein L46 (MRP L46) is a component of the large subunit (39S) of the mammalian mitochondrial ribosome and a member of the Nudix hydrolase superfamily Back     alignment and domain information
>cd04689 Nudix_Hydrolase_30 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04672 Nudix_Hydrolase_14 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03426 CoAse Coenzyme A pyrophosphatase (CoAse), a member of the Nudix hydrolase superfamily, functions to catalyze the elimination of oxidized inactive CoA, which can inhibit CoA-utilizing enzymes Back     alignment and domain information
>cd03673 Ap6A_hydrolase Diadenosine hexaphosphate (Ap6A) hydrolase is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>cd04673 Nudix_Hydrolase_15 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04681 Nudix_Hydrolase_22 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04687 Nudix_Hydrolase_28 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04670 Nudix_Hydrolase_12 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03671 Ap4A_hydrolase_plant_like Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>cd04688 Nudix_Hydrolase_29 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04682 Nudix_Hydrolase_23 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04669 Nudix_Hydrolase_11 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04667 Nudix_Hydrolase_10 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04696 Nudix_Hydrolase_37 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03430 GDPMH GDP-mannose glycosyl hydrolase (AKA GDP-mannose mannosyl hydrolase (GDPMH)) is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>cd03675 Nudix_Hydrolase_2 Contains a crystal structure of the Nudix hydrolase from Nitrosomonas europaea, which has an unknown function Back     alignment and domain information
>cd03424 ADPRase_NUDT5 ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose and a variety of additional ADP-sugar conjugates to AMP and ribose-5-phosphate Back     alignment and domain information
>cd03674 Nudix_Hydrolase_1 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK15434 GDP-mannose mannosyl hydrolase NudD; Provisional Back     alignment and domain information
>cd04677 Nudix_Hydrolase_18 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04690 Nudix_Hydrolase_31 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04692 Nudix_Hydrolase_33 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04693 Nudix_Hydrolase_34 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK00241 nudC NADH pyrophosphatase; Reviewed Back     alignment and domain information
>COG1051 ADP-ribose pyrophosphatase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK15393 NUDIX hydrolase YfcD; Provisional Back     alignment and domain information
>cd04697 Nudix_Hydrolase_38 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04666 Nudix_Hydrolase_9 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK15472 nucleoside triphosphatase NudI; Provisional Back     alignment and domain information
>cd04695 Nudix_Hydrolase_36 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PF00293 NUDIX: NUDIX domain; InterPro: IPR000086 The generic name 'NUDIX hydrolases' (NUcleoside DIphosphate linked to some other moiety X) has been coined for this domain family [] Back     alignment and domain information
>cd04664 Nudix_Hydrolase_7 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03428 Ap4A_hydrolase_human_like Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>PRK00714 RNA pyrophosphohydrolase; Reviewed Back     alignment and domain information
>cd03429 NADH_pyrophosphatase NADH pyrophosphatase, a member of the Nudix hydrolase superfamily, catalyzes the cleavage of NADH into reduced nicotinamide mononucleotide (NMNH) and AMP Back     alignment and domain information
>cd02885 IPP_Isomerase Isopentenyl diphosphate (IPP) isomerase, a member of the Nudix hydrolase superfamily, is a key enzyme in the isoprenoid biosynthetic pathway Back     alignment and domain information
>cd04699 Nudix_Hydrolase_39 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK09438 nudB dihydroneopterin triphosphate pyrophosphatase; Provisional Back     alignment and domain information
>cd04511 Nudix_Hydrolase_4 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04676 Nudix_Hydrolase_17 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK11762 nudE adenosine nucleotide hydrolase NudE; Provisional Back     alignment and domain information
>PRK03759 isopentenyl-diphosphate delta-isomerase; Provisional Back     alignment and domain information
>cd04686 Nudix_Hydrolase_27 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd02883 Nudix_Hydrolase Nudix hydrolase is a superfamily of enzymes found in all three kingdoms of life, and it catalyzes the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK10546 pyrimidine (deoxy)nucleoside triphosphate pyrophosphohydrolase; Provisional Back     alignment and domain information
>COG2816 NPY1 NTP pyrophosphohydrolases containing a Zn-finger, probably nucleic-acid-binding [DNA replication, recombination, and repair] Back     alignment and domain information
>cd03425 MutT_pyrophosphohydrolase The MutT pyrophosphohydrolase is a prototypical Nudix hydrolase that catalyzes the hydrolysis of nucleoside and deoxynucleoside triphosphates (NTPs and dNTPs) by substitution at a beta-phosphorus to yield a nucleotide monophosphate (NMP) and inorganic pyrophosphate (PPi) Back     alignment and domain information
>PRK10729 nudF ADP-ribose pyrophosphatase NudF; Provisional Back     alignment and domain information
>cd04662 Nudix_Hydrolase_5 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK05379 bifunctional nicotinamide mononucleotide adenylyltransferase/ADP-ribose pyrophosphatase; Provisional Back     alignment and domain information
>cd04685 Nudix_Hydrolase_26 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK10776 nucleoside triphosphate pyrophosphohydrolase; Provisional Back     alignment and domain information
>PRK15009 GDP-mannose pyrophosphatase NudK; Provisional Back     alignment and domain information
>cd04665 Nudix_Hydrolase_8 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>TIGR00052 nudix-type nucleoside diphosphatase, YffH/AdpP family Back     alignment and domain information
>TIGR00586 mutt mutator mutT protein Back     alignment and domain information
>cd03676 Nudix_hydrolase_3 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>TIGR02150 IPP_isom_1 isopentenyl-diphosphate delta-isomerase, type 1 Back     alignment and domain information
>PRK08999 hypothetical protein; Provisional Back     alignment and domain information
>PRK10707 putative NUDIX hydrolase; Provisional Back     alignment and domain information
>cd03670 ADPRase_NUDT9 ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose to AMP and ribose-5-P Back     alignment and domain information
>cd04663 Nudix_Hydrolase_6 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04694 Nudix_Hydrolase_35 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PLN02552 isopentenyl-diphosphate delta-isomerase Back     alignment and domain information
>PLN03143 nudix hydrolase; Provisional Back     alignment and domain information
>cd04674 Nudix_Hydrolase_16 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>COG0494 MutT NTP pyrophosphohydrolases including oxidative damage repair enzymes [DNA replication, recombination, and repair / General function prediction only] Back     alignment and domain information
>TIGR02705 nudix_YtkD nucleoside triphosphatase YtkD Back     alignment and domain information
>PLN02709 nudix hydrolase Back     alignment and domain information
>KOG3041|consensus Back     alignment and domain information
>KOG2839|consensus Back     alignment and domain information
>PLN02791 Nudix hydrolase homolog Back     alignment and domain information
>KOG3084|consensus Back     alignment and domain information
>KOG0648|consensus Back     alignment and domain information
>COG4119 Predicted NTP pyrophosphohydrolase [DNA replication, recombination, and repair / General function prediction only] Back     alignment and domain information
>KOG3069|consensus Back     alignment and domain information
>PLN02839 nudix hydrolase Back     alignment and domain information
>COG1443 Idi Isopentenyldiphosphate isomerase [Lipid metabolism] Back     alignment and domain information
>KOG4432|consensus Back     alignment and domain information
>KOG4432|consensus Back     alignment and domain information
>cd03431 DNA_Glycosylase_C DNA glycosylase (MutY in bacteria and hMYH in humans) is responsible for repairing misread A*oxoG residues to C*G by removing the inappropriately paired adenine base from the DNA backbone Back     alignment and domain information
>KOG0142|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query114
2qkm_B266 The Crystal Structure Of Fission Yeast Mrna Decappi 1e-13
2a6t_A271 Crystal Structure Of S.Pombe Mrna Decapping Enzyme 1e-13
2jvb_A146 Solution Structure Of Catalytic Domain Of Ydcp2 Len 2e-07
>pdb|2QKM|B Chain B, The Crystal Structure Of Fission Yeast Mrna Decapping Enzyme Dcp1-Dcp2 Complex Length = 266 Back     alignment and structure

Iteration: 1

Score = 71.6 bits (174), Expect = 1e-13, Method: Compositional matrix adjust. Identities = 34/92 (36%), Positives = 53/92 (57%), Gaps = 7/92 (7%) Query: 14 KQVLEETGFDSSHLIAEDSYLETTYNDQLTRLYLIPGVPIDFKFAPQTRGEIKACQWFPI 73 ++V EETGFD S I + +++ T Q RLY+IPG+ +D +F +TR EI +W + Sbjct: 142 REVYEETGFDCSSRINPNEFIDMTIRGQNVRLYIIPGISLDTRFESRTRKEISKIEWHNL 201 Query: 74 GDLPSSRKEIKTVLINGTPVGTNAFFMIMPFI 105 DLP+ +K N N F+M++PF+ Sbjct: 202 MDLPTFKK-------NKPQTMKNKFYMVIPFL 226
>pdb|2A6T|A Chain A, Crystal Structure Of S.Pombe Mrna Decapping Enzyme Dcp2p Length = 271 Back     alignment and structure
>pdb|2JVB|A Chain A, Solution Structure Of Catalytic Domain Of Ydcp2 Length = 146 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query114
2jvb_A146 Protein PSU1, mRNA-decapping enzyme subunit 2; DCP 1e-20
2a6t_A271 SPAC19A8.12; alpha/beta/alpha, RNA binding protein 6e-20
3h95_A199 Nucleoside diphosphate-linked moiety X motif 6; NU 7e-05
2b0v_A153 Nudix hydrolase; structural genomics, PSI, protein 7e-04
>2jvb_A Protein PSU1, mRNA-decapping enzyme subunit 2; DCP2, mRNA decay, cytoplasm, hydrolase, manganese, metal-binding, mRNA processing; NMR {Saccharomyces cerevisiae} Length = 146 Back     alignment and structure
 Score = 79.5 bits (196), Expect = 1e-20
 Identities = 22/95 (23%), Positives = 42/95 (44%), Gaps = 11/95 (11%)

Query: 16  VLEETGFDSSHLIAEDSYLETTYNDQLTRLYLIPGVPIDFKFAPQTRGEIKACQWFPIGD 75
           V EE GFD +  I ++ ++E     +  +++LI GV   F F PQ R EI   +WF    
Sbjct: 51  VKEEIGFDLTDYIDDNQFIERNIQGKNYKIFLISGVSEVFNFKPQVRNEIDKIEWFDFKK 110

Query: 76  LPSSRKEIKTVLINGTPVGTNAFFMIMPFINSINI 110
           +  +  +               +++I   +  +++
Sbjct: 111 ISKTMYK-----------SNIKYYLINSMMRPLSM 134


>2a6t_A SPAC19A8.12; alpha/beta/alpha, RNA binding protein,hydrolase; 2.50A {Schizosaccharomyces pombe} SCOP: a.242.1.1 d.113.1.7 PDB: 2qkm_B* Length = 271 Back     alignment and structure
>3h95_A Nucleoside diphosphate-linked moiety X motif 6; NUDT6, nudix, hydrolase, GFG, GFG-1, FGF2AS, structural GENO structural genomics consortium, SGC; HET: FLC; 1.70A {Homo sapiens} Length = 199 Back     alignment and structure
>2b0v_A Nudix hydrolase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, U function; 1.55A {Nitrosomonas europaea} SCOP: d.113.1.1 Length = 153 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query114
2jvb_A146 Protein PSU1, mRNA-decapping enzyme subunit 2; DCP 99.64
2a6t_A271 SPAC19A8.12; alpha/beta/alpha, RNA binding protein 99.61
3i7u_A134 AP4A hydrolase; nudix protein, diadenosine polypho 99.38
3gg6_A156 Nudix motif 18, nucleoside diphosphate-linked moie 99.31
4dyw_A157 MUTT/nudix family protein; structural genomics, ni 99.28
2yyh_A139 MUTT domain, 8-OXO-DGTPase domain; nudix family pr 99.25
3shd_A153 Phosphatase NUDJ; nudix fold, nudix motif, hydrola 99.22
3u53_A155 BIS(5'-nucleosyl)-tetraphosphatase [asymmetrical]; 99.21
3q1p_A205 Phosphohydrolase (MUTT/nudix family protein); asym 99.2
3eds_A153 MUTT/nudix family protein; MUT/nudix protein, prot 99.19
3f6a_A159 Hydrolase, nudix family; protein structure initiat 99.17
2pqv_A154 MUTT/nudix family protein; structu genomics, PSI-2 99.17
3o8s_A206 Nudix hydrolase, ADP-ribose pyrophosphatase; struc 99.15
3id9_A171 MUTT/nudix family protein; hydrolase, protein stru 99.14
1sjy_A159 MUTT/nudix family protein; nudix fold, alpha-beta- 99.14
3grn_A153 MUTT related protein; structural genomics, hydrola 99.14
1vcd_A126 NDX1; nudix protein, diadenosine polyphosphate, AP 99.13
3gwy_A140 Putative CTP pyrophosphohydrolase; structural geno 99.13
2w4e_A145 MUTT/nudix family protein; ADP-ribose pyrophosphat 99.12
3h95_A199 Nucleoside diphosphate-linked moiety X motif 6; NU 99.12
3oga_A165 Nucleoside triphosphatase NUDI; salmonella enteric 99.11
3exq_A161 Nudix family hydrolase; protein structure initiati 99.11
2b0v_A153 Nudix hydrolase; structural genomics, PSI, protein 99.1
3i9x_A187 MUTT/nudix family protein; structural genomics, hy 99.1
2fb1_A226 Conserved hypothetical protein; structural genomic 99.09
1ktg_A138 Diadenosine tetraphosphate hydrolase; nudix, AMP, 99.09
3fk9_A188 Mutator MUTT protein; structural genomics, hydrola 99.09
1f3y_A165 Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase 99.09
3cng_A189 Nudix hydrolase; structural genomics, APC7497, PSI 99.09
2b06_A155 MUTT/nudix family protein; structural genomics, P 99.09
1vk6_A269 NADH pyrophosphatase; 1790429, structural genomics 99.08
3f13_A163 Putative nudix hydrolase family member; structural 99.08
2fkb_A180 Putative nudix hydrolase YFCD; putative protein, M 99.08
2pbt_A134 AP4A hydrolase; nudix protein, diadenosine polypho 99.07
3hhj_A158 Mutator MUTT protein; niaid, ssgcid, decode, UW, S 99.07
1vhz_A198 ADP compounds hydrolase NUDE; structural genomics; 99.07
3son_A149 Hypothetical nudix hydrolase; structural genomics, 99.07
3r03_A144 Nudix hydrolase; structural genomics, PSI2, protei 99.07
3q93_A176 7,8-dihydro-8-oxoguanine triphosphatase; structura 99.04
3ees_A153 Probable pyrophosphohydrolase; nudix, RNA pyrophos 99.04
2yvp_A182 NDX2, MUTT/nudix family protein; nudix protein, AD 99.03
1mut_A129 MUTT, nucleoside triphosphate pyrophosphohydrolase 99.01
1nqz_A194 COA pyrophosphatase (MUTT/nudix family protein); D 99.0
1q27_A171 Putative nudix hydrolase DR0079; radiation resista 99.0
2kdv_A164 RNA pyrophosphohydrolase; nudix family, magnesium, 98.99
2rrk_A140 ORF135, CTP pyrophosphohydrolase; NMR {Escherichia 98.98
3o6z_A191 GDP-mannose pyrophosphatase NUDK; nudix, hydrolase 98.98
2dsc_A212 ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP 98.98
3q91_A218 Uridine diphosphate glucose pyrophosphatase; struc 98.97
1mk1_A207 ADPR pyrophosphatase; nudix hydrolase, adprase, ad 98.96
1g0s_A209 Hypothetical 23.7 kDa protein in ICC-TOLC intergen 98.96
2azw_A148 MUTT/nudix family protein; MUTT/nudix ,enterococcu 98.96
3fcm_A197 Hydrolase, nudix family; protein structure initiat 98.93
1v8y_A170 ADP-ribose pyrophosphatase; nudix motif, loop-heli 98.93
1hzt_A190 Isopentenyl diphosphate delta-isomerase; dimethyla 98.92
2fvv_A194 Diphosphoinositol polyphosphate phosphohydrolase 1 98.91
2o1c_A150 DATP pyrophosphohydrolase; nudix NTP hydrolase NTP 98.9
3fjy_A 364 Probable MUTT1 protein; dimer, protein structure i 98.9
1rya_A160 GDP-mannose mannosyl hydrolase; GDP-glucose, nudix 98.88
2qjt_B352 Nicotinamide-nucleotide adenylyltransferase; two i 98.85
1k2e_A156 Nudix homolog; nudix/MUTT-like fold, mixed alpha/b 98.82
2qjo_A341 Bifunctional NMN adenylyltransferase/nudix hydrol; 98.82
3gz5_A240 MUTT/nudix family protein; DNA binding protein, nu 98.8
2fml_A273 MUTT/nudix family protein; structural genomics, PS 98.78
1q33_A292 Pyrophosphatase, ADP-ribose pyrophosphatase; nudix 98.72
3e57_A211 Uncharacterized protein TM1382; structural genomic 98.71
1u20_A212 U8 snoRNA-binding protein X29; modified nudix hydr 98.7
2xsq_A217 U8 snoRNA-decapping enzyme; hydrolase, mRNA decapp 98.65
1x51_A155 A/G-specific adenine DNA glycosylase; nudix domain 98.48
2pny_A246 Isopentenyl-diphosphate delta-isomerase 2; caroten 98.35
2dho_A235 Isopentenyl-diphosphate delta-isomerase 1; alpha/b 98.34
3dup_A300 MUTT/nudix family protein; nudix superfamily hydro 98.33
3fsp_A369 A/G-specific adenine glycosylase; protein-DNA comp 98.32
3rh7_A321 Hypothetical oxidoreductase; FMN-binding split bar 98.13
3qsj_A232 Nudix hydrolase; structural genomics, PSI-biology, 97.51
3kvh_A214 Protein syndesmos; NUDT16-like, NUDT16L1, nudix, R 95.87
3bho_A208 Cleavage and polyadenylation specificity factor su 90.49
>2jvb_A Protein PSU1, mRNA-decapping enzyme subunit 2; DCP2, mRNA decay, cytoplasm, hydrolase, manganese, metal-binding, mRNA processing; NMR {Saccharomyces cerevisiae} Back     alignment and structure
Probab=99.64  E-value=1.9e-16  Score=107.75  Aligned_cols=99  Identities=23%  Similarity=0.488  Sum_probs=74.1

Q ss_pred             cccCCCHHHHHHHHhhhhhCceeeeeeecceeeeeccCCeEEEEEEEeccCCCCccCcCCcCcccceEEEeCCCCCCCch
Q psy13065          2 MEEIMMNIISEAKQVLEETGFDSSHLIAEDSYLETTYNDQLTRLYLIPGVPIDFKFAPQTRGEIKACQWFPIGDLPSSRK   81 (114)
Q Consensus         2 ~~~~es~~eaAvREv~EETGl~v~~li~~~~y~~~~~~~~~~~lfv~~~~~~~~~~~p~~~~EI~~i~Wf~id~lp~~~~   81 (114)
                      ++..||+.+||+||++||||+++..+.....|......+...++|++..+.......+...+|+.++.|+++++++.+..
T Consensus        37 ve~gEs~~~aa~RE~~EEtGl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~E~~~~~W~~~~el~~~~~  116 (146)
T 2jvb_A           37 ISKDENDIDCCIREVKEEIGFDLTDYIDDNQFIERNIQGKNYKIFLISGVSEVFNFKPQVRNEIDKIEWFDFKKISKTMY  116 (146)
T ss_dssp             CCSSSCHHHHHHHHHHHHTSCCCSSSSCSSCEEEEEETTEEEEEEEECCCCSSSCCCCCCSSSCCCEEEEEHHHHHTGGG
T ss_pred             CCCCCCHHHHHHHHHHHHHCCCchHhcccccccccccCCceEEEEEEEeccccccCCcCCcchhheeEEeEHHHHHhhhc
Confidence            56789999999999999999999865544455443344555666666554433334455568999999999999998664


Q ss_pred             hhhhhhccCCCCCCCceEEEccchHhHHhh
Q psy13065         82 EIKTVLINGTPVGTNAFFMIMPFINSINIA  111 (114)
Q Consensus        82 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  111 (114)
                                 ....+++|+.||+..|+=|
T Consensus       117 -----------~~~~~~~l~~~~~~~l~~~  135 (146)
T 2jvb_A          117 -----------KSNIKYYLINSMMRPLSMW  135 (146)
T ss_dssp             -----------CSSCCCHHHHHHHHHHHHH
T ss_pred             -----------ccchhhhhHHHHHHHHHHH
Confidence                       4567899999999998765



>2a6t_A SPAC19A8.12; alpha/beta/alpha, RNA binding protein,hydrolase; 2.50A {Schizosaccharomyces pombe} SCOP: a.242.1.1 d.113.1.7 PDB: 2qkm_B* Back     alignment and structure
>3i7u_A AP4A hydrolase; nudix protein, diadenosine polyphosphate, S genomics, NPPSFA, national project on protein structural AN functional analyses; HET: PGE PG4; 1.80A {Aquifex aeolicus} PDB: 3i7v_A* Back     alignment and structure
>3gg6_A Nudix motif 18, nucleoside diphosphate-linked moiety X motif 18; NUDT18, NXR1, nucleotide hydrolase, hydrolase, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>4dyw_A MUTT/nudix family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Burkholderia pseudomallei} Back     alignment and structure
>2yyh_A MUTT domain, 8-OXO-DGTPase domain; nudix family protein, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.80A {Aquifex aeolicus} Back     alignment and structure
>3shd_A Phosphatase NUDJ; nudix fold, nudix motif, hydrolase, (D)NDP/(D)NTP binding, dephosphorylation; 2.50A {Escherichia coli} PDB: 3dku_A Back     alignment and structure
>3u53_A BIS(5'-nucleosyl)-tetraphosphatase [asymmetrical]; hydrolase; 2.71A {Homo sapiens} PDB: 1xsa_A 1xsb_A 1xsc_A* Back     alignment and structure
>3q1p_A Phosphohydrolase (MUTT/nudix family protein); asymmetric dimer, RNA exonuclease, CDP-CHO pyrophosphatase; 1.80A {Bacillus cereus} PDB: 3q4i_A Back     alignment and structure
>3f6a_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.02A {Clostridium perfringens atcc 13124} Back     alignment and structure
>2pqv_A MUTT/nudix family protein; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 1.63A {Streptococcus pneumoniae} Back     alignment and structure
>3o8s_A Nudix hydrolase, ADP-ribose pyrophosphatase; structural genomics, joint center for structural genomics, J protein structure initiative; 2.27A {Streptococcus suis} Back     alignment and structure
>3id9_A MUTT/nudix family protein; hydrolase, protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.55A {Bacillus thuringiensis str} Back     alignment and structure
>1sjy_A MUTT/nudix family protein; nudix fold, alpha-beta-alpha sandwich, structural genomics, BSGC structure funded by NIH; 1.39A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1soi_A 1su2_A* 1sz3_A* Back     alignment and structure
>3grn_A MUTT related protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 1.70A {Methanosarcina mazei} Back     alignment and structure
>1vcd_A NDX1; nudix protein, diadenosine polyphosphate, AP6A, thermus THER HB8, hydrolase, riken structural genomics/proteomics initia RSGI; 1.70A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1vc8_A 1vc9_A* Back     alignment and structure
>3gwy_A Putative CTP pyrophosphohydrolase; structural genomics, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Bacteroides fragilis} SCOP: d.113.1.0 Back     alignment and structure
>2w4e_A MUTT/nudix family protein; ADP-ribose pyrophosphatase, hydrolase; 2.00A {Deinococcus radiodurans} Back     alignment and structure
>3h95_A Nucleoside diphosphate-linked moiety X motif 6; NUDT6, nudix, hydrolase, GFG, GFG-1, FGF2AS, structural GENO structural genomics consortium, SGC; HET: FLC; 1.70A {Homo sapiens} Back     alignment and structure
>3oga_A Nucleoside triphosphatase NUDI; salmonella enterica subsp. enterica serovar typhimurium STR. unknown function; HET: PO4; 1.75A {Salmonella enterica subsp} PDB: 3n77_A Back     alignment and structure
>3exq_A Nudix family hydrolase; protein structure initiative II(PSI II), NYSGXRC, 11180K, structural genomics; 2.00A {Lactobacillus brevis atcc 367} Back     alignment and structure
>2b0v_A Nudix hydrolase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, U function; 1.55A {Nitrosomonas europaea} SCOP: d.113.1.1 Back     alignment and structure
>3i9x_A MUTT/nudix family protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 2.20A {Listeria innocua} Back     alignment and structure
>2fb1_A Conserved hypothetical protein; structural genomics, PSI, protein STRU initiative, midwest center for structural genomics, MCSG; 2.50A {Bacteroides thetaiotaomicron} SCOP: a.4.5.68 d.113.1.6 Back     alignment and structure
>1ktg_A Diadenosine tetraphosphate hydrolase; nudix, AMP, magnesium cluster; HET: AMP; 1.80A {Caenorhabditis elegans} SCOP: d.113.1.1 PDB: 1kt9_A* Back     alignment and structure
>3fk9_A Mutator MUTT protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.50A {Bacillus halodurans} Back     alignment and structure
>1f3y_A Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase; enzyme,mixed 4-stranded beta sheet, 2-stranded antiparallel sheet; NMR {Lupinus angustifolius} SCOP: d.113.1.1 PDB: 1jkn_A* Back     alignment and structure
>3cng_A Nudix hydrolase; structural genomics, APC7497, PSI-2, protei structure initiative; 2.00A {Nitrosomonas europaea atcc 19718} Back     alignment and structure
>2b06_A MUTT/nudix family protein; structural genomics, P protein structure initiative, midwest center for structural genomics, MCSG; 1.40A {Streptococcus pneumoniae} SCOP: d.113.1.1 Back     alignment and structure
>1vk6_A NADH pyrophosphatase; 1790429, structural genomics, JCSG, PS protein structure initiative, joint center for structural G hydrolase; HET: MSE; 2.20A {Escherichia coli} SCOP: d.113.1.4 d.113.1.4 g.41.14.1 PDB: 2gb5_A Back     alignment and structure
>3f13_A Putative nudix hydrolase family member; structural genomics, PSI-2, protein structure initiative; 1.70A {Chromobacterium violaceum} Back     alignment and structure
>2fkb_A Putative nudix hydrolase YFCD; putative protein, MAD, structural genomics, escherichia coli putative nudix hydrolase, PSI; HET: MSE; 2.00A {Escherichia coli K12} SCOP: d.113.1.2 Back     alignment and structure
>3hhj_A Mutator MUTT protein; niaid, ssgcid, decode, UW, SBRI, infectious diseases, hydrol structural genomics; 2.10A {Bartonella henselae} Back     alignment and structure
>1vhz_A ADP compounds hydrolase NUDE; structural genomics; HET: APR; 2.32A {Escherichia coli} SCOP: d.113.1.1 PDB: 1vhg_A* Back     alignment and structure
>3son_A Hypothetical nudix hydrolase; structural genomics, joint center for structural GENO JCSG, protein structure initiative, PSI-biology; HET: MSE; 1.71A {Listeria monocytogenes} Back     alignment and structure
>3r03_A Nudix hydrolase; structural genomics, PSI2, protein structure INIT NEW YORK SGX research center for structural genomics, nysgx; HET: ADP; 2.49A {Rhodospirillum rubrum} SCOP: d.113.1.0 Back     alignment and structure
>3q93_A 7,8-dihydro-8-oxoguanine triphosphatase; structural genomics, structural genomics consortium, SGC, NU MUTT-like, hydrolase, magnesium binding; 1.80A {Homo sapiens} PDB: 1iry_A 3zr0_A* 3zr1_A Back     alignment and structure
>3ees_A Probable pyrophosphohydrolase; nudix, RNA pyrophosphohydrolase; 1.90A {Bdellovibrio bacteriovorus} PDB: 3eeu_A 3ef5_A* 3ffu_A* Back     alignment and structure
>2yvp_A NDX2, MUTT/nudix family protein; nudix protein, ADP-ribose, FAD, hydrol structural genomics, NPPSFA; HET: RBY; 1.66A {Thermus thermophilus} PDB: 2yvn_A 2yvm_A* 2yvo_A* Back     alignment and structure
>1mut_A MUTT, nucleoside triphosphate pyrophosphohydrolase; DNA repair; NMR {Escherichia coli} SCOP: d.113.1.1 PDB: 1ppx_A* 1pun_A* 1puq_A* 1pus_A* 1tum_A* 3a6s_A* 3a6t_A* 3a6u_A* 3a6v_A* Back     alignment and structure
>1nqz_A COA pyrophosphatase (MUTT/nudix family protein); D.radiodurans, hydrolase; 1.70A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1nqy_A Back     alignment and structure
>1q27_A Putative nudix hydrolase DR0079; radiation resistance; NMR {Deinococcus radiodurans} SCOP: d.113.1.2 PDB: 2o5f_A Back     alignment and structure
>2kdv_A RNA pyrophosphohydrolase; nudix family, magnesium, manganese, zinc; NMR {Escherichia coli} PDB: 2kdw_A Back     alignment and structure
>2rrk_A ORF135, CTP pyrophosphohydrolase; NMR {Escherichia coli} Back     alignment and structure
>3o6z_A GDP-mannose pyrophosphatase NUDK; nudix, hydrolase, biofilm; 2.05A {Escherichia coli} SCOP: d.113.1.1 PDB: 3o52_A* 1viu_A 3o69_A 3o61_A Back     alignment and structure
>2dsc_A ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP-ribose pyrophosphatase, NUDT5, hydrolase; HET: APR; 2.00A {Homo sapiens} PDB: 2dsd_A* 3bm4_A* 2dsb_A 3aca_A* 3ac9_A* 3l85_A* Back     alignment and structure
>3q91_A Uridine diphosphate glucose pyrophosphatase; structural genomics, structural genomics consortium, SGC, NU MUTT-like, hydrolase, magnesium binding; 2.70A {Homo sapiens} Back     alignment and structure
>1mk1_A ADPR pyrophosphatase; nudix hydrolase, adprase, adenosine DI ribose, RV1700, hydrolase; HET: APR; 2.00A {Mycobacterium tuberculosis} SCOP: d.113.1.1 PDB: 1mp2_A 1mqe_A* 1mqw_A* 1mr2_A* Back     alignment and structure
>1g0s_A Hypothetical 23.7 kDa protein in ICC-TOLC intergenic region; nudix fold, hydrolase; 1.90A {Escherichia coli} SCOP: d.113.1.1 PDB: 1g9q_A* 1ga7_A 1khz_A* 1viq_A Back     alignment and structure
>2azw_A MUTT/nudix family protein; MUTT/nudix ,enterococcus faecalis, structural genomics, PSI, structure initiative; HET: 1PE; 1.90A {Enterococcus faecalis} SCOP: d.113.1.1 Back     alignment and structure
>3fcm_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, 11180J, structural genomics; 2.20A {Clostridium perfringens atcc 13124} Back     alignment and structure
>1v8y_A ADP-ribose pyrophosphatase; nudix motif, loop-helix-loop, MUTT family, riken structural genomics/proteomics initiative, RSGI; HET: APR; 1.65A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1v8v_A* 1v8n_A 1v8l_A* 1v8m_A* 1v8i_A 1v8r_A* 1v8s_A* 1v8t_A* 1v8w_A 1v8u_A Back     alignment and structure
>1hzt_A Isopentenyl diphosphate delta-isomerase; dimethylallyl, isoprenoids; 1.45A {Escherichia coli} SCOP: d.113.1.2 PDB: 1hx3_A 1r67_A 1x84_A* 1x83_A* 1ppv_A* 1nfz_A* 1nfs_A* 1ppw_A* 1pvf_A 2veh_A* 2vej_A 2vnp_A* 2vnq_A 2g74_A 2g73_A* 2b2k_A 1i9a_A 1q54_A* 1ow2_A* 3hyq_A* Back     alignment and structure
>2fvv_A Diphosphoinositol polyphosphate phosphohydrolase 1; nudix, inositol polyphosphate metabolism, structural genomics, structural genomics consortium; HET: IHP; 1.25A {Homo sapiens} SCOP: d.113.1.1 PDB: 2q9p_A* 2duk_A 3mcf_A* Back     alignment and structure
>2o1c_A DATP pyrophosphohydrolase; nudix NTP hydrolase NTP pyrophosphohydrolase MUTT dihydroneo triphosphate pyrophosphohydrolase folate biosynthesis; 1.80A {Escherichia coli} PDB: 2o5w_A Back     alignment and structure
>3fjy_A Probable MUTT1 protein; dimer, protein structure initiative II), NYSGXRC, 11181H, structural genomics; 2.15A {Bifidobacterium adolescentis atcc 1570ORGANISM_TAXID} Back     alignment and structure
>1rya_A GDP-mannose mannosyl hydrolase; GDP-glucose, nudix, nudix Mg-complex; HET: GDP; 1.30A {Escherichia coli} SCOP: d.113.1.5 PDB: 2gt2_A 2gt4_A* 2i8t_A* 2i8u_A* Back     alignment and structure
>2qjt_B Nicotinamide-nucleotide adenylyltransferase; two individual domains, hydrolase; HET: AMP; 2.30A {Francisella tularensis} PDB: 2r5w_B Back     alignment and structure
>1k2e_A Nudix homolog; nudix/MUTT-like fold, mixed alpha/beta, dimer, putative NUDI hydrolase, structural genomics, unknown function; 1.80A {Pyrobaculum aerophilum} SCOP: d.113.1.1 PDB: 1jrk_A 1k26_A Back     alignment and structure
>2qjo_A Bifunctional NMN adenylyltransferase/nudix hydrol; two individual domains, hydrolase; HET: APR NAD; 2.60A {Synechocystis SP} Back     alignment and structure
>3gz5_A MUTT/nudix family protein; DNA binding protein, nudix domain, WHTH domain; 2.20A {Shewanella oneidensis} PDB: 3gz6_A* 3gz8_A* Back     alignment and structure
>2fml_A MUTT/nudix family protein; structural genomics, PSI, protein structure initiative, midwest center structural genomics, MCSG; 2.26A {Enterococcus faecalis} SCOP: a.4.5.68 d.113.1.6 Back     alignment and structure
>1q33_A Pyrophosphatase, ADP-ribose pyrophosphatase; nudix fold, hydrolase; HET: BGC; 1.81A {Homo sapiens} SCOP: d.113.1.1 PDB: 1qvj_A* Back     alignment and structure
>3e57_A Uncharacterized protein TM1382; structural genomics, nudix hydrolase, PSI-2, protein structure initiative; 1.89A {Thermotoga maritima} Back     alignment and structure
>1u20_A U8 snoRNA-binding protein X29; modified nudix hydrolase fold, hydrolase; 2.10A {Xenopus laevis} SCOP: d.113.1.1 PDB: 2a8t_A* 2a8q_A* 2a8p_A* 2a8r_A* 2a8s_A* Back     alignment and structure
>2xsq_A U8 snoRNA-decapping enzyme; hydrolase, mRNA decapping, mRNA turnover, structural genomic consortium, SGC; HET: IMP; 1.72A {Homo sapiens} PDB: 3cou_A 3mgm_A Back     alignment and structure
>1x51_A A/G-specific adenine DNA glycosylase; nudix domain, DNA repair, alpha-3 isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.113.1.3 Back     alignment and structure
>2pny_A Isopentenyl-diphosphate delta-isomerase 2; carotenoid biosynthesis, cholesterol biosynthesis, isomerase isoprene biosynthesis, lipid synthesis; HET: GOL; 1.81A {Homo sapiens} Back     alignment and structure
>2dho_A Isopentenyl-diphosphate delta-isomerase 1; alpha/beta protein; 1.60A {Homo sapiens} PDB: 2i6k_A* 2icj_A 2ick_A* Back     alignment and structure
>3dup_A MUTT/nudix family protein; nudix superfamily hydrolase, hydrolase 3 family, structural protein structure initiative, PSI; HET: MSE; 1.80A {Rhodospirillum rubrum atcc 11170} Back     alignment and structure
>3fsp_A A/G-specific adenine glycosylase; protein-DNA complex, DNA glycosylase, transition state analog, DNA repair; HET: NRI; 2.20A {Geobacillus stearothermophilus} PDB: 3fsq_A* 1rrs_A* 1vrl_A* 1rrq_A* 3g0q_A* Back     alignment and structure
>3rh7_A Hypothetical oxidoreductase; FMN-binding split barrel, nudix, structural genomics, joint for structural genomics, JCSG; HET: FMN; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>3qsj_A Nudix hydrolase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 1.70A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3kvh_A Protein syndesmos; NUDT16-like, NUDT16L1, nudix, RNA regulation, RNA structural genomics consortium, SGC, RNA degradation, RNA B protein; 1.70A {Homo sapiens} Back     alignment and structure
>3bho_A Cleavage and polyadenylation specificity factor subunit 5; CPSF5, RNA processing, cleavage factor, diadenosine tetraphosphate, mRNA processing; HET: B4P; 1.80A {Homo sapiens} PDB: 3bap_A 3mdg_A 3mdi_A 2cl3_A 3n9u_A 3q2s_A 3q2t_A 2j8q_A 3p5t_A 3p6y_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 114
d2a6ta2151 d.113.1.7 (A:95-245) mRNA decapping enzyme Dcp2p c 1e-15
>d2a6ta2 d.113.1.7 (A:95-245) mRNA decapping enzyme Dcp2p catalytic domain {Schizosaccharomyces pombe [TaxId: 4896]} Length = 151 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Nudix
superfamily: Nudix
family: mRNA decapping enzyme-like
domain: mRNA decapping enzyme Dcp2p catalytic domain
species: Schizosaccharomyces pombe [TaxId: 4896]
 Score = 66.3 bits (161), Expect = 1e-15
 Identities = 33/96 (34%), Positives = 54/96 (56%), Gaps = 7/96 (7%)

Query: 13  AKQVLEETGFDSSHLIAEDSYLETTYNDQLTRLYLIPGVPIDFKFAPQTRGEIKACQWFP 72
            ++V EETGFD S  I  + +++ T   Q  RLY+IPG+ +D +F  +TR EI   +W  
Sbjct: 47  IREVYEETGFDCSSRINPNEFIDMTIRGQNVRLYIIPGISLDTRFESRTRKEISKIEWHN 106

Query: 73  IGDLPSSRKEIKTVLINGTPVGTNAFFMIMPFINSI 108
           + DLP+ +K     +        N F+M++PF+  +
Sbjct: 107 LMDLPTFKKNKPQTMK-------NKFYMVIPFLAPL 135


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query114
d2a6ta2151 mRNA decapping enzyme Dcp2p catalytic domain {Schi 99.84
d1vk6a2131 NADH pyrophosphatase {Escherichia coli [TaxId: 562 99.42
d1vcda1126 AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: 99.39
d2b06a1155 Hypothetical protein SP1235 (spr1115) {Streptococc 99.34
d2fb1a2147 Hypothetical protein BT0354, N-terminal domain {Ba 99.33
d1sjya_158 Hypothetical protein DR1025 {Deinococcus radiodura 99.31
d1irya_156 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Hum 99.3
d2b0va1146 Hypothetical protein NE0184 {Nitrosomonas europaea 99.26
d1puna_129 Nucleoside triphosphate pyrophosphorylase (MutT) { 99.23
d1ktga_137 Diadenosine tetraphosphate hydrolase (Ap4A hydrola 99.22
d2fkba1161 Hypothetical protein YfcD {Escherichia coli [TaxId 99.21
d2fvva1135 Diphosphoinositol polyphosphate phosphohydrolase { 99.2
d1v8ya_158 ADP-ribose pyrophosphatase {Thermus thermophilus [ 99.16
d1vhza_186 ADP compounds hydrolase NudE {Escherichia coli [Ta 99.16
d2fmla2202 Hypothetical protein EF2700, N-terminal domain {En 99.15
d1xsba_153 Diadenosine tetraphosphate hydrolase (Ap4A hydrola 99.13
d2azwa1147 Hypothetical protein EF1141 {Enterococcus faecalis 99.13
d1hzta_153 Isopentenyl diphosphate isomerase {Escherichia col 99.11
d1jkna_165 Diadenosine tetraphosphate hydrolase (Ap4A hydrola 99.11
d1k2ea_152 Hypothetical protein PAE3301 {Archaeon Pyrobaculum 99.11
d1mqea_202 ADP-ribose pyrophosphatase {Mycobacterium tubercul 99.05
d1ryaa_160 GDP-mannose mannosyl hydrolase NudD {Escherichia c 99.03
d2o5fa1162 Hypothetical protein DR0079 {Deinococcus radiodura 99.02
d1nqza_187 Coenzyme A pyrophosphatase {Deinococcus radioduran 98.96
d1g0sa_209 ADP-ribose pyrophosphatase {Escherichia coli [TaxI 98.89
d1viua_189 ADP-ribose pyrophosphatase homologue YffH {Escheri 98.83
d1q33a_292 NUDT9 (mitochondrial ADP-ribose pyrophosphatase) { 98.67
d1u20a1196 U8 snorna-binding protein x29 {African clawed frog 98.33
d1rrqa2127 Adenine glycosylase MutY, C-terminal domain {Bacil 98.01
d1x51a1142 A/G-specific adenine DNA glycosylase {Human (Homo 93.81
>d2a6ta2 d.113.1.7 (A:95-245) mRNA decapping enzyme Dcp2p catalytic domain {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Nudix
superfamily: Nudix
family: mRNA decapping enzyme-like
domain: mRNA decapping enzyme Dcp2p catalytic domain
species: Schizosaccharomyces pombe [TaxId: 4896]
Probab=99.84  E-value=2.1e-21  Score=133.57  Aligned_cols=103  Identities=32%  Similarity=0.628  Sum_probs=73.4

Q ss_pred             cccCCCHHHHHHHHhhhhhCceeeeeeecceeeeeccCCeEEEEEEEeccCCCCccCcCCcCcccceEEEeCCCCCCCch
Q psy13065          2 MEEIMMNIISEAKQVLEETGFDSSHLIAEDSYLETTYNDQLTRLYLIPGVPIDFKFAPQTRGEIKACQWFPIGDLPSSRK   81 (114)
Q Consensus         2 ~~~~es~~eaAvREv~EETGl~v~~li~~~~y~~~~~~~~~~~lfv~~~~~~~~~~~p~~~~EI~~i~Wf~id~lp~~~~   81 (114)
                      ++..||+.+||+||++||||+++..+.....+......++.+++|++..+..+..+.+...+|+++++||++++||.+..
T Consensus        36 ie~gEs~~~aa~RE~~EEtGi~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Ei~~~~W~~~~el~~~~~  115 (151)
T d2a6ta2          36 IDKDESDVDCAIREVYEETGFDCSSRINPNEFIDMTIRGQNVRLYIIPGISLDTRFESRTRKEISKIEWHNLMDLPTFKK  115 (151)
T ss_dssp             CCTTCCHHHHHHHHHHHHHCCCCTTTCCTTCEEEEEETTEEEEEEEECCCCTTCCCC------EEEEEEEEGGGSTTCC-
T ss_pred             ccCCCCHHHHHHHHHHHHhCCCceeeeecceEEeecccCceEEEEEEEEeccCCcccccCCCccceEEEEEHHHhhhhhh
Confidence            57899999999999999999999864444445554456666777777776665556666678999999999999998765


Q ss_pred             hhhhhhccCCCCCCCceEEEccchHhHHhh
Q psy13065         82 EIKTVLINGTPVGTNAFFMIMPFINSINIA  111 (114)
Q Consensus        82 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  111 (114)
                      +..       ....++|||+.|||++|+-|
T Consensus       116 ~~~-------~~~~~~~~~v~~fi~~L~~w  138 (151)
T d2a6ta2         116 NKP-------QTMKNKFYMVIPFLAPLKKW  138 (151)
T ss_dssp             ------------CCGGGTTTGGGHHHHHHH
T ss_pred             ccc-------ccccchhhhHHHHHHHHHHH
Confidence            321       13467899999999999876



>d1vk6a2 d.113.1.4 (A:126-256) NADH pyrophosphatase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vcda1 d.113.1.1 (A:1-126) AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2b06a1 d.113.1.1 (A:1-155) Hypothetical protein SP1235 (spr1115) {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2fb1a2 d.113.1.6 (A:3-149) Hypothetical protein BT0354, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1sjya_ d.113.1.1 (A:) Hypothetical protein DR1025 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1irya_ d.113.1.1 (A:) 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0va1 d.113.1.1 (A:4-149) Hypothetical protein NE0184 {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d1puna_ d.113.1.1 (A:) Nucleoside triphosphate pyrophosphorylase (MutT) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ktga_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2fkba1 d.113.1.2 (A:8-168) Hypothetical protein YfcD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fvva1 d.113.1.1 (A:8-142) Diphosphoinositol polyphosphate phosphohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v8ya_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vhza_ d.113.1.1 (A:) ADP compounds hydrolase NudE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fmla2 d.113.1.6 (A:3-204) Hypothetical protein EF2700, N-terminal domain {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1xsba_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2azwa1 d.113.1.1 (A:2-148) Hypothetical protein EF1141 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1hzta_ d.113.1.2 (A:) Isopentenyl diphosphate isomerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jkna_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Narrow-leaved blue lupine (Lupinus angustifolius) [TaxId: 3871]} Back     information, alignment and structure
>d1k2ea_ d.113.1.1 (A:) Hypothetical protein PAE3301 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1mqea_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ryaa_ d.113.1.5 (A:) GDP-mannose mannosyl hydrolase NudD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2o5fa1 d.113.1.2 (A:7-168) Hypothetical protein DR0079 {Deinococcus radiodurans str. R1 (Deinococcus radiodurans R1) [TaxId: 243230]} Back     information, alignment and structure
>d1nqza_ d.113.1.1 (A:) Coenzyme A pyrophosphatase {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1g0sa_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1viua_ d.113.1.1 (A:) ADP-ribose pyrophosphatase homologue YffH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q33a_ d.113.1.1 (A:) NUDT9 (mitochondrial ADP-ribose pyrophosphatase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u20a1 d.113.1.1 (A:14-209) U8 snorna-binding protein x29 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1rrqa2 d.113.1.3 (A:234-360) Adenine glycosylase MutY, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1x51a1 d.113.1.3 (A:8-149) A/G-specific adenine DNA glycosylase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure