Psyllid ID: psy13164


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190---
MEPKVEESQEHVGASPSLYDPFRVIKREPLDIPYEVTVKEESYEGDSINVEENNGNDAVTRDCLEFFKSHDSTLKNESDHERRSINYNCQQSYKVGKLNKILHRGIRYKCDLCSKEYFHKGSLTEHKKRHQGIRYKCDLCSKEYFHKGYLTDHKKIHQGIRYKCNLCSKEFLRKDILIEHKKIHQGIRFKCDL
ccccccHHccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
ccccccccccccccEccccHHHHHcccccccccccccccccccccccHHHHHccccccccccccccEccccHHHHHHHHcccccccccccHccHHHHHHHHHccccEEEcccccccEccccHHHHHHHHccccEEEcccccccEccccHHHHHHHHccccEEEcccccccEccccHHHHHHHHccccEEEEcc
mepkveesqehvgaspslydpfrvikrepldipyevtvkeesyegdsinveenngndavtRDCLEFFKShdstlknesdherrsinyncqqsykvgklnkiLHRGIRYkcdlcskeyfhkgsltehkkrhqgirykcdlcskeyfhkgyltdhkkihQGIRykcnlcskeflrKDILIEHKKIhqgirfkcdl
mepkveesqehvgaspslydpfrvIKREPLDIPYEVTvkeesyegdsinveenngndaVTRDCLEFFKSHDstlknesdherrsinyncqqsykvgklnkiLHRGIRYKCDLCSKEYFHkgsltehkkrhqgirykCDLCSKEYFHKGYLTDHKKIHQGIRYKCNLCSKEFLRKDILIEhkkihqgirfkcdl
MEPKVEESQEHVGASPSLYDPFRVIKREPLDIPYEVTVKEESYEGDSINVEENNGNDAVTRDCLEFFKSHDSTLKNESDHERRSINYNCQQSYKVGKLNKILHRGIRYKCDLCSKEYFHKGSLTEHKKRHQGIRYKCDLCSKEYFHKGYLTDHKKIHQGIRYKCNLCSKEFLRKDILIEHKKIHQGIRFKCDL
******************YDPFRVIKREPLDIPYEVTVK*******************VTRDCLEFF*****************INYNCQQSYKVGKLNKILHRGIRYKCDLCSKEYFHKGSLTEHKKRHQGIRYKCDLCSKEYFHKGYLTDHKKIHQGIRYKCNLCSKEFLRKDILIEHKKIHQGIRFK***
**PKVEESQEHVGASPSLYDPFRVIKREPLDIPYEVTVKEESYEGDSINVEENNGNDAVTRDCLEFFKSHDSTLKNESDHERRSINYNCQQSYKVGKLNKILHRGIRYKCDLCSKEYFHKGSLTEHKKRHQGIRYKCDLCSKEYFHKGYLTDHKKIHQGIRYKCNLCSKEFLRKDILIEHKKIHQGIRFKCDL
**************SPSLYDPFRVIKREPLDIPYEVTVKEESYEGDSINVEENNGNDAVTRDCLEFFKSHDS*********RRSINYNCQQSYKVGKLNKILHRGIRYKCDLCSKEYFHKGSLTEHKKRHQGIRYKCDLCSKEYFHKGYLTDHKKIHQGIRYKCNLCSKEFLRKDILIEHKKIHQGIRFKCDL
****VEESQEHVGASPSLYDPFRVIKREPLDIPYEVTVKEESYEGDSINVEENNGNDAVTRDCLEFFKSHDSTLKNESDHERRSINYNCQQSYKVGKLNKILHRGIRYKCDLCSKEYFHKGSLTEHKKRHQGIRYKCDLCSKEYFHKGYLTDHKKIHQGIRYKCNLCSKEFLRKDILIEHKKIHQGIRFKCDL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEPKVEESQEHVGASPSLYDPFRVIKREPLDIPYEVTVKEESYEGDSINVEENNGNDAVTRDCLEFFKSHDSTLKNESDHERRSINYNCQQSYKVGKLNKILHRGIRYKCDLCSKEYFHKGSLTEHKKRHQGIRYKCDLCSKEYFHKGYLTDHKKIHQGIRYKCNLCSKEFLRKDILIEHKKIHQGIRFKCDL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query193 2.2.26 [Sep-21-2011]
O43309604 Zinc finger and SCAN doma yes N/A 0.880 0.281 0.336 3e-15
A1YEP8604 Zinc finger and SCAN doma N/A N/A 0.880 0.281 0.336 3e-15
A2T6V8604 Zinc finger and SCAN doma yes N/A 0.880 0.281 0.336 4e-15
A1YFW2604 Zinc finger and SCAN doma N/A N/A 0.880 0.281 0.336 4e-15
A2T6E3604 Zinc finger and SCAN doma N/A N/A 0.880 0.281 0.331 8e-15
A2T7F4604 Zinc finger and SCAN doma N/A N/A 0.880 0.281 0.331 1e-14
Q8TF45 676 Zinc finger protein 418 O no N/A 0.471 0.134 0.421 1e-13
Q9H4T2348 Zinc finger and SCAN doma no N/A 0.445 0.247 0.404 2e-13
Q99676 751 Zinc finger protein 184 O no N/A 0.471 0.121 0.431 2e-13
Q9UDV7671 Zinc finger protein 282 O no N/A 0.564 0.162 0.381 2e-13
>sp|O43309|ZSC12_HUMAN Zinc finger and SCAN domain-containing protein 12 OS=Homo sapiens GN=ZSCAN12 PE=2 SV=1 Back     alignment and function desciption
 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 62/184 (33%), Positives = 99/184 (53%), Gaps = 14/184 (7%)

Query: 22  FRVIKREPLDIPYEVTVKEESYEGDSINVEENNG--NDAVTRDCLEFFKS--HDSTLKNE 77
           F  IK    D PY+ T   +S+   SI + ++ G    A   +C E  K+  ++S+L + 
Sbjct: 374 FHHIKIHTRDKPYQCTQCNKSFSRRSI-LTQHQGVHTGAKPYECNECGKAFVYNSSLVSH 432

Query: 78  SDHERRSINYNCQQSYKVGKLNKIL-----HRGIR-YKCDLCSKEYFHKGSLTEHKKRHQ 131
            +   +   Y C++  K    + ++     H G + YKCD+C K +  + SLTEH++ H 
Sbjct: 433 QEIHHKEKCYQCKECGKSFSQSGLIQHQRIHTGEKPYKCDVCEKAFIQRTSLTEHQRIHT 492

Query: 132 GIR-YKCDLCSKEYFHKGYLTDHKKIHQGIR-YKCNLCSKEFLRKDILIEHKKIHQGIR- 188
           G R YKCD C K +  +  LT+H++IH G R YKC+ C   F     LI+H++IH G + 
Sbjct: 493 GERPYKCDKCGKAFTQRSVLTEHQRIHTGERPYKCDECGNAFRGITSLIQHQRIHTGEKP 552

Query: 189 FKCD 192
           ++CD
Sbjct: 553 YQCD 556




May be involved in transcriptional regulation.
Homo sapiens (taxid: 9606)
>sp|A1YEP8|ZSC12_GORGO Zinc finger and SCAN domain-containing protein 12 OS=Gorilla gorilla gorilla GN=ZSCAN12 PE=3 SV=1 Back     alignment and function description
>sp|A2T6V8|ZSC12_PANTR Zinc finger and SCAN domain-containing protein 12 OS=Pan troglodytes GN=ZSCAN12 PE=3 SV=1 Back     alignment and function description
>sp|A1YFW2|ZSC12_PANPA Zinc finger and SCAN domain-containing protein 12 OS=Pan paniscus GN=ZSCAN12 PE=3 SV=1 Back     alignment and function description
>sp|A2T6E3|ZSC12_MACNE Zinc finger and SCAN domain-containing protein 12 OS=Macaca nemestrina GN=ZSCAN12 PE=3 SV=1 Back     alignment and function description
>sp|A2T7F4|ZSC12_PONPY Zinc finger and SCAN domain-containing protein 12 OS=Pongo pygmaeus GN=ZSCAN12 PE=3 SV=1 Back     alignment and function description
>sp|Q8TF45|ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens GN=ZNF418 PE=1 SV=2 Back     alignment and function description
>sp|Q9H4T2|ZSC16_HUMAN Zinc finger and SCAN domain-containing protein 16 OS=Homo sapiens GN=ZSCAN16 PE=1 SV=2 Back     alignment and function description
>sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 Back     alignment and function description
>sp|Q9UDV7|ZN282_HUMAN Zinc finger protein 282 OS=Homo sapiens GN=ZNF282 PE=2 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query193
350582020 618 PREDICTED: zinc finger protein 2-like [S 0.699 0.218 0.335 3e-14
442759863 348 Putative zinc finger protein [Ixodes ric 0.544 0.301 0.410 4e-14
292626254 394 PREDICTED: zinc finger protein 226-like 0.803 0.393 0.364 6e-14
158260627 604 unnamed protein product [Homo sapiens] 0.880 0.281 0.336 1e-13
254281232 611 zinc finger and SCAN domain-containing p 0.880 0.278 0.342 1e-13
40788255 613 KIAA0426 [Homo sapiens] 0.880 0.277 0.336 1e-13
256085594 357 zinc finger protein [Schistosoma mansoni 0.481 0.260 0.416 2e-13
11135560 604 RecName: Full=Zinc finger and SCAN domai 0.880 0.281 0.336 2e-13
146328578 604 RecName: Full=Zinc finger and SCAN domai 0.880 0.281 0.336 2e-13
395537815 684 PREDICTED: zinc finger protein 84-like [ 0.440 0.124 0.5 2e-13
>gi|350582020|ref|XP_003354739.2| PREDICTED: zinc finger protein 2-like [Sus scrofa] Back     alignment and taxonomy information
 Score = 84.0 bits (206), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 49/146 (33%), Positives = 77/146 (52%), Gaps = 11/146 (7%)

Query: 57  DAVTRDCLEFFKSHDSTLKNESDHERRSINYNCQQSYKVGKLNKILHRGIR-------YK 109
           D   RDC + F  H S ++++  H      Y+C +  K       L R +        Y+
Sbjct: 365 DQECRDCGKTFFDHSSLIRHQRTHTGEK-PYDCPECGKAFSHRSSLSRHLMSHTGESPYE 423

Query: 110 CDLCSKEYFHKGSLTEHKKRHQGIR-YKCDLCSKEYFHKGYLTDHKKIHQGIR-YKCNLC 167
           C+ C K +F + SLT H++ H G + +KC+ C K +F +  LT H++IH G   Y+CN C
Sbjct: 424 CNACGKAFFDRSSLTVHQRIHTGEKPFKCNECGKAFFDRSSLTRHQRIHTGESPYECNQC 483

Query: 168 SKEFLRKDILIEHKKIHQGIR-FKCD 192
            K F +K IL  H+ IH G + ++C+
Sbjct: 484 GKAFSQKSILTRHQLIHTGRKPYECN 509




Source: Sus scrofa

Species: Sus scrofa

Genus: Sus

Family: Suidae

Order:

Class: Mammalia

Phylum: Chordata

Superkingdom: Eukaryota

>gi|442759863|gb|JAA72090.1| Putative zinc finger protein [Ixodes ricinus] Back     alignment and taxonomy information
>gi|292626254|ref|XP_001346347.3| PREDICTED: zinc finger protein 226-like [Danio rerio] Back     alignment and taxonomy information
>gi|158260627|dbj|BAF82491.1| unnamed protein product [Homo sapiens] Back     alignment and taxonomy information
>gi|254281232|ref|NP_001156863.1| zinc finger and SCAN domain-containing protein 12 [Homo sapiens] Back     alignment and taxonomy information
>gi|40788255|dbj|BAA24856.2| KIAA0426 [Homo sapiens] Back     alignment and taxonomy information
>gi|256085594|ref|XP_002579002.1| zinc finger protein [Schistosoma mansoni] gi|353233177|emb|CCD80532.1| putative zinc finger protein [Schistosoma mansoni] Back     alignment and taxonomy information
>gi|11135560|sp|O43309.1|ZSC12_HUMAN RecName: Full=Zinc finger and SCAN domain-containing protein 12; AltName: Full=Zinc finger protein 305; AltName: Full=Zinc finger protein 96 gi|27371193|gb|AAH41661.1| Zinc finger and SCAN domain containing 12 [Homo sapiens] gi|119623566|gb|EAX03161.1| zinc finger protein 96, isoform CRA_a [Homo sapiens] gi|119623567|gb|EAX03162.1| zinc finger protein 96, isoform CRA_a [Homo sapiens] gi|168267360|dbj|BAG09736.1| zinc finger and SCAN domain-containing protein 12 [synthetic construct] Back     alignment and taxonomy information
>gi|146328578|sp|A1YEP8.1|ZSC12_GORGO RecName: Full=Zinc finger and SCAN domain-containing protein 12; AltName: Full=Zinc finger protein 96 gi|120974013|gb|ABM46616.1| ZNF96 [Gorilla gorilla] Back     alignment and taxonomy information
>gi|395537815|ref|XP_003770885.1| PREDICTED: zinc finger protein 84-like [Sarcophilus harrisii] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query193
UNIPROTKB|O43309604 ZSCAN12 "Zinc finger and SCAN 0.880 0.281 0.342 4.2e-21
UNIPROTKB|F1S1R6610 ZSCAN12 "Uncharacterized prote 0.880 0.278 0.331 4.1e-20
UNIPROTKB|Q08E61613 ZSCAN12 "Zinc finger and SCAN 0.880 0.277 0.326 6.8e-20
UNIPROTKB|F1PFL5609 ZSCAN12 "Uncharacterized prote 0.880 0.279 0.320 1.4e-19
UNIPROTKB|Q96PE6472 ZIM3 "Zinc finger imprinted 3" 0.683 0.279 0.340 5.4e-19
UNIPROTKB|F1SU63 428 ZNF2 "Uncharacterized protein" 0.699 0.315 0.349 1.1e-18
UNIPROTKB|Q9H4T2348 ZSCAN16 "Zinc finger and SCAN 0.979 0.543 0.298 1.4e-18
ZFIN|ZDB-GENE-030131-4589 449 zgc:174263 "zgc:174263" [Danio 0.538 0.231 0.415 1.7e-18
UNIPROTKB|J9NS60 426 ZNF2 "Uncharacterized protein" 0.792 0.359 0.313 1.8e-18
UNIPROTKB|Q3ZBI4348 ZSCAN16 "Uncharacterized prote 0.984 0.545 0.275 2.3e-18
UNIPROTKB|O43309 ZSCAN12 "Zinc finger and SCAN domain-containing protein 12" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 256 (95.2 bits), Expect = 4.2e-21, P = 4.2e-21
 Identities = 63/184 (34%), Positives = 101/184 (54%)

Query:    22 FRVIKREPLDIPYEVTVKEESYEGDSINVEENNG--NDAVTRDCLEFFKS--HDSTLKNE 77
             F  IK    D PY+ T   +S+   SI + ++ G    A   +C E  K+  ++S+L + 
Sbjct:   374 FHHIKIHTRDKPYQCTQCNKSFSRRSI-LTQHQGVHTGAKPYECNECGKAFVYNSSLVSH 432

Query:    78 SDHERRSINYNCQQ---SYKVGKL--NKILHRGIR-YKCDLCSKEYFHKGSLTEHKKRHQ 131
              +   +   Y C++   S+    L  ++ +H G + YKCD+C K +  + SLTEH++ H 
Sbjct:   433 QEIHHKEKCYQCKECGKSFSQSGLIQHQRIHTGEKPYKCDVCEKAFIQRTSLTEHQRIHT 492

Query:   132 GIR-YKCDLCSKEYFHKGYLTDHKKIHQGIR-YKCNLCSKEFLRKDILIEHKKIHQGIR- 188
             G R YKCD C K +  +  LT+H++IH G R YKC+ C   F     LI+H++IH G + 
Sbjct:   493 GERPYKCDKCGKAFTQRSVLTEHQRIHTGERPYKCDECGNAFRGITSLIQHQRIHTGEKP 552

Query:   189 FKCD 192
             ++CD
Sbjct:   553 YQCD 556


GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0016032 "viral reproduction" evidence=IEA
GO:0003677 "DNA binding" evidence=IEA
GO:0006351 "transcription, DNA-dependent" evidence=IEA
GO:0005634 "nucleus" evidence=IEA
UNIPROTKB|F1S1R6 ZSCAN12 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q08E61 ZSCAN12 "Zinc finger and SCAN domain containing 12" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PFL5 ZSCAN12 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q96PE6 ZIM3 "Zinc finger imprinted 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SU63 ZNF2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q9H4T2 ZSCAN16 "Zinc finger and SCAN domain-containing protein 16" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-4589 zgc:174263 "zgc:174263" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|J9NS60 ZNF2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q3ZBI4 ZSCAN16 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 193
KOG2462|consensus279 99.93
KOG2462|consensus279 99.91
KOG1074|consensus 958 99.6
KOG3608|consensus467 99.57
KOG3576|consensus267 99.57
KOG3576|consensus267 99.53
KOG1074|consensus958 99.52
KOG3623|consensus 1007 99.5
KOG3608|consensus 467 99.47
KOG3623|consensus1007 99.46
PHA00733128 hypothetical protein 99.09
PHA0276855 hypothetical protein; Provisional 99.08
PLN03086567 PRLI-interacting factor K; Provisional 99.06
PHA0276855 hypothetical protein; Provisional 98.89
PLN03086567 PRLI-interacting factor K; Provisional 98.86
PHA00733128 hypothetical protein 98.81
KOG3993|consensus500 98.67
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.65
PHA0061644 hypothetical protein 98.64
KOG3993|consensus 500 98.61
PHA0073279 hypothetical protein 98.38
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.36
PHA0061644 hypothetical protein 98.27
PHA0073279 hypothetical protein 98.26
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 98.16
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 98.09
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.95
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.93
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.81
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.8
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 97.71
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.57
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 97.52
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.46
smart0035526 ZnF_C2H2 zinc finger. 97.42
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.4
smart0035526 ZnF_C2H2 zinc finger. 96.96
COG5189423 SFP1 Putative transcriptional repressor regulating 96.94
COG5189423 SFP1 Putative transcriptional repressor regulating 96.76
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 96.74
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 96.71
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 96.59
PRK04860160 hypothetical protein; Provisional 96.49
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 96.47
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 96.15
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 95.83
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 95.83
PRK04860160 hypothetical protein; Provisional 95.56
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 95.02
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 94.08
KOG1146|consensus 1406 92.93
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 92.92
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 92.01
KOG2186|consensus 276 90.86
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 90.19
COG5048467 FOG: Zn-finger [General function prediction only] 90.05
COG5048 467 FOG: Zn-finger [General function prediction only] 89.77
PF06524314 NOA36: NOA36 protein; InterPro: IPR010531 This fam 88.54
KOG1146|consensus1406 88.53
KOG2231|consensus 669 87.89
KOG2893|consensus 341 87.14
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 86.24
KOG2231|consensus 669 85.17
KOG2186|consensus 276 84.82
COG5236 493 Uncharacterized conserved protein, contains RING Z 83.54
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 83.43
KOG4173|consensus253 83.06
KOG2482|consensus 423 82.94
COG5236 493 Uncharacterized conserved protein, contains RING Z 82.71
KOG2785|consensus 390 82.68
COG404965 Uncharacterized protein containing archaeal-type C 82.49
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 82.16
PRK1489059 putative Zn-ribbon RNA-binding protein; Provisiona 81.02
>KOG2462|consensus Back     alignment and domain information
Probab=99.93  E-value=1.2e-26  Score=168.75  Aligned_cols=129  Identities=19%  Similarity=0.431  Sum_probs=115.0

Q ss_pred             cCCCCcccchhHhhccCchhhccccccccc--CCCCccCCCCccc-------chhhhhhcCCCceecccccccccChhHH
Q psy13164         53 NNGNDAVTRDCLEFFKSHDSTLKNESDHER--RSINYNCQQSYKV-------GKLNKILHRGIRYKCDLCSKEYFHKGSL  123 (193)
Q Consensus        53 ~~~~~~~c~~c~~~f~~~~~~~~h~~~~~~--~~~~~~C~~c~~~-------~~~~~~~~~~~~~~C~~C~~~f~~~~~l  123 (193)
                      .....+.|..|++.+.+...|.+|.+.|..  ..+.+.|..|+++       ..|.++|.  .++.|.+||+.|.+..-|
T Consensus       126 ~~~~r~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~--l~c~C~iCGKaFSRPWLL  203 (279)
T KOG2462|consen  126 AKHPRYKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHT--LPCECGICGKAFSRPWLL  203 (279)
T ss_pred             ccCCceeccccccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhhccC--CCcccccccccccchHHh
Confidence            355678899999999999999999998876  3456999999985       45667775  569999999999999999


Q ss_pred             HHHHHhhCCc-ceeccccchhccChhHHHHHHHHhCCc-ccccccCcccccChHHHHHHHHH
Q psy13164        124 TEHKKRHQGI-RYKCDLCSKEYFHKGYLTDHKKIHQGI-RYKCNLCSKEFLRKDILIEHKKI  183 (193)
Q Consensus       124 ~~h~~~h~~~-~~~C~~C~~~f~~~~~l~~H~~~h~~~-~~~C~~C~~~F~~~~~L~~H~~~  183 (193)
                      +-|+++|+|+ ||.|++|+++|...++|+.||++|.+. +|+|..|+++|...+.|.+|...
T Consensus       204 QGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C~KsFsl~SyLnKH~ES  265 (279)
T KOG2462|consen  204 QGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPRCGKSFALKSYLNKHSES  265 (279)
T ss_pred             hcccccccCCCCccCCcccchhcchHHHHHHHHhhcCCccccCcchhhHHHHHHHHHHhhhh
Confidence            9999999998 999999999999999999999999996 99999999999999999999754



>KOG2462|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information
>KOG2186|consensus Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PF06524 NOA36: NOA36 protein; InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>KOG2186|consensus Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query193
2csh_A110 Solution Structure Of Tandem Repeat Of The Zf-C2h2 1e-08
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 1e-08
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 6e-08
2cot_A77 Solution Structure Of The First And Second Zf-C2h2 3e-07
2lce_A74 Chemical Shift Assignment Of Hr4436b From Homo Sapi 4e-07
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 9e-07
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 2e-05
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 2e-05
2jp9_A119 Structure Of The Wilms Tumor Suppressor Protein Zin 2e-05
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 2e-05
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 3e-05
1p47_A87 Crystal Structure Of Tandem Zif268 Molecules Comple 3e-05
1aay_A90 Zif268 Zinc Finger-Dna Complex Length = 90 3e-05
1zaa_C87 Zinc Finger-Dna Recognition: Crystal Structure Of A 4e-05
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 7e-05
2ee8_A106 Solution Structure Of Three Zf-C2h2 Domains From Mo 1e-04
2adr_A60 Adr1 Dna-Binding Domain From Saccharomyces Cerevisi 3e-04
>pdb|2CSH|A Chain A, Solution Structure Of Tandem Repeat Of The Zf-C2h2 Domains Of Human Zinc Finger Protein 297b Length = 110 Back     alignment and structure

Iteration: 1

Score = 56.2 bits (134), Expect = 1e-08, Method: Compositional matrix adjust. Identities = 30/75 (40%), Positives = 42/75 (56%), Gaps = 3/75 (4%) Query: 108 YKCDLCSKEYFHKGSLTEHKKRHQGIR-YKCDLCSKEYFHKGYLTDHKKIHQGIR-YKCN 165 Y C C K + HK H H G+R Y C +C K++ K +L H KIH GI+ Y+CN Sbjct: 11 YPCQ-CGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMKIHTGIKPYECN 69 Query: 166 LCSKEFLRKDILIEH 180 +C+K F+ +D H Sbjct: 70 ICAKRFMWRDSFHRH 84
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure
>pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 Back     alignment and structure
>pdb|2LCE|A Chain A, Chemical Shift Assignment Of Hr4436b From Homo Sapiens, Northeast Structural Genomics Consortium Length = 74 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|2JP9|A Chain A, Structure Of The Wilms Tumor Suppressor Protein Zinc Finger Domain Bound To Dna Length = 119 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 Back     alignment and structure
>pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 Back     alignment and structure
>pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|2EE8|A Chain A, Solution Structure Of Three Zf-C2h2 Domains From Mouse Protein Odd-Skipped-Related 2 Splicing Isoform 2 Length = 106 Back     alignment and structure
>pdb|2ADR|A Chain A, Adr1 Dna-Binding Domain From Saccharomyces Cerevisiae, Nmr, 25 Structures Length = 60 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query193
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 7e-17
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 2e-10
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 1e-15
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 2e-15
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 4e-12
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 3e-15
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 1e-14
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-14
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 4e-14
2i13_A 190 AART; DNA binding, zinc finger, DNA binding protei 3e-11
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 3e-14
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 1e-09
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 4e-14
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 9e-14
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 6e-14
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 1e-08
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 1e-13
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 1e-09
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 2e-09
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 3e-13
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 8e-13
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 4e-13
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 2e-09
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 4e-13
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 1e-07
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 1e-06
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 1e-12
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 1e-08
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 1e-12
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 1e-09
1tf6_A190 Protein (transcription factor IIIA); complex (tran 6e-12
1tf6_A190 Protein (transcription factor IIIA); complex (tran 1e-11
1tf6_A190 Protein (transcription factor IIIA); complex (tran 3e-08
1tf6_A 190 Protein (transcription factor IIIA); complex (tran 3e-07
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 7e-12
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 6e-11
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 1e-11
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 4e-07
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 2e-06
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-11
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 8e-11
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 2e-10
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 3e-08
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 2e-04
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 2e-10
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 3e-08
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 4e-10
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 2e-09
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 2e-06
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 5e-10
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 7e-10
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 5e-10
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 2e-09
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 3e-09
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 7e-07
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 3e-09
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 8e-08
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 1e-08
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 6e-05
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 1e-07
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 5e-06
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 5e-07
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 2e-05
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 5e-07
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 3e-04
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 2e-06
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 8e-06
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 3e-06
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 5e-06
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 7e-05
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 9e-06
2epa_A72 Krueppel-like factor 10; transforming growth facto 1e-05
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 3e-05
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-05
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-05
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-04
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-05
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 6e-05
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 7e-04
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-05
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-04
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-05
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-04
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 9e-05
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 9e-05
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 9e-05
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-05
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-04
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-04
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-04
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-04
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-04
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-04
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-04
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-04
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 7e-04
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-04
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-04
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-04
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-04
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-04
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-04
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-04
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 1e-04
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-04
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-04
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 1e-04
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-04
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-04
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-04
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-04
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-04
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-04
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-04
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-04
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-04
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-04
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-04
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-04
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-04
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-04
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-04
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-04
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-04
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 2e-04
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 2e-04
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-04
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-04
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-04
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 2e-04
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-04
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-04
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 2e-04
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 3e-04
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-04
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-04
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-04
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-04
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-04
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-04
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-04
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-04
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-04
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-04
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-04
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-04
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-04
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-04
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-04
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-04
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 4e-04
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-04
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-04
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-04
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-04
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-04
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-04
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 5e-04
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-04
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-04
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-04
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-04
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-04
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-04
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-04
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 8e-04
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-04
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-04
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
 Score = 71.3 bits (176), Expect = 7e-17
 Identities = 25/81 (30%), Positives = 36/81 (44%), Gaps = 2/81 (2%)

Query: 108 YKCDLCSKEYFHKGSLTEHKKRHQGIR-YKCDLCSKEYFHKGYLTDHKKIHQGIR-YKCN 165
           +KC++C K +  K  L  H + H G++ YKC  C         L  H +IH   R +KC 
Sbjct: 9   HKCEVCGKCFSRKDKLKTHMRCHTGVKPYKCKTCDYAAADSSSLNKHLRIHSDERPFKCQ 68

Query: 166 LCSKEFLRKDILIEHKKIHQG 186
           +C         L  H + H G
Sbjct: 69  ICPYASRNSSQLTVHLRSHTG 89


>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query193
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.96
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.95
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.91
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.91
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.9
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.9
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.89
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.87
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.87
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.86
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.85
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.85
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.84
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.84
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.83
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.83
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.82
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.81
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.81
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.8
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.79
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.79
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.78
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.78
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.76
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.75
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.74
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.74
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.73
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.72
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.67
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.67
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.66
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.65
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.64
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.63
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.63
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.63
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.62
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.61
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.61
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.61
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.6
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.59
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.58
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.57
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.57
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.56
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.55
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.53
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.53
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.53
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.52
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.52
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.51
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.51
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.51
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.5
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.5
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.5
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.5
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.49
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.49
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.47
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.47
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.47
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.46
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.46
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.45
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.45
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.44
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.43
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.41
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.4
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.39
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.39
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.37
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.36
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.33
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.33
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.33
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.32
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.31
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.29
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.27
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.26
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.24
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.24
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.24
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.24
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.24
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.24
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.24
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.24
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.24
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.24
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.24
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.24
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.24
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.24
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.23
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.23
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.23
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.23
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.23
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.23
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.23
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.23
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.23
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.23
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.23
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.23
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.23
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.23
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.23
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.23
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.23
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.23
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.22
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.22
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.22
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.22
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.22
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.22
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.22
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.22
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.22
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.22
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.22
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.22
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.22
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.22
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.22
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.22
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.21
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.21
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.21
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.21
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.21
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.21
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.21
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.21
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.21
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.21
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.21
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.2
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.2
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.2
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.2
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.2
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.2
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.2
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.2
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.2
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.2
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.2
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.19
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.19
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.19
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.19
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.19
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.19
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.19
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.19
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.18
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.18
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.18
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.18
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.17
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.17
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.17
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.17
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 99.16
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.15
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.15
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.14
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 99.13
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.12
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.12
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.11
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.11
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.11
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.11
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.11
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 99.11
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.1
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.1
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.1
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.1
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.1
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.09
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.09
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.09
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.09
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.09
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 99.08
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.08
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.07
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.05
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.05
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.04
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.04
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.04
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.04
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.04
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.03
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.03
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.03
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.03
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.03
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.03
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.02
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.02
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.02
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.02
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.02
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.02
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.02
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.02
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.02
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.02
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.02
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.01
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.01
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.01
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.01
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.0
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.99
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.99
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.99
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.99
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.99
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.99
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.98
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 98.97
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.96
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.96
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.95
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 98.95
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.94
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.94
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.94
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.94
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.93
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.93
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.93
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.92
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.91
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.91
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.91
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.9
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.9
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.9
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.9
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.9
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.89
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.89
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.88
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.88
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.88
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.88
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.88
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.88
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.88
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.87
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.87
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.87
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.87
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.86
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.86
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.86
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.85
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.85
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.85
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.85
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.85
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.85
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.84
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.84
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.84
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.84
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.84
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.84
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.83
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.83
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.82
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.79
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.79
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.78
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.78
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.78
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.77
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.77
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.77
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.75
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.75
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.74
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.73
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.72
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.72
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.72
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.71
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.7
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.69
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.68
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.67
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.67
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.66
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.66
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.64
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.58
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.57
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.56
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.56
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.55
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.53
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.53
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.53
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.53
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.52
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.51
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.51
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.48
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.47
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.85
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.46
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.44
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.42
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.4
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.38
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.73
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.37
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.37
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.35
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.35
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.34
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.32
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.31
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.31
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.29
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.25
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.23
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.23
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.22
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.22
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.21
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.21
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.48
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.17
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.17
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 98.16
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.15
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.14
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.11
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.11
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.06
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.06
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.05
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.04
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.04
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.03
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.01
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.01
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.0
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.22
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 97.97
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 97.95
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 97.93
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.16
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.1
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.86
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.82
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.24
2e72_A49 POGO transposable element with ZNF domain; zinc fi 97.11
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 96.84
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 96.69
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 96.68
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 96.4
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 95.57
2e72_A49 POGO transposable element with ZNF domain; zinc fi 94.29
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 94.21
1fu9_A36 U-shaped transcriptional cofactor; zinc-finger, be 89.16
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 88.0
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 86.16
2jsp_A87 Transcriptional regulatory protein ROS; prokaryoti 85.33
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 83.81
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 83.17
2jsp_A87 Transcriptional regulatory protein ROS; prokaryoti 83.14
4ayb_P48 DNA-directed RNA polymerase; transferase, multi-su 82.73
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
Probab=99.96  E-value=1e-29  Score=182.72  Aligned_cols=161  Identities=24%  Similarity=0.482  Sum_probs=121.1

Q ss_pred             CCCCceeEEEecccccCCCccc----cccCCCCcccchhHhhccCchhhcccccccccCCCCccCCCCccc-------ch
Q psy13164         29 PLDIPYEVTVKEESYEGDSINV----EENNGNDAVTRDCLEFFKSHDSTLKNESDHERRSINYNCQQSYKV-------GK   97 (193)
Q Consensus        29 ~~~~~~~~~~~~~~~~~~~~~~----~~~~~~~~~c~~c~~~f~~~~~~~~h~~~~~~~~~~~~C~~c~~~-------~~   97 (193)
                      ..+.++.|..+...+.....+.    .......+.|..|++.|.+...|..|+..+.. ..+|.|+.|++.       ..
T Consensus        17 ~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~-~~~~~C~~C~~~f~~~~~l~~   95 (190)
T 2i13_A           17 PGEKPYACPECGKSFSRSDHLAEHQRTHTGEKPYKCPECGKSFSDKKDLTRHQRTHTG-EKPYKCPECGKSFSQRANLRA   95 (190)
T ss_dssp             --------------CCSSHHHHHGGGCC---CCEECTTTCCEESSHHHHHHHHHHHHC-CCCEECTTTCCEESCHHHHHH
T ss_pred             CCCCCCcCCCCccccCCHHHHHHHHHHcCCCCCccCCCcCchhCCHHHHHHHHHhcCC-CCCccCcccCCccCCHHHHHH
Confidence            3445678888888877655432    22344678899999999999999999988764 678999999874       56


Q ss_pred             hhhhhcCCCceecccccccccChhHHHHHHHhhCCc-ceeccccchhccChhHHHHHHHHhCCc-ccccccCcccccChH
Q psy13164         98 LNKILHRGIRYKCDLCSKEYFHKGSLTEHKKRHQGI-RYKCDLCSKEYFHKGYLTDHKKIHQGI-RYKCNLCSKEFLRKD  175 (193)
Q Consensus        98 ~~~~~~~~~~~~C~~C~~~f~~~~~l~~h~~~h~~~-~~~C~~C~~~f~~~~~l~~H~~~h~~~-~~~C~~C~~~F~~~~  175 (193)
                      |+++|.+.++|.|..|++.|.+...|..|+++|.+. +|.|..|++.|.....|..|+++|++. ||.|..|++.|....
T Consensus        96 H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~H~~~~~~~C~~C~~~f~~~~  175 (190)
T 2i13_A           96 HQRTHTGEKPYACPECGKSFSQLAHLRAHQRTHTGEKPYKCPECGKSFSREDNLHTHQRTHTGEKPYKCPECGKSFSRRD  175 (190)
T ss_dssp             HHHHHHTCCCEECTTTCCEESSHHHHHHHHHHHHCCCCEECTTTCCEESCHHHHHHHHHHHHCCCCEECTTTCCEESSHH
T ss_pred             HHHhcCCCCCCcCCCCCCccCCHHHHHHHHHHhCCCCCeECCCCCcccCCHHHHHHHHHhcCCCCCeECCCCCCccCCHH
Confidence            778888889999999999999999999999999887 899999999999999999999999987 999999999999999


Q ss_pred             HHHHHHHHcCCCCCC
Q psy13164        176 ILIEHKKIHQGIRFK  190 (193)
Q Consensus       176 ~L~~H~~~h~~~~~~  190 (193)
                      .|..|+++|+|++||
T Consensus       176 ~L~~H~~~H~~~k~~  190 (190)
T 2i13_A          176 ALNVHQRTHTGKKTS  190 (190)
T ss_dssp             HHHHHHTTC------
T ss_pred             HHHHHHHhcCCCCCC
Confidence            999999999999986



>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>2jsp_A Transcriptional regulatory protein ROS; prokaryotic Cys2His2 zinc finger, gene regulation; NMR {Agrobacterium tumefaciens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>2jsp_A Transcriptional regulatory protein ROS; prokaryotic Cys2His2 zinc finger, gene regulation; NMR {Agrobacterium tumefaciens} Back     alignment and structure
>4ayb_P DNA-directed RNA polymerase; transferase, multi-subunit, transcription; 3.20A {Sulfolobus shibatae} PDB: 2pmz_P 2wb1_P 2y0s_P 3hkz_P 2waq_P 4b1o_P 4b1p_X Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 193
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 5e-05
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 1e-04
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 3e-04
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 9e-04
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 0.001
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 0.001
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 0.002
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 0.003
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 37.4 bits (86), Expect = 5e-05
 Identities = 20/51 (39%), Positives = 25/51 (49%), Gaps = 2/51 (3%)

Query: 135 YKCDLCSKEYFHKGYLTDHKKIHQG-IRYKCNLCSKEFLRKDILIEHKKIH 184
           Y C  C K + HK     H  +H G   Y C +C K+F  K  L+ H KIH
Sbjct: 4   YPCQ-CGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMKIH 53


>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query193
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.65
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.6
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.4
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.38
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.34
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.28
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.27
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.22
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.19
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 99.18
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.15
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.14
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.08
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.08
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.07
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 99.06
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.02
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.02
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 98.99
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.98
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.94
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.93
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 98.92
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.92
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.91
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.88
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.86
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.81
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.8
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.75
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.71
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.7
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.67
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.64
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.56
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.53
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.5
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.49
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.48
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.39
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.37
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 98.37
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.35
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.35
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.34
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.1
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 98.05
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.0
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.99
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.94
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.91
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.89
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.88
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.84
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.83
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.72
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.66
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.66
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.61
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.56
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.41
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.35
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.33
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.32
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.31
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.28
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.27
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.24
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.24
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.05
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.01
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 96.99
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.96
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 96.92
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.82
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 96.76
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 96.71
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.71
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 96.66
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.49
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 96.47
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 96.37
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.32
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 96.3
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.28
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.18
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.12
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 95.87
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.66
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 95.59
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 95.4
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 95.36
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 95.23
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 95.09
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 95.06
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 95.01
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 94.94
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 94.92
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 94.92
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 94.71
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 94.56
d1y0jb136 U-shaped transcription factor, different fingers { 94.18
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 93.98
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 93.64
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 92.15
d1y0jb136 U-shaped transcription factor, different fingers { 92.06
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 91.74
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 91.24
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 89.58
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 89.24
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 88.83
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 88.23
d1fu9a_36 U-shaped transcription factor, different fingers { 86.85
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 85.78
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 85.26
d2dlka130 Zinc finger protein 692, ZNF692 {Human (Homo sapie 84.95
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 84.59
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 83.96
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.65  E-value=5e-17  Score=90.58  Aligned_cols=50  Identities=40%  Similarity=0.826  Sum_probs=37.8

Q ss_pred             ceeccccchhccChhHHHHHHHHhCCc-ccccccCcccccChHHHHHHHHHc
Q psy13164        134 RYKCDLCSKEYFHKGYLTDHKKIHQGI-RYKCNLCSKEFLRKDILIEHKKIH  184 (193)
Q Consensus       134 ~~~C~~C~~~f~~~~~l~~H~~~h~~~-~~~C~~C~~~F~~~~~L~~H~~~h  184 (193)
                      ||.| .||+.|.....|..|+++|+|+ ||.|.+|+++|...+.|..|+++|
T Consensus         3 ~y~C-~Cgk~F~~~~~l~~H~~~Ht~ekpy~C~~C~k~F~~~~~L~~H~r~H   53 (53)
T d2csha1           3 LYPC-QCGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMKIH   53 (53)
T ss_dssp             CEEC-TTSCEESSHHHHHHHHHHHSCCCSEECTTTSCEESSSHHHHHHHTTT
T ss_pred             CCCC-CCCCeECCHHHhHHHhhccccccCCcCCCcCCEecCHHHHHHHHhcC
Confidence            6777 4777777777777777777776 777777777777777777777765



>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fu9a_ g.37.1.2 (A:) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2dlka1 g.37.1.1 (A:8-37) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure