Psyllid ID: psy13181


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------
MADYSYGGYPERYGRNQKTLPTEPPYTAFVGNLPNGITQGDVERFFPEQKLVSVRLVKDKETDRFKGFCYVEFVDVENLRQALLKDGRITVDGLQVRLDIADGKRNDNKGGFNNKQNRGGGSGGMGGNKYNQHQDKG
ccccccccccccccccccccccccccEEEEccccccccHHHHHHHcccccEEEEEEcccccccccccEEEEEEccHHHHHHHHHHcccccccccEEEEEcccccccccccccccccccccccccccccccccccccc
cccccccccccccccccccccccccEEEEEEcccccccHHHHHHHHHcccEEEEEEEEcccccccccEEEEEEccHHHHHHHHHccccEEEcccEEEEEEccccccccccccccccccccccccccccccccccccc
madysyggyperygrnqktlpteppytafvgnlpngitqgdverffpeqkLVSVRLVKdketdrfkgfcyveFVDVENLRQALLkdgritvdglqvrldiadgkrndnkggfnnkqnrgggsggmggnkynqhqdkg
madysyggyperygrnqktlptEPPYTAFVGNLPNGITQGDVERFFPEQKLVSVRLVKDKETDRFKGFCYVEFVDVENLRQALlkdgritvdglqvrldiadgkrndnkggfnnkqnrgggsggmggnkynqhqdkg
MADYSYGGYPERYGRNQKTLPTEPPYTAFVGNLPNGITQGDVERFFPEQKLVSVRLVKDKETDRFKGFCYVEFVDVENLRQALLKDGRITVDGLQVRLDIADGKRNDNKGGFNNKQNRgggsggmggNKYNQHQDKG
*************************YTAFVGNLPNGITQGDVERFFPEQKLVSVRLVKDKETDRFKGFCYVEFVDVENLRQALLKDGRITVDGLQVRLDIA************************************
**************************TAFVGNLPNGITQGDVERFFPEQKLVSVRLVKDKETDRFKGFCYVEFVDVENLRQALLKDGRITVDGLQVR****************************************
MADYSYGGYPERYGRNQKTLPTEPPYTAFVGNLPNGITQGDVERFFPEQKLVSVRLVKDKETDRFKGFCYVEFVDVENLRQALLKDGRITVDGLQVRLDIADGKRNDNKGGFNNKQNRGGGSGGMGGNKYNQHQDKG
******************TLPTEPPYTAFVGNLPNGITQGDVERFFPEQKLVSVRLVKDKETDRFKGFCYVEFVDVENLRQALLKDGRITVDGLQVRLDIAD***********************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MADYSYGGYPERYGRNQKTLPTEPPYTAFVGNLPNGITQGDVERFFPEQKLVSVRLVKDKETDRFKGFCYVEFVDVENLRQALLKDGRITVDGLQVRLDIADGKRNDNKGGFNNKQNRGGGSGGMGGNKYNQHQDKG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query137 2.2.26 [Sep-21-2011]
Q15056248 Eukaryotic translation in yes N/A 0.766 0.423 0.474 3e-24
Q5XI72248 Eukaryotic translation in yes N/A 0.671 0.370 0.559 4e-24
Q9WUK2248 Eukaryotic translation in yes N/A 0.671 0.370 0.559 4e-24
Q5RBR8228 Eukaryotic translation in yes N/A 0.678 0.407 0.553 6e-24
Q1JPH6228 Eukaryotic translation in yes N/A 0.678 0.407 0.553 7e-24
O14369 388 Probable RNA-binding prot yes N/A 0.671 0.237 0.414 2e-11
Q04836329 31 kDa ribonucleoprotein, yes N/A 0.664 0.276 0.350 1e-08
Q8BGD9 611 Eukaryotic translation in no N/A 0.627 0.140 0.352 5e-08
Q9FVQ1 557 Nucleolin 1 OS=Arabidopsi no N/A 0.824 0.202 0.352 1e-07
P23588 611 Eukaryotic translation in no N/A 0.627 0.140 0.340 1e-07
>sp|Q15056|IF4H_HUMAN Eukaryotic translation initiation factor 4H OS=Homo sapiens GN=EIF4H PE=1 SV=5 Back     alignment and function desciption
 Score =  110 bits (274), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 83/118 (70%), Gaps = 13/118 (11%)

Query: 15  RNQKTLPTEPPYTAFVGNLPNGITQGDVERFFPEQKLVSVRLVKDKETDRFKGFCYVEFV 74
           R+QK LPTEPPYTA+VGNLP    QGD++  F +  + SVRLV+DK+TD+FKGFCYVEF 
Sbjct: 31  RSQKELPTEPPYTAYVGNLPFNTVQGDIDAIFKDLSIRSVRLVRDKDTDKFKGFCYVEFD 90

Query: 75  DVENLRQALLKDGRITVDGLQVRLDIADGKRN------------DNKGGFNNKQNRGG 120
           +V++L++AL  DG +  D   +R+DIA+G++             D++G  +++++RGG
Sbjct: 91  EVDSLKEALTYDGALLGD-RSLRVDIAEGRKQDKGGFGFRKGGPDDRGMGSSRESRGG 147




Stimulates the RNA helicase activity of EIF4A in the translation initiation complex. Binds weakly mRNA.
Homo sapiens (taxid: 9606)
>sp|Q5XI72|IF4H_RAT Eukaryotic translation initiation factor 4H OS=Rattus norvegicus GN=Eif4h PE=1 SV=1 Back     alignment and function description
>sp|Q9WUK2|IF4H_MOUSE Eukaryotic translation initiation factor 4H OS=Mus musculus GN=Eif4h PE=1 SV=3 Back     alignment and function description
>sp|Q5RBR8|IF4H_PONAB Eukaryotic translation initiation factor 4H OS=Pongo abelii GN=EIF4H PE=2 SV=1 Back     alignment and function description
>sp|Q1JPH6|IF4H_BOVIN Eukaryotic translation initiation factor 4H OS=Bos taurus GN=EIF4H PE=2 SV=1 Back     alignment and function description
>sp|O14369|SCE3_SCHPO Probable RNA-binding protein sce3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sce3 PE=1 SV=1 Back     alignment and function description
>sp|Q04836|ROC3_ARATH 31 kDa ribonucleoprotein, chloroplastic OS=Arabidopsis thaliana GN=RBP31 PE=1 SV=1 Back     alignment and function description
>sp|Q8BGD9|IF4B_MOUSE Eukaryotic translation initiation factor 4B OS=Mus musculus GN=Eif4b PE=1 SV=1 Back     alignment and function description
>sp|Q9FVQ1|NUCL1_ARATH Nucleolin 1 OS=Arabidopsis thaliana GN=NUCL1 PE=1 SV=1 Back     alignment and function description
>sp|P23588|IF4B_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens GN=EIF4B PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query137
380027391 270 PREDICTED: eukaryotic translation initia 0.744 0.377 0.626 6e-29
48103761 274 PREDICTED: eukaryotic translation initia 0.744 0.372 0.626 9e-29
340722741 280 PREDICTED: eukaryotic translation initia 0.744 0.364 0.607 3e-27
346468341 273 hypothetical protein [Amblyomma maculatu 0.788 0.395 0.513 1e-26
350424096 278 PREDICTED: eukaryotic translation initia 0.700 0.345 0.62 1e-26
332022959 285 Eukaryotic translation initiation factor 0.722 0.347 0.564 1e-26
345484780 277 PREDICTED: eukaryotic translation initia 0.671 0.332 0.586 5e-26
383858995 286 PREDICTED: eukaryotic translation initia 0.656 0.314 0.6 9e-26
307203767 249 Eukaryotic translation initiation factor 0.678 0.373 0.580 7e-25
195164911 300 GL20267 [Drosophila persimilis] gi|19410 0.737 0.336 0.574 8e-25
>gi|380027391|ref|XP_003697409.1| PREDICTED: eukaryotic translation initiation factor 4H-like [Apis florea] Back     alignment and taxonomy information
 Score =  132 bits (331), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 67/107 (62%), Positives = 82/107 (76%), Gaps = 5/107 (4%)

Query: 7   GGYPERYGRNQKTLPTEPPYTAFVGNLPNGITQGDVERFFPEQKLVSVRLVKDKETDRFK 66
           GGY  R GR  K LPTEPPYTAFVGNLPNGI QGDV++ F +  +  +RLVKDKETDRFK
Sbjct: 15  GGY--RSGR--KPLPTEPPYTAFVGNLPNGIVQGDVDKIFKKLNVKGIRLVKDKETDRFK 70

Query: 67  GFCYVEFVDVENLRQALLKDGRITVDGLQVRLDIADGKRNDNKGGFN 113
           GFCYVEF D+ +L  AL  DG + VD   +++D+A+GKRND +GGF+
Sbjct: 71  GFCYVEFEDLADLEAALEMDGAVEVDKSVIKIDVAEGKRND-RGGFD 116




Source: Apis florea

Species: Apis florea

Genus: Apis

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|48103761|ref|XP_392894.1| PREDICTED: eukaryotic translation initiation factor 4H-like [Apis mellifera] Back     alignment and taxonomy information
>gi|340722741|ref|XP_003399761.1| PREDICTED: eukaryotic translation initiation factor 4H-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|346468341|gb|AEO34015.1| hypothetical protein [Amblyomma maculatum] Back     alignment and taxonomy information
>gi|350424096|ref|XP_003493687.1| PREDICTED: eukaryotic translation initiation factor 4H-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|332022959|gb|EGI63225.1| Eukaryotic translation initiation factor 4H [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|345484780|ref|XP_001599359.2| PREDICTED: eukaryotic translation initiation factor 4H-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|383858995|ref|XP_003704984.1| PREDICTED: eukaryotic translation initiation factor 4H-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|307203767|gb|EFN82710.1| Eukaryotic translation initiation factor 4H [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|195164911|ref|XP_002023289.1| GL20267 [Drosophila persimilis] gi|194105394|gb|EDW27437.1| GL20267 [Drosophila persimilis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query137
FB|FBgn0262734 358 Rbp2 "RNA-binding protein 2" [ 0.766 0.293 0.562 3.7e-29
ZFIN|ZDB-GENE-010328-19 263 eif4h "eukaryotic translation 0.751 0.391 0.561 1.9e-26
UNIPROTKB|E1BZH4 254 LOC100859865 "Uncharacterized 0.759 0.409 0.554 2.5e-26
UNIPROTKB|F1NYA2146 LOC100859865 "Uncharacterized 0.759 0.712 0.554 2.5e-26
UNIPROTKB|A7MBG9222 WBSCR1 "WBSCR1 protein" [Bos t 0.751 0.463 0.546 2.5e-26
UNIPROTKB|Q1JPH6228 EIF4H "Eukaryotic translation 0.751 0.451 0.546 2.5e-26
UNIPROTKB|E2RQG8251 EIF4H "Uncharacterized protein 0.751 0.410 0.546 2.5e-26
UNIPROTKB|Q15056248 EIF4H "Eukaryotic translation 0.751 0.415 0.546 2.5e-26
UNIPROTKB|I3L594228 EIF4H "Uncharacterized protein 0.751 0.451 0.546 2.5e-26
UNIPROTKB|I3LRD5248 EIF4H "Uncharacterized protein 0.751 0.415 0.546 2.5e-26
FB|FBgn0262734 Rbp2 "RNA-binding protein 2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 300 (110.7 bits), Expect = 3.7e-29, Sum P(2) = 3.7e-29
 Identities = 63/112 (56%), Positives = 79/112 (70%)

Query:     7 GGYPE-RYG----RNQKTLPTEPPYTAFVGNLPNGITQGDVERFFPEQKLVSVRLVKDKE 61
             GGY   R G    R  K LPTEPP+ AFVGNLP G+ QGDV + F + ++  VRLVKD+E
Sbjct:     5 GGYEHARSGFGGDRASKQLPTEPPFIAFVGNLPQGLVQGDVIKIFQDFEVKYVRLVKDRE 64

Query:    62 TDRFKGFCYVEFVDVENLRQALLKDGRITVDGLQ--VRLDIADGKRNDNKGG 111
             TD+FKGFCYVEF  ++NL +AL  DGRI +D L   +R+DIAD ++ND  GG
Sbjct:    65 TDQFKGFCYVEFETLDNLERALECDGRIKLDDLSAPLRIDIADRRKNDRPGG 116


GO:0003729 "mRNA binding" evidence=ISS;NAS
GO:0006413 "translational initiation" evidence=ISS
GO:0005829 "cytosol" evidence=ISS
GO:0003743 "translation initiation factor activity" evidence=ISS
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0000166 "nucleotide binding" evidence=IEA
GO:0005875 "microtubule associated complex" evidence=IDA
ZFIN|ZDB-GENE-010328-19 eif4h "eukaryotic translation initiation factor 4h" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1BZH4 LOC100859865 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NYA2 LOC100859865 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|A7MBG9 WBSCR1 "WBSCR1 protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q1JPH6 EIF4H "Eukaryotic translation initiation factor 4H" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RQG8 EIF4H "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q15056 EIF4H "Eukaryotic translation initiation factor 4H" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|I3L594 EIF4H "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|I3LRD5 EIF4H "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9WUK2IF4H_MOUSENo assigned EC number0.55910.67150.3709yesN/A
Q5XI72IF4H_RATNo assigned EC number0.55910.67150.3709yesN/A
Q5RBR8IF4H_PONABNo assigned EC number0.55310.67880.4078yesN/A
Q1JPH6IF4H_BOVINNo assigned EC number0.55310.67880.4078yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query137
cd1240176 cd12401, RRM_eIF4H, RNA recognition motif in eukar 8e-33
cd1240277 cd12402, RRM_eIF4B, RNA recognition motif in eukar 3e-16
cd1227272 cd12272, RRM2_PHIP1, RNA recognition motif 2 in Ar 7e-15
smart0036073 smart00360, RRM, RNA recognition motif 1e-14
cd1244873 cd12448, RRM2_gar2, RNA recognition motif 2 in yea 7e-14
cd1245077 cd12450, RRM1_NUCLs, RNA recognition motif 1 found 1e-12
cd1239978 cd12399, RRM_HP0827_like, RNA recognition motif in 2e-12
cd1228373 cd12283, RRM1_RBM39_like, RNA recognition motif 1 5e-12
cd1240074 cd12400, RRM_Nop6, RNA recognition motif in Saccha 9e-12
cd1239172 cd12391, RRM1_SART3, RNA recognition motif 1 in sq 1e-11
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 2e-11
cd1239573 cd12395, RRM2_RBM34, RNA recognition motif 2 in RN 2e-11
pfam0007670 pfam00076, RRM_1, RNA recognition motif 2e-10
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 2e-10
COG0724306 COG0724, COG0724, RNA-binding proteins (RRM domain 4e-09
cd1241189 cd12411, RRM_ist3_like, RNA recognition motif in i 5e-09
cd1231384 cd12313, RRM1_RRM2_RBM5_like, RNA recognition moti 6e-09
cd1234481 cd12344, RRM1_SECp43_like, RNA recognition motif 1 5e-08
cd1239875 cd12398, RRM_CSTF2_RNA15_like, RNA recognition mot 6e-08
cd1244776 cd12447, RRM1_gar2, RNA recognition motif 1 in yea 6e-08
cd1241379 cd12413, RRM1_RBM28_like, RNA recognition motif 1 6e-08
TIGR01622 457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 2e-07
cd1267479 cd12674, RRM1_Nop4p, RNA recognition motif 1 in ye 3e-07
cd1224273 cd12242, RRM_SLIRP, RNA recognition motif found in 3e-07
cd1228473 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 4e-07
cd1231674 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition mot 5e-07
cd1239378 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc 8e-07
cd1230673 cd12306, RRM_II_PABPs, RNA recognition motif in ty 2e-06
cd1241582 cd12415, RRM3_RBM28_like, RNA recognition motif 3 4e-06
cd1256679 cd12566, RRM2_MRD1, RNA recognition motif 2 in yea 4e-06
cd1244980 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in 6e-06
cd1267175 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif i 7e-06
cd1223793 cd12237, RRM_snRNP35, RNA recognition motif found 7e-06
cd1238280 cd12382, RRM_RBMX_like, RNA recognition motif in h 8e-06
cd1267079 cd12670, RRM2_Nop12p_like, RNA recognition motif 2 1e-05
cd1239281 cd12392, RRM2_SART3, RNA recognition motif 2 in sq 1e-05
cd1237880 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in 1e-05
TIGR01622 457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 3e-05
cd1222577 cd12225, RRM1_2_CID8_like, RNA recognition motif 1 3e-05
cd1230774 cd12307, RRM_NIFK_like, RNA recognition motif in n 4e-05
cd1231284 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif 5e-05
cd1229671 cd12296, RRM1_Prp24, RNA recognition motif 1 in fu 6e-05
cd1232873 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 7e-05
cd1223691 cd12236, RRM_snRNP70, RNA recognition motif in U1 8e-05
cd1263380 cd12633, RRM1_FCA, RNA recognition motif 1 in plan 8e-05
cd1223177 cd12231, RRM2_U2AF65, RNA recognition motif 2 foun 8e-05
cd1236378 cd12363, RRM_TRA2, RNA recognition motif in transf 9e-05
cd1261780 cd12617, RRM2_TIAR, RNA recognition motif 2 in nuc 1e-04
cd1240877 cd12408, RRM_eIF3G_like, RNA recognition motif in 1e-04
cd1232975 cd12329, RRM2_hnRNPD_like, RNA recognition motif 2 1e-04
cd1253685 cd12536, RRM1_RBM39, RNA recognition motif 1 in ve 1e-04
cd1234773 cd12347, RRM_PPIE, RNA recognition motif in cyclop 1e-04
cd1238476 cd12384, RRM_RBM24_RBM38_like, RNA recognition mot 2e-04
cd1251473 cd12514, RRM4_RBM12_like, RNA recognition motif 4 2e-04
cd1234580 cd12345, RRM2_SECp43_like, RNA recognition motif 2 2e-04
cd1238383 cd12383, RRM_RBM42, RNA recognition motif in RNA-b 3e-04
cd1261880 cd12618, RRM2_TIA1, RNA recognition motif 2 in nuc 3e-04
cd1223082 cd12230, RRM1_U2AF65, RNA recognition motif 1 foun 3e-04
cd1225473 cd12254, RRM_hnRNPH_ESRPs_RBM12_like, RNA recognit 4e-04
cd1235473 cd12354, RRM3_TIA1_like, RNA recognition motif 2 i 4e-04
cd1255277 cd12552, RRM_Nop15p, RNA recognition motif in yeas 5e-04
cd1253785 cd12537, RRM1_RBM23, RNA recognition motif 1 in ve 7e-04
cd1229778 cd12297, RRM2_Prp24, RNA recognition motif 2 in fu 9e-04
cd1239491 cd12394, RRM1_RBM34, RNA recognition motif 1 in RN 9e-04
cd1233075 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in ye 0.001
cd1259972 cd12599, RRM1_SF2_plant_like, RNA recognition moti 0.002
PLN03134144 PLN03134, PLN03134, glycine-rich RNA-binding prote 0.002
cd1255984 cd12559, RRM_SRSF10, RNA recognition motif in seri 0.002
cd1256084 cd12560, RRM_SRSF12, RNA recognition motif in seri 0.002
cd1232374 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA- 0.002
cd1244684 cd12446, RRM_RBM25, RNA recognition motif in eukar 0.002
cd1264279 cd12642, RRM_TRA2A, RNA recognition motif in trans 0.002
cd1255076 cd12550, RRM_II_PABPN1, RNA recognition motif in t 0.002
cd1232076 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition mot 0.003
cd1256181 cd12561, RRM1_RBM5_like, RNA recognition motif 1 i 0.003
cd1240678 cd12406, RRM4_NCL, RNA recognition motif 4 in vert 0.004
cd1257482 cd12574, RRM1_DAZAP1, RNA recognition motif 1 in D 0.004
>gnl|CDD|240847 cd12401, RRM_eIF4H, RNA recognition motif in eukaryotic translation initiation factor 4H (eIF-4H) and similar proteins Back     alignment and domain information
 Score =  110 bits (276), Expect = 8e-33
 Identities = 45/77 (58%), Positives = 58/77 (75%), Gaps = 1/77 (1%)

Query: 25  PYTAFVGNLPNGITQGDVERFFPEQKLVSVRLVKDKETDRFKGFCYVEFVDVENLRQALL 84
           P+TAFVGNLP    QGD++  F +  + SVRLV+DKETD+FKGFCYVEF DVE+L++AL 
Sbjct: 1   PFTAFVGNLPFNTVQGDLDAIFKDLSVKSVRLVRDKETDKFKGFCYVEFEDVESLKEALE 60

Query: 85  KDGRITVDGLQVRLDIA 101
            DG +  D   +R+DIA
Sbjct: 61  YDGAL-FDDRSLRVDIA 76


This subfamily corresponds to the RRM of eIF-4H, also termed Williams-Beuren syndrome chromosomal region 1 protein, which, together with elf-4B/eIF-4G, serves as the accessory protein of RNA helicase eIF-4A. eIF-4H contains a well conserved RNA recognition motif (RRM), also termed RBD (RNA binding domain) or RNP (ribonucleoprotein domain). It stimulates protein synthesis by enhancing the helicase activity of eIF-4A in the initiation step of mRNA translation. . Length = 76

>gnl|CDD|240848 cd12402, RRM_eIF4B, RNA recognition motif in eukaryotic translation initiation factor 4B (eIF-4B) and similar proteins Back     alignment and domain information
>gnl|CDD|240718 cd12272, RRM2_PHIP1, RNA recognition motif 2 in Arabidopsis thaliana phragmoplastin interacting protein 1 (PHIP1) and similar proteins Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240894 cd12448, RRM2_gar2, RNA recognition motif 2 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|240896 cd12450, RRM1_NUCLs, RNA recognition motif 1 found in nucleolin-like proteins mainly from plants Back     alignment and domain information
>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins Back     alignment and domain information
>gnl|CDD|240729 cd12283, RRM1_RBM39_like, RNA recognition motif 1 in vertebrate RNA-binding protein 39 (RBM39) and similar proteins Back     alignment and domain information
>gnl|CDD|240846 cd12400, RRM_Nop6, RNA recognition motif in Saccharomyces cerevisiae nucleolar protein 6 (Nop6) and similar proteins Back     alignment and domain information
>gnl|CDD|240837 cd12391, RRM1_SART3, RNA recognition motif 1 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|240841 cd12395, RRM2_RBM34, RNA recognition motif 2 in RNA-binding protein 34 (RBM34) and similar proteins Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>gnl|CDD|240857 cd12411, RRM_ist3_like, RNA recognition motif in ist3 family Back     alignment and domain information
>gnl|CDD|240759 cd12313, RRM1_RRM2_RBM5_like, RNA recognition motif 1 and 2 in RNA-binding protein 5 (RBM5) and similar proteins Back     alignment and domain information
>gnl|CDD|240790 cd12344, RRM1_SECp43_like, RNA recognition motif 1 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins Back     alignment and domain information
>gnl|CDD|240844 cd12398, RRM_CSTF2_RNA15_like, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), yeast ortholog mRNA 3'-end-processing protein RNA15 and similar proteins Back     alignment and domain information
>gnl|CDD|240893 cd12447, RRM1_gar2, RNA recognition motif 1 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|240859 cd12413, RRM1_RBM28_like, RNA recognition motif 1 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|241118 cd12674, RRM1_Nop4p, RNA recognition motif 1 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240688 cd12242, RRM_SLIRP, RNA recognition motif found in SRA stem-loop-interacting RNA-binding protein (SLIRP) and similar proteins Back     alignment and domain information
>gnl|CDD|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate RNA-binding protein RBM23, RBM39 and similar proteins Back     alignment and domain information
>gnl|CDD|240762 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and RNA recognition motif 2 found in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|240839 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc finger CCHC-type and RNA-binding motif-containing protein 1 (ZCRB1) and similar proteins Back     alignment and domain information
>gnl|CDD|240752 cd12306, RRM_II_PABPs, RNA recognition motif in type II polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|241010 cd12566, RRM2_MRD1, RNA recognition motif 2 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240895 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in cold inducible RNA binding protein (CIRBP), RNA binding motif protein 3 (RBM3) and similar proteins Back     alignment and domain information
>gnl|CDD|241115 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), cleavage stimulation factor subunit 2 tau variant (CSTF2T) and similar proteins Back     alignment and domain information
>gnl|CDD|240683 cd12237, RRM_snRNP35, RNA recognition motif found in U11/U12 small nuclear ribonucleoprotein 35 kDa protein (U11/U12-35K) and similar proteins Back     alignment and domain information
>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins Back     alignment and domain information
>gnl|CDD|241114 cd12670, RRM2_Nop12p_like, RNA recognition motif 2 in yeast nucleolar protein 12 (Nop12p) and similar proteins Back     alignment and domain information
>gnl|CDD|240838 cd12392, RRM2_SART3, RNA recognition motif 2 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|240824 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|240671 cd12225, RRM1_2_CID8_like, RNA recognition motif 1 and 2 (RRM1, RRM2) in Arabidopsis thaliana CTC-interacting domain protein CID8, CID9, CID10, CID11, CID12, CID 13 and similar proteins Back     alignment and domain information
>gnl|CDD|240753 cd12307, RRM_NIFK_like, RNA recognition motif in nucleolar protein interacting with the FHA domain of pKI-67 (NIFK) and similar proteins Back     alignment and domain information
>gnl|CDD|240758 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif in serine/arginine-rich splicing factor SRSF10, SRSF12 and similar proteins Back     alignment and domain information
>gnl|CDD|240742 cd12296, RRM1_Prp24, RNA recognition motif 1 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|240774 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|240682 cd12236, RRM_snRNP70, RNA recognition motif in U1 small nuclear ribonucleoprotein 70 kDa (U1-70K) and similar proteins Back     alignment and domain information
>gnl|CDD|241077 cd12633, RRM1_FCA, RNA recognition motif 1 in plant flowering time control protein FCA and similar proteins Back     alignment and domain information
>gnl|CDD|240677 cd12231, RRM2_U2AF65, RNA recognition motif 2 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins Back     alignment and domain information
>gnl|CDD|240809 cd12363, RRM_TRA2, RNA recognition motif in transformer-2 protein homolog TRA2-alpha, TRA2-beta and similar proteins Back     alignment and domain information
>gnl|CDD|241061 cd12617, RRM2_TIAR, RNA recognition motif 2 in nucleolysin TIAR and similar proteins Back     alignment and domain information
>gnl|CDD|240854 cd12408, RRM_eIF3G_like, RNA recognition motif in eukaryotic translation initiation factor 3 subunit G (eIF-3G) and similar proteins Back     alignment and domain information
>gnl|CDD|240775 cd12329, RRM2_hnRNPD_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein hnRNP D0, hnRNP A/B, hnRNP DL and similar proteins Back     alignment and domain information
>gnl|CDD|240980 cd12536, RRM1_RBM39, RNA recognition motif 1 in vertebrate RNA-binding protein 39 (RBM39) Back     alignment and domain information
>gnl|CDD|240793 cd12347, RRM_PPIE, RNA recognition motif in cyclophilin-33 (Cyp33) and similar proteins Back     alignment and domain information
>gnl|CDD|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in eukaryotic RNA-binding protein RBM24, RBM38 and similar proteins Back     alignment and domain information
>gnl|CDD|240958 cd12514, RRM4_RBM12_like, RNA recognition motif 4 in RNA-binding protein RBM12, RBM12B and similar proteins Back     alignment and domain information
>gnl|CDD|240791 cd12345, RRM2_SECp43_like, RNA recognition motif 2 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins Back     alignment and domain information
>gnl|CDD|240829 cd12383, RRM_RBM42, RNA recognition motif in RNA-binding protein 42 (RBM42) and similar proteins Back     alignment and domain information
>gnl|CDD|241062 cd12618, RRM2_TIA1, RNA recognition motif 2 in nucleolysin TIA-1 isoform p40 (p40-TIA-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240676 cd12230, RRM1_U2AF65, RNA recognition motif 1 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins Back     alignment and domain information
>gnl|CDD|240700 cd12254, RRM_hnRNPH_ESRPs_RBM12_like, RNA recognition motif found in heterogeneous nuclear ribonucleoprotein (hnRNP) H protein family, epithelial splicing regulatory proteins (ESRPs), Drosophila RNA-binding protein Fusilli, RNA-binding protein 12 (RBM12) and similar proteins Back     alignment and domain information
>gnl|CDD|240800 cd12354, RRM3_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins (p40-TIA-1 and TIAR), and yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 Back     alignment and domain information
>gnl|CDD|240996 cd12552, RRM_Nop15p, RNA recognition motif in yeast ribosome biogenesis protein 15 (Nop15p) and similar proteins Back     alignment and domain information
>gnl|CDD|240981 cd12537, RRM1_RBM23, RNA recognition motif 1 in vertebrate probable RNA-binding protein 23 (RBM23) Back     alignment and domain information
>gnl|CDD|240743 cd12297, RRM2_Prp24, RNA recognition motif 2 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|240840 cd12394, RRM1_RBM34, RNA recognition motif 1 in RNA-binding protein 34 (RBM34) and similar proteins Back     alignment and domain information
>gnl|CDD|240776 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in yeast nuclear polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p) and similar proteins Back     alignment and domain information
>gnl|CDD|241043 cd12599, RRM1_SF2_plant_like, RNA recognition motif 1 in plant pre-mRNA-splicing factor SF2 and similar proteins Back     alignment and domain information
>gnl|CDD|178680 PLN03134, PLN03134, glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>gnl|CDD|241003 cd12559, RRM_SRSF10, RNA recognition motif in serine/arginine-rich splicing factor 10 (SRSF10) and similar proteins Back     alignment and domain information
>gnl|CDD|241004 cd12560, RRM_SRSF12, RNA recognition motif in serine/arginine-rich splicing factor 12 (SRSF12) and similar proteins Back     alignment and domain information
>gnl|CDD|240769 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA-binding protein Musashi homologs Musashi-1, Musashi-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240892 cd12446, RRM_RBM25, RNA recognition motif in eukaryotic RNA-binding protein 25 and similar proteins Back     alignment and domain information
>gnl|CDD|241086 cd12642, RRM_TRA2A, RNA recognition motif in transformer-2 protein homolog alpha (TRA-2 alpha) and similar proteins Back     alignment and domain information
>gnl|CDD|240994 cd12550, RRM_II_PABPN1, RNA recognition motif in type II polyadenylate-binding protein 2 (PABP-2) and similar proteins Back     alignment and domain information
>gnl|CDD|240766 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition motif 6 in RNA-binding protein 19 (RBM19 or RBD-1) and RNA recognition motif 5 in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|241005 cd12561, RRM1_RBM5_like, RNA recognition motif 1 in RNA-binding protein 5 (RBM5) and similar proteins Back     alignment and domain information
>gnl|CDD|240852 cd12406, RRM4_NCL, RNA recognition motif 4 in vertebrate nucleolin Back     alignment and domain information
>gnl|CDD|241018 cd12574, RRM1_DAZAP1, RNA recognition motif 1 in Deleted in azoospermia-associated protein 1 (DAZAP1) and similar proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 137
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 99.86
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 99.77
KOG0121|consensus153 99.69
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.69
TIGR01659 346 sex-lethal sex-lethal family splicing factor. This 99.66
TIGR01661 352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.65
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 99.63
KOG0122|consensus270 99.62
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 99.57
KOG0149|consensus 247 99.57
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 99.54
KOG0105|consensus 241 99.54
KOG0107|consensus195 99.53
KOG0113|consensus 335 99.52
KOG4207|consensus 256 99.51
PLN03120 260 nucleic acid binding protein; Provisional 99.51
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.5
TIGR01622 457 SF-CC1 splicing factor, CC1-like family. A homolog 99.5
KOG0130|consensus170 99.49
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 99.49
KOG0125|consensus 376 99.48
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 99.48
TIGR01622 457 SF-CC1 splicing factor, CC1-like family. A homolog 99.47
TIGR01642 509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.47
KOG0126|consensus219 99.47
KOG0144|consensus 510 99.46
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.45
KOG0111|consensus 298 99.44
PLN03121 243 nucleic acid binding protein; Provisional 99.43
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 99.42
KOG0145|consensus 360 99.42
smart0036272 RRM_2 RNA recognition motif. 99.41
PLN03213 759 repressor of silencing 3; Provisional 99.39
smart0036071 RRM RNA recognition motif. 99.38
COG0724306 RNA-binding proteins (RRM domain) [General functio 99.37
KOG0144|consensus 510 99.36
KOG0131|consensus203 99.36
KOG0148|consensus 321 99.36
KOG0117|consensus 506 99.34
KOG0108|consensus 435 99.33
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 99.33
KOG0114|consensus124 99.33
KOG0148|consensus321 99.3
KOG4212|consensus 608 99.29
TIGR01649 481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.28
KOG0117|consensus 506 99.27
TIGR01649481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.27
KOG0127|consensus 678 99.24
KOG0127|consensus 678 99.2
KOG0109|consensus 346 99.2
KOG0415|consensus 479 99.18
KOG0145|consensus360 99.18
KOG0146|consensus 371 99.17
KOG0116|consensus419 99.17
KOG0146|consensus371 99.14
KOG0124|consensus 544 99.14
smart0036170 RRM_1 RNA recognition motif. 99.08
KOG0147|consensus 549 99.07
KOG4205|consensus 311 99.06
TIGR01642 509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.06
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 99.04
KOG4208|consensus214 99.01
KOG0124|consensus 544 99.01
KOG0153|consensus377 99.0
KOG4206|consensus221 98.96
KOG0109|consensus 346 98.95
KOG0131|consensus203 98.95
KOG4205|consensus 311 98.95
KOG0123|consensus 369 98.88
KOG0132|consensus 894 98.86
KOG4211|consensus 510 98.86
KOG0533|consensus243 98.79
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 98.7
KOG0123|consensus 369 98.68
KOG1457|consensus 284 98.67
KOG0226|consensus290 98.65
KOG4211|consensus 510 98.65
KOG0110|consensus725 98.65
KOG0110|consensus725 98.64
KOG4661|consensus 940 98.62
KOG4209|consensus231 98.58
KOG4212|consensus608 98.51
KOG0106|consensus 216 98.46
KOG4849|consensus 498 98.36
KOG1548|consensus 382 98.33
KOG4454|consensus 267 98.32
KOG0151|consensus 877 98.3
KOG4660|consensus 549 98.28
KOG1995|consensus 351 98.23
KOG4210|consensus285 98.04
KOG0120|consensus500 98.03
KOG0147|consensus 549 97.99
KOG1457|consensus284 97.94
KOG1365|consensus 508 97.88
KOG1190|consensus492 97.84
KOG4206|consensus221 97.8
KOG4307|consensus944 97.77
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 97.73
KOG0129|consensus520 97.58
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 97.55
KOG0106|consensus216 97.46
KOG1365|consensus 508 97.39
KOG1190|consensus492 97.25
KOG0129|consensus 520 97.24
COG5175 480 MOT2 Transcriptional repressor [Transcription] 97.14
KOG4307|consensus 944 96.98
KOG0105|consensus241 96.89
PF0867587 RNA_bind: RNA binding domain; InterPro: IPR014789 96.82
PF05172100 Nup35_RRM: Nup53/35/40-type RNA recognition motif; 96.81
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 96.67
PF1030962 DUF2414: Protein of unknown function (DUF2414); In 96.53
PF03467176 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 96.36
KOG2193|consensus 584 96.34
PF08952146 DUF1866: Domain of unknown function (DUF1866) ; In 96.2
KOG1456|consensus494 96.2
KOG0120|consensus500 96.18
KOG1456|consensus 494 96.16
KOG2416|consensus 718 96.14
KOG0128|consensus881 95.81
KOG1548|consensus382 95.76
KOG3152|consensus278 95.68
PF07576110 BRAP2: BRCA1-associated protein 2; InterPro: IPR01 95.59
KOG2314|consensus 698 95.57
KOG1855|consensus 484 95.16
KOG0112|consensus 975 95.14
KOG0128|consensus 881 95.06
KOG1996|consensus378 94.61
KOG0804|consensus 493 94.44
KOG4676|consensus 479 93.75
KOG0115|consensus 275 93.57
KOG2202|consensus260 92.84
KOG0112|consensus 975 92.32
PRK11634629 ATP-dependent RNA helicase DeaD; Provisional 92.22
KOG2591|consensus 684 91.99
KOG2068|consensus 327 91.69
PF0388074 DbpA: DbpA RNA binding domain ; InterPro: IPR00558 90.8
KOG4660|consensus549 90.75
PF1176766 SET_assoc: Histone lysine methyltransferase SET as 90.69
KOG4410|consensus396 88.97
PF04847184 Calcipressin: Calcipressin; InterPro: IPR006931 Ca 88.54
KOG4210|consensus285 88.08
KOG2253|consensus 668 87.56
KOG4285|consensus350 86.86
KOG2135|consensus526 86.53
KOG4483|consensus528 86.42
PF15023166 DUF4523: Protein of unknown function (DUF4523) 83.61
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
Probab=99.86  E-value=1.6e-20  Score=124.79  Aligned_cols=85  Identities=25%  Similarity=0.473  Sum_probs=79.1

Q ss_pred             CCceEEEcCCCCCCCHHHHHhcCcCC-ceeEEEEeecCCCCCeecEEEEEEcCHHHHHHHHH-hCCCeeecCeEEEEEec
Q psy13181         24 PPYTAFVGNLPNGITQGDVERFFPEQ-KLVSVRLVKDKETDRFKGFCYVEFVDVENLRQALL-KDGRITVDGLQVRLDIA  101 (137)
Q Consensus        24 ~~~~l~v~nlp~~~~e~~l~~~f~~~-~i~~i~~~~~~~t~~~~g~~fv~f~~~~~a~~al~-l~~~~~l~g~~l~v~~a  101 (137)
                      ..++|||+|||+.++|++|+++|++| .|..|.++.++.|+++++||||+|.+.++|++||. |++ ..|+++.|+|.++
T Consensus        33 ~~~~lfVgnL~~~~te~~L~~~F~~~G~I~~v~i~~d~~tg~~kGfaFV~F~~~e~A~~Al~~lng-~~i~Gr~l~V~~a  111 (144)
T PLN03134         33 MSTKLFIGGLSWGTDDASLRDAFAHFGDVVDAKVIVDRETGRSRGFGFVNFNDEGAATAAISEMDG-KELNGRHIRVNPA  111 (144)
T ss_pred             CCCEEEEeCCCCCCCHHHHHHHHhcCCCeEEEEEEecCCCCCcceEEEEEECCHHHHHHHHHHcCC-CEECCEEEEEEeC
Confidence            45789999999999999999999999 99999999999999999999999999999999999 999 9999999999999


Q ss_pred             CCCCCCCC
Q psy13181        102 DGKRNDNK  109 (137)
Q Consensus       102 ~~~~~~~~  109 (137)
                      .+++...+
T Consensus       112 ~~~~~~~~  119 (144)
T PLN03134        112 NDRPSAPR  119 (144)
T ss_pred             CcCCCCCC
Confidence            87765433



>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>KOG0121|consensus Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>KOG0122|consensus Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>KOG0149|consensus Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>KOG0105|consensus Back     alignment and domain information
>KOG0107|consensus Back     alignment and domain information
>KOG0113|consensus Back     alignment and domain information
>KOG4207|consensus Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>KOG0130|consensus Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>KOG0125|consensus Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>KOG0126|consensus Back     alignment and domain information
>KOG0144|consensus Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>KOG0111|consensus Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>KOG0145|consensus Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>KOG0144|consensus Back     alignment and domain information
>KOG0131|consensus Back     alignment and domain information
>KOG0148|consensus Back     alignment and domain information
>KOG0117|consensus Back     alignment and domain information
>KOG0108|consensus Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>KOG0114|consensus Back     alignment and domain information
>KOG0148|consensus Back     alignment and domain information
>KOG4212|consensus Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>KOG0117|consensus Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>KOG0127|consensus Back     alignment and domain information
>KOG0127|consensus Back     alignment and domain information
>KOG0109|consensus Back     alignment and domain information
>KOG0415|consensus Back     alignment and domain information
>KOG0145|consensus Back     alignment and domain information
>KOG0146|consensus Back     alignment and domain information
>KOG0116|consensus Back     alignment and domain information
>KOG0146|consensus Back     alignment and domain information
>KOG0124|consensus Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG0147|consensus Back     alignment and domain information
>KOG4205|consensus Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>KOG4208|consensus Back     alignment and domain information
>KOG0124|consensus Back     alignment and domain information
>KOG0153|consensus Back     alignment and domain information
>KOG4206|consensus Back     alignment and domain information
>KOG0109|consensus Back     alignment and domain information
>KOG0131|consensus Back     alignment and domain information
>KOG4205|consensus Back     alignment and domain information
>KOG0123|consensus Back     alignment and domain information
>KOG0132|consensus Back     alignment and domain information
>KOG4211|consensus Back     alignment and domain information
>KOG0533|consensus Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>KOG0123|consensus Back     alignment and domain information
>KOG1457|consensus Back     alignment and domain information
>KOG0226|consensus Back     alignment and domain information
>KOG4211|consensus Back     alignment and domain information
>KOG0110|consensus Back     alignment and domain information
>KOG0110|consensus Back     alignment and domain information
>KOG4661|consensus Back     alignment and domain information
>KOG4209|consensus Back     alignment and domain information
>KOG4212|consensus Back     alignment and domain information
>KOG0106|consensus Back     alignment and domain information
>KOG4849|consensus Back     alignment and domain information
>KOG1548|consensus Back     alignment and domain information
>KOG4454|consensus Back     alignment and domain information
>KOG0151|consensus Back     alignment and domain information
>KOG4660|consensus Back     alignment and domain information
>KOG1995|consensus Back     alignment and domain information
>KOG4210|consensus Back     alignment and domain information
>KOG0120|consensus Back     alignment and domain information
>KOG0147|consensus Back     alignment and domain information
>KOG1457|consensus Back     alignment and domain information
>KOG1365|consensus Back     alignment and domain information
>KOG1190|consensus Back     alignment and domain information
>KOG4206|consensus Back     alignment and domain information
>KOG4307|consensus Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>KOG0129|consensus Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>KOG0106|consensus Back     alignment and domain information
>KOG1365|consensus Back     alignment and domain information
>KOG1190|consensus Back     alignment and domain information
>KOG0129|consensus Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG4307|consensus Back     alignment and domain information
>KOG0105|consensus Back     alignment and domain information
>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) Back     alignment and domain information
>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function Back     alignment and domain information
>PF03467 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 Nonsense-mediated mRNA decay (NMD) is a surveillance mechanism by which eukaryotic cells detect and degrade transcripts containing premature termination codons Back     alignment and domain information
>KOG2193|consensus Back     alignment and domain information
>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function Back     alignment and domain information
>KOG1456|consensus Back     alignment and domain information
>KOG0120|consensus Back     alignment and domain information
>KOG1456|consensus Back     alignment and domain information
>KOG2416|consensus Back     alignment and domain information
>KOG0128|consensus Back     alignment and domain information
>KOG1548|consensus Back     alignment and domain information
>KOG3152|consensus Back     alignment and domain information
>PF07576 BRAP2: BRCA1-associated protein 2; InterPro: IPR011422 These proteins include BRCA1-associated protein 2 (BRAP2), which binds nuclear localisation signals (NLSs) in vitro and in yeast two-hybrid screening [] Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>KOG1855|consensus Back     alignment and domain information
>KOG0112|consensus Back     alignment and domain information
>KOG0128|consensus Back     alignment and domain information
>KOG1996|consensus Back     alignment and domain information
>KOG0804|consensus Back     alignment and domain information
>KOG4676|consensus Back     alignment and domain information
>KOG0115|consensus Back     alignment and domain information
>KOG2202|consensus Back     alignment and domain information
>KOG0112|consensus Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>KOG2591|consensus Back     alignment and domain information
>KOG2068|consensus Back     alignment and domain information
>PF03880 DbpA: DbpA RNA binding domain ; InterPro: IPR005580 This RNA binding domain is found at the C terminus of a number of DEAD helicase proteins [] Back     alignment and domain information
>KOG4660|consensus Back     alignment and domain information
>PF11767 SET_assoc: Histone lysine methyltransferase SET associated; InterPro: IPR024636 The SET domain is a protein-protein interaction domain found in protein lysine methyltransferase enzymes Back     alignment and domain information
>KOG4410|consensus Back     alignment and domain information
>PF04847 Calcipressin: Calcipressin; InterPro: IPR006931 Calcipressin 1 negatively regulates calcineurin (IPR015757 from INTERPRO) by direct binding and is essential for the survival of T helper type 1 cells Back     alignment and domain information
>KOG4210|consensus Back     alignment and domain information
>KOG2253|consensus Back     alignment and domain information
>KOG4285|consensus Back     alignment and domain information
>KOG2135|consensus Back     alignment and domain information
>KOG4483|consensus Back     alignment and domain information
>PF15023 DUF4523: Protein of unknown function (DUF4523) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query137
2dng_A103 Solution Structure Of Rna Binding Domain In Eukaryo 4e-25
1wi8_A104 Solution Structure Of The Rna Binding Domain Of Euk 1e-08
2j76_E100 Solution Structure And Rna Interactions Of The Rna 3e-08
1x5s_A102 Solution Structure Of Rrm Domain In A18 Hnrnp Lengt 5e-08
2dh7_A105 Solution Structure Of The Second Rna Binding Domain 3e-05
2dgo_A115 Solution Structure Of The Rna Binding Domain In Cyt 7e-05
1p1t_A104 Nmr Structure Of The N-Terminal Rrm Domain Of Cleav 9e-05
2e5h_A94 Solution Structure Of Rna Binding Domain In Zinc Fi 9e-05
2fc8_A102 Solution Structure Of The Rrm_1 Domain Of Ncl Prote 1e-04
4f02_A213 Crystal Structure Of The Pabp-Binding Site Of Eif4g 3e-04
1cvj_A190 X-Ray Crystal Structure Of The Poly(A)-Binding Prot 6e-04
2jrs_A108 Solution Nmr Structure Of Caper Rrm2 Domain. Northe 7e-04
>pdb|2DNG|A Chain A, Solution Structure Of Rna Binding Domain In Eukaryotic Translation Initiation Factor 4h Length = 103 Back     alignment and structure

Iteration: 1

Score = 109 bits (273), Expect = 4e-25, Method: Compositional matrix adjust. Identities = 52/97 (53%), Positives = 72/97 (74%), Gaps = 1/97 (1%) Query: 14 GRNQKTLPTEPPYTAFVGNLPNGITQGDVERFFPEQKLVSVRLVKDKETDRFKGFCYVEF 73 G + K LPTEPPYTA+VGNLP QGD++ F + + SVRLV+DK+TD+FKGFCYVEF Sbjct: 4 GSSGKELPTEPPYTAYVGNLPFNTVQGDIDAIFKDLSIRSVRLVRDKDTDKFKGFCYVEF 63 Query: 74 VDVENLRQALLKDGRITVDGLQVRLDIADGKRNDNKG 110 +V++L++AL DG + D +R+DIA+G++ D G Sbjct: 64 DEVDSLKEALTYDGALLGD-RSLRVDIAEGRKQDKSG 99
>pdb|1WI8|A Chain A, Solution Structure Of The Rna Binding Domain Of Eukaryotic Initiation Factor 4b Length = 104 Back     alignment and structure
>pdb|2J76|E Chain E, Solution Structure And Rna Interactions Of The Rna Recognition Motif From Eukaryotic Translation Initiation Factor 4b Length = 100 Back     alignment and structure
>pdb|1X5S|A Chain A, Solution Structure Of Rrm Domain In A18 Hnrnp Length = 102 Back     alignment and structure
>pdb|2DH7|A Chain A, Solution Structure Of The Second Rna Binding Domain In Nucleolysin Tiar Length = 105 Back     alignment and structure
>pdb|2DGO|A Chain A, Solution Structure Of The Rna Binding Domain In Cytotoxic Granule-Associated Rna Binding Protein 1 Length = 115 Back     alignment and structure
>pdb|1P1T|A Chain A, Nmr Structure Of The N-Terminal Rrm Domain Of Cleavage Stimulation Factor 64 Kda Subunit Length = 104 Back     alignment and structure
>pdb|2E5H|A Chain A, Solution Structure Of Rna Binding Domain In Zinc Finger Cchc-Type And Rna Binding Motif 1 Length = 94 Back     alignment and structure
>pdb|2FC8|A Chain A, Solution Structure Of The Rrm_1 Domain Of Ncl Protein Length = 102 Back     alignment and structure
>pdb|4F02|A Chain A, Crystal Structure Of The Pabp-Binding Site Of Eif4g In Complex With Rrm1-2 Of Pabp And Poly(A) Length = 213 Back     alignment and structure
>pdb|1CVJ|A Chain A, X-Ray Crystal Structure Of The Poly(A)-Binding Protein In Complex With Polyadenylate Rna Length = 190 Back     alignment and structure
>pdb|2JRS|A Chain A, Solution Nmr Structure Of Caper Rrm2 Domain. Northeast Structural Genomics Target Hr4730a Length = 108 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query137
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 3e-34
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 5e-32
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 6e-31
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 4e-22
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 7e-20
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 1e-17
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 5e-17
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 9e-16
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 1e-15
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 1e-15
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 2e-15
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 2e-15
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 3e-15
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 5e-15
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} Len 7e-15
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 1e-14
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 3e-10
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 1e-14
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 2e-14
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 2e-14
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 3e-14
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 3e-14
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 4e-14
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 5e-14
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 7e-14
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 7e-14
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 3e-08
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 7e-14
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 8e-14
2cph_A107 RNA binding motif protein 19; RNA recognition moti 9e-14
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 9e-14
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 5e-09
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 3e-13
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 4e-13
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 5e-13
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 5e-13
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 8e-12
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 6e-13
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 7e-13
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 8e-13
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 2e-12
3n9u_C156 Cleavage and polyadenylation specificity factor S; 2e-12
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 3e-12
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 3e-10
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 3e-12
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 4e-12
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 8e-12
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 8e-12
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 8e-12
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 9e-12
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 1e-11
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 1e-11
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 2e-11
2la6_A99 RNA-binding protein FUS; structural genomics, nort 2e-11
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 3e-11
3p5t_L90 Cleavage and polyadenylation specificity factor S; 3e-11
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 4e-11
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 5e-11
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 6e-11
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 5e-11
3q2s_C229 Cleavage and polyadenylation specificity factor S; 6e-11
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 6e-11
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 7e-11
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 7e-11
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 8e-11
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 1e-10
2div_A99 TRNA selenocysteine associated protein; structural 2e-10
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 2e-10
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 2e-10
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 1e-08
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 2e-10
2dis_A109 Unnamed protein product; structural genomics, RRM 2e-10
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 2e-10
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 3e-10
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 3e-10
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 4e-10
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 7e-10
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 8e-10
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 1e-09
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 1e-09
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 2e-09
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 2e-09
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 2e-09
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 3e-06
3smz_A 284 Protein raver-1, ribonucleoprotein PTB-binding 1; 4e-06
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 2e-09
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 2e-09
2ghp_A 292 U4/U6 snRNA-associated splicing factor PRP24; RNA 3e-07
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 9e-07
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 3e-09
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 3e-09
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 3e-09
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 3e-09
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 4e-08
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 3e-09
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 3e-06
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 3e-09
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 5e-09
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 2e-04
1x4e_A85 RNA binding motif, single-stranded interacting pro 8e-09
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 1e-08
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 1e-08
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 1e-08
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 2e-08
2kt5_A124 RNA and export factor-binding protein 2; chaperone 2e-08
2cqd_A116 RNA-binding region containing protein 1; RNA recog 2e-08
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 3e-08
2i2y_A150 Fusion protein consists of immunoglobin G- binding 3e-08
2cpj_A99 Non-POU domain-containing octamer-binding protein; 5e-08
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 6e-08
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 6e-08
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 3e-04
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 6e-08
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 6e-08
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 9e-08
2f3j_A177 RNA and export factor binding protein 2; RRM domai 1e-07
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 1e-07
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 1e-07
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 1e-07
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 2e-07
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 2e-07
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 2e-07
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 3e-07
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 3e-07
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 4e-07
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 5e-07
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 5e-07
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 7e-07
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 8e-07
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 9e-07
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 1e-06
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 1e-06
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 1e-06
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 1e-06
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 1e-06
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 2e-06
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 3e-06
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 3e-06
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 3e-06
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 3e-06
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 3e-06
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 4e-06
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 5e-06
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 5e-06
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 5e-06
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 5e-06
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 5e-06
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 6e-06
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 6e-06
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 9e-06
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 1e-05
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 1e-05
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 1e-05
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 1e-05
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 2e-05
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 5e-05
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 6e-05
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 1e-04
3sde_A 261 Paraspeckle component 1; RRM, anti parallel right 2e-04
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 1e-04
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 1e-04
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 2e-04
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 2e-04
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 2e-04
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 2e-04
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 3e-04
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 3e-04
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 4e-04
1x5o_A114 RNA binding motif, single-stranded interacting pro 5e-04
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 5e-04
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 5e-04
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 5e-04
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 103 Back     alignment and structure
 Score =  114 bits (287), Expect = 3e-34
 Identities = 51/98 (52%), Positives = 71/98 (72%), Gaps = 1/98 (1%)

Query: 14  GRNQKTLPTEPPYTAFVGNLPNGITQGDVERFFPEQKLVSVRLVKDKETDRFKGFCYVEF 73
           G + K LPTEPPYTA+VGNLP    QGD++  F +  + SVRLV+DK+TD+FKGFCYVEF
Sbjct: 4   GSSGKELPTEPPYTAYVGNLPFNTVQGDIDAIFKDLSIRSVRLVRDKDTDKFKGFCYVEF 63

Query: 74  VDVENLRQALLKDGRITVDGLQVRLDIADGKRNDNKGG 111
            +V++L++AL  DG   +    +R+DIA+G++ D  G 
Sbjct: 64  DEVDSLKEALTYDGA-LLGDRSLRVDIAEGRKQDKSGP 100


>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 124 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Length = 115 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Length = 89 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Length = 139 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Length = 124 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Length = 158 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Length = 126 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 107 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Length = 135 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Length = 156 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Length = 126 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Length = 136 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Length = 106 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Length = 90 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} Length = 83 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Length = 87 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 93 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Length = 90 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 118 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 113 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Length = 107 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Length = 106 Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Length = 87 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 85 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Length = 139 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Length = 150 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Length = 193 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Length = 110 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Length = 75 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Length = 111 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Length = 75 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Length = 103 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Length = 88 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Length = 77 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Length = 118 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 119 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 108 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Length = 97 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Length = 115 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Length = 96 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Length = 102 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Length = 87 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Length = 109 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Length = 100 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 88 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Length = 100 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Length = 89 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Length = 115 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Length = 143 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Length = 92 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query137
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 99.86
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.85
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.84
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.84
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.84
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.84
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.83
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.83
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.83
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.83
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.83
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.83
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.83
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.83
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.82
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.82
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.82
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.82
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.82
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.82
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.82
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.82
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.82
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.81
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 99.81
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.81
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.81
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.81
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.81
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.81
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.81
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.8
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.8
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.8
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.8
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 99.8
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.8
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.8
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.8
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.8
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.8
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 99.8
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.8
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.8
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.8
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.8
2div_A99 TRNA selenocysteine associated protein; structural 99.8
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.8
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.79
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.79
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.79
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.79
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.79
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.79
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.79
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 99.79
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.79
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.79
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.79
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.78
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.78
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 99.78
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.78
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.78
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 99.78
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.78
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.77
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.77
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.77
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.77
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.77
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.77
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.76
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.76
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.76
2dis_A109 Unnamed protein product; structural genomics, RRM 99.76
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.76
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.76
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.76
3q2s_C229 Cleavage and polyadenylation specificity factor S; 99.76
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.76
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.76
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.75
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.75
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.75
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 99.75
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.75
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.75
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.75
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.75
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.75
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.75
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 99.6
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 99.74
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.74
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.74
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.74
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 99.74
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.74
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.74
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.74
3n9u_C156 Cleavage and polyadenylation specificity factor S; 99.74
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.74
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 99.74
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 99.74
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 99.73
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 99.73
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 99.73
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 99.72
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.72
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 99.72
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.72
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 99.72
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 99.71
2cpj_A99 Non-POU domain-containing octamer-binding protein; 99.71
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.71
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.71
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 99.71
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.71
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.71
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.71
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 99.7
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 99.7
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.7
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 99.7
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 99.7
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 99.7
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.7
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.69
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.69
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.69
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 99.69
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 99.69
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 99.69
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 99.69
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 99.68
2f3j_A177 RNA and export factor binding protein 2; RRM domai 99.68
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.68
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.68
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 99.68
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 99.68
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 99.68
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.67
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.67
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.67
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.67
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.67
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 99.66
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 99.66
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.66
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.66
2krb_A81 Eukaryotic translation initiation factor 3 subunit 99.66
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.65
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.65
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 99.65
1x5p_A97 Negative elongation factor E; structure genomics, 99.65
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 99.64
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 99.62
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.62
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 99.61
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.61
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.6
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.6
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 99.6
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 99.59
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 99.59
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.59
2dnl_A114 Cytoplasmic polyadenylation element binding protei 99.59
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 99.58
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 99.58
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.56
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 99.56
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.56
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 99.56
3pgw_A 282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.56
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 99.56
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.55
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 99.55
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 99.54
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.54
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.54
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.53
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.53
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.51
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.51
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 99.5
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.48
2dit_A112 HIV TAT specific factor 1 variant; structural geno 99.47
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 99.47
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.44
3sde_A 261 Paraspeckle component 1; RRM, anti parallel right 99.44
2ghp_A 292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.41
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.41
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.4
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.39
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.38
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.38
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.35
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 99.34
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 99.34
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 99.29
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 99.22
3tht_A 345 Alkylated DNA repair protein ALKB homolog 8; struc 99.2
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 99.09
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 99.06
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 98.98
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 98.66
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 98.59
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 98.29
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 97.8
1uw4_A91 UPF3X; nonsense mediated mRNA decay protein, RNA-b 97.74
2l08_A97 Regulator of nonsense transcripts 3A; NESG, nonsen 97.64
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 97.63
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 97.37
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 97.0
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 96.64
3pq1_A 464 Poly(A) RNA polymerase; nucleotidyl transferase, R 95.53
3p3d_A132 Nucleoporin 53; structural genomics, PSI-2, protei 94.63
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 94.14
2i2y_A150 Fusion protein consists of immunoglobin G- binding 92.53
3d45_A507 Poly(A)-specific ribonuclease PARN; CAP analogue, 90.67
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
Probab=99.86  E-value=4.1e-21  Score=128.04  Aligned_cols=89  Identities=24%  Similarity=0.400  Sum_probs=81.2

Q ss_pred             CCCCceEEEcCCCCCCCHHHHHhcCcCC-ceeEEEEeecCCCCCeecEEEEEEcCHHHHHHHHH-hCCCeeecCeEEEEE
Q psy13181         22 TEPPYTAFVGNLPNGITQGDVERFFPEQ-KLVSVRLVKDKETDRFKGFCYVEFVDVENLRQALL-KDGRITVDGLQVRLD   99 (137)
Q Consensus        22 ~~~~~~l~v~nlp~~~~e~~l~~~f~~~-~i~~i~~~~~~~t~~~~g~~fv~f~~~~~a~~al~-l~~~~~l~g~~l~v~   99 (137)
                      ....++|||+|||..+++++|+++|++| .|..|.++.++.++.+++||||+|.+.++|++||. |++ ..|.++.|.|.
T Consensus        36 ~~~~~~l~V~nlp~~~t~~~l~~~F~~~G~i~~v~i~~~~~~~~~~g~afV~f~~~~~A~~Ai~~l~g-~~~~g~~l~V~  114 (156)
T 1h2v_Z           36 LKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDKMKKTACGFCFVEYYSRADAENAMRYING-TRLDDRIIRTD  114 (156)
T ss_dssp             TTTCCEEEEESCCTTCCHHHHHHHHGGGSCEEEEEEEECTTTCCEEEEEEEEESSHHHHHHHHHHTTT-SEETTEECEEE
T ss_pred             CCCCCEEEEeCCCCCCCHHHHHHHHHhcCCeEEEEEEecCCCCccceEEEEEECCHHHHHHHHHHhCC-CEECCeEEEEE
Confidence            3467899999999999999999999999 99999999999999999999999999999999999 999 99999999999


Q ss_pred             ecCCCCCCCCCC
Q psy13181        100 IADGKRNDNKGG  111 (137)
Q Consensus       100 ~a~~~~~~~~~~  111 (137)
                      ++.+....++.+
T Consensus       115 ~a~~~~~~~~~~  126 (156)
T 1h2v_Z          115 WDAGFKEGRQYG  126 (156)
T ss_dssp             EESCCCTTCC--
T ss_pred             ECCCCCCcCCCC
Confidence            999877655433



>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 Back     alignment and structure
>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure
>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>3d45_A Poly(A)-specific ribonuclease PARN; CAP analogue, exonuclease, hydrolase, magnesium, metal nonsense-mediated mRNA decay, nucleus; HET: 7MG GDP; 3.00A {Mus musculus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 137
d1wi8a_104 d.58.7.1 (A:) Eukaryotic translation initiation fa 8e-14
d2cq4a1101 d.58.7.1 (A:132-232) RNA binding protein 23 {Human 1e-12
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 8e-11
d2cqpa186 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous 1e-10
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 2e-10
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 1e-09
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 1e-09
d1x5ta183 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu 2e-09
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 8e-09
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 8e-09
d1l3ka184 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN 1e-08
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 2e-08
d1x5sa190 d.58.7.1 (A:8-97) Cold-inducible RNA-binding prote 2e-08
d2cpxa1102 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 3e-08
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 6e-08
d1x0fa175 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 6e-08
d2cqha180 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 is 6e-08
d1hd0a_75 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 8e-08
d2disa196 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { 8e-08
d1fjeb191 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesoc 8e-08
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 9e-08
d1x4ba1103 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle 1e-07
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 1e-07
d2cq3a193 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human 1e-07
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 1e-07
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 1e-07
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 1e-07
d1x4aa195 d.58.7.1 (A:9-103) Splicing factor, arginine/serin 1e-07
d2cq0a190 d.58.7.1 (A:231-320) Eukaryotic translation initia 2e-07
d1wf0a_88 d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 { 2e-07
d2cpda186 d.58.7.1 (A:223-308) APOBEC1 stimulating protein { 2e-07
d1x4ha198 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse ( 3e-07
d2msta_75 d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 3e-07
d1nu4a_91 d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo 5e-07
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 7e-07
d1weza_102 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 1e-06
d1l3ka279 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 1e-06
d2ghpa386 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splici 1e-06
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 1e-06
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 2e-06
d2cpya1103 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human 2e-06
d1p1ta_104 d.58.7.1 (A:) Cleavage stimulation factor, 64 kda 3e-06
d2cqda1103 d.58.7.1 (A:1-103) RNA-binding region containing p 4e-06
d2cqia190 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa 4e-06
d1u2fa_90 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 7e-06
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 1e-05
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 1e-05
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 1e-05
d1rk8a_88 d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr 1e-05
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 1e-05
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 2e-05
d2cpea1101 d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma 2e-05
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 2e-05
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 3e-05
d2cpza1102 d.58.7.1 (A:383-484) CUG triplet repeat RNA-bindin 5e-05
d2ghpa181 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splici 8e-05
d1zh5a285 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo 1e-04
d1wwha181 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus mu 1e-04
d2ghpa275 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicin 1e-04
d2dita199 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Huma 2e-04
d1u6fa1139 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypa 2e-04
d1wg4a_98 d.58.7.1 (A:) Splicing factor, arginine/serine-ric 2e-04
d1wexa_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 4e-04
d1weya_104 d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) 5e-04
d2adca288 d.58.7.1 (A:444-531) Polypyrimidine tract-binding 6e-04
d1whya_97 d.58.7.1 (A:) Putative RNA-binding protein 15B, Rb 0.001
d1x4ea172 d.58.7.1 (A:8-79) RNA-binding motif, single-strand 0.002
d2adba1108 d.58.7.1 (A:177-284) Polypyrimidine tract-binding 0.002
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Eukaryotic translation initiation factor 4B
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 60.9 bits (147), Expect = 8e-14
 Identities = 32/99 (32%), Positives = 53/99 (53%), Gaps = 2/99 (2%)

Query: 14  GRNQKTLPTEPPYTAFVGNLPNGITQGDVERFFPE-QKLVSVRLVKDKETDRFKGFCYVE 72
           G +   LP  PPYTAF+GNLP  +T+  ++ FF            +    +R KGF Y E
Sbjct: 4   GSSGSRLPKSPPYTAFLGNLPYDVTEESIKEFFRGLNISAVRLPREPSNPERLKGFGYAE 63

Query: 73  FVDVENLRQALLKDGRITVDGLQVRLDIADGKRNDNKGG 111
           F D+++L  AL  +   ++   ++R+D+AD  ++ + G 
Sbjct: 64  FEDLDSLLSALSLNEE-SLGNKRIRVDVADQAQDKDSGP 101


>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 91 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 75 Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Length = 139 Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query137
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.86
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.86
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.86
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.85
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.85
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.85
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.85
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.85
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.85
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.84
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.84
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.83
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.83
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.83
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.83
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.82
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.82
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.82
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.82
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.81
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.81
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.81
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.81
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.81
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.81
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.81
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.81
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.81
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.8
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.8
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.8
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.8
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.8
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.8
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.79
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.79
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.79
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.78
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.78
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.78
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.77
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.77
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.77
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.77
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.76
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.76
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.75
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.75
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.75
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.74
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 99.73
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.72
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.72
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.72
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.72
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.72
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 99.72
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.72
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.72
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 99.71
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.71
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.71
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.7
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.69
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.69
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.69
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.69
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.69
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 99.68
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.68
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.68
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.67
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.67
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 99.67
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.65
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.63
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.61
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.61
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.57
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 99.5
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.49
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 99.35
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.32
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 99.32
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 99.3
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 99.24
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.13
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 97.71
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 96.81
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 96.48
d1whva_100 Poly(A)-specific ribonuclease PARN {Mouse (Mus mus 96.19
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Probable RNA-binding protein 19, Rbm19
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.86  E-value=3.2e-21  Score=118.24  Aligned_cols=84  Identities=25%  Similarity=0.319  Sum_probs=78.7

Q ss_pred             CCCceEEEcCCCCCCCHHHHHhcCcCC-ceeEEEEeecCCCCCeecEEEEEEcCHHHHHHHHH-hCCCeeecCeEEEEEe
Q psy13181         23 EPPYTAFVGNLPNGITQGDVERFFPEQ-KLVSVRLVKDKETDRFKGFCYVEFVDVENLRQALL-KDGRITVDGLQVRLDI  100 (137)
Q Consensus        23 ~~~~~l~v~nlp~~~~e~~l~~~f~~~-~i~~i~~~~~~~t~~~~g~~fv~f~~~~~a~~al~-l~~~~~l~g~~l~v~~  100 (137)
                      ....+|||+|||+.+++++|+++|.+| .|..|.++.++.++.+++||||+|.+.++|+.||. |++ ..|+|+.|+|.+
T Consensus         6 ~~~~~lfV~nL~~~~t~~~l~~~F~~~g~v~~v~i~~d~~tg~~~g~afV~f~~~~~a~~A~~~l~g-~~~~gr~i~V~~   84 (99)
T d1whwa_           6 SGSGRLFVRNLSYTSSEEDLEKLFSAYGPLSELHYPIDSLTKKPKGFAFVTFMFPEHAVKAYAEVDG-QVFQGRMLHVLP   84 (99)
T ss_dssp             CSCEEEEEECCCTTCCHHHHHHHHHTTSCEEEEECCCCTTTCCCCSEEEEEESSHHHHHHHHHHTTT-EESSSCEEEEEE
T ss_pred             CCCCEEEEECCCCcCCHHHHHHHHHhcCCceeeeecccccccccCcceEEEECCHHHHHHHHHHcCC-CEECCEEEEEEE
Confidence            456789999999999999999999999 99999999999999999999999999999999999 999 999999999999


Q ss_pred             cCCCCCC
Q psy13181        101 ADGKRND  107 (137)
Q Consensus       101 a~~~~~~  107 (137)
                      +.++...
T Consensus        85 a~~~~~~   91 (99)
T d1whwa_          85 STIKKEA   91 (99)
T ss_dssp             CCCCSTT
T ss_pred             CCCCCcc
Confidence            9977643



>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure