Psyllid ID: psy13182

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190----
MESEAQKVSKKALKKQAKEQEKKEKKDQRKSAQQNVEESEPVEDVSARLYGKTPLIMSEKDVDRDFVPIRQLNKDYVDKTVWVRGRLHTSRAKGKQCFVVIREQNFTIQGILSVGDTVSKQMIKYVSQIPKESILDIQAHVQATPTIVESLPMSILSVGDTVSKQMIKYVSQIPKESILDIQAHVQATPTIVES
cccHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHccccccccccccccccEEEcccccccccccEEEEEEEEEEEEccccEEEEEEEEccEEEEEEEEcccccHHHHHHHHcccccccEEEEEEEEEEccccccccccEEEEEEEEEEEEEEEEEccccccccccccHHcccccccccc
cccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHcccccEEEcccccccEEEEEccccHHHcccEEEEEEEEEcccHcccEEEEEEEccccEEEEEEEccccccHHHHHHHHccccccEEEEEEEEEcccccEEEEEEEEEEEEEEEEEEEEEEEcccccccccEEccccccccccccc
MESEAQKVSKKALKKQAKEQEKKEKKDQRKSAQQnveesepvedvsarlygktplimsekdvdrdfvpirqlnkdyvdktvwvrgrlhtsrakgkQCFVVIREQNFTIQGILSVGDTVSKQMIKYVSQIPKESILDIQAHVqatptiveslpmsilsVGDTVSKQMIKYVSQIPKESILDIQAHvqatptives
meseaqkvskkalkkqakeqekkekkdqrksaqqnveesepvedvsarlygktplimsekdvdrdfvpirqlnkdyvdktvwvrgrlhtsrakgkqcfVVIREQNFTIQGILSVGDTVSKQMIKYVSQIPKESILDIQAHVQATPTIVESLPMSILSVGDTVSKQMIKYVSQIPKESILDIQAHvqatptives
MESeaqkvskkalkkqakeqekkekkdqrksaqQNVEESEPVEDVSARLYGKTPLIMSEKDVDRDFVPIRQLNKDYVDKTVWVRGRLHTSRAKGKQCFVVIREQNFTIQGILSVGDTVSKQMIKYVSQIPKESILDIQAHVQATPTIVESLPMSILSVGDTVSKQMIKYVSQIPKESILDIQAHVQATPTIVES
************************************************LYGKTPLIMSEKDVDRDFVPIRQLNKDYVDKTVWVRGRLHTSRAKGKQCFVVIREQNFTIQGILSVGDTVSKQMIKYVSQIPKESILDIQAHVQATPTIVESLPMSILSVGDTVSKQMIKYVSQIPKESILDIQAHV*********
******K******************************************YGKTPLIMSEKDVDRDFVPIRQLNKDYVDKTVWVRGRLHTSRAKGKQCFVVIREQNFTIQGILSVGDTVSKQMIKYVSQIPKESILDIQAHVQATP**********LSVGDTVSKQMIKYVSQIPKESILDIQAHVQATPT****
*********************************************SARLYGKTPLIMSEKDVDRDFVPIRQLNKDYVDKTVWVRGRLHTSRAKGKQCFVVIREQNFTIQGILSVGDTVSKQMIKYVSQIPKESILDIQAHVQATPTIVESLPMSILSVGDTVSKQMIKYVSQIPKESILDIQAHVQATPTIVES
****************************************PVEDVSARLYGKTPLIMSEKDVDRDFVPIRQLNKDYVDKTVWVRGRLHTSRAKGKQCFVVIREQNFTIQGILSVGDTVSKQMIKYVSQIPKESILDIQAHVQATPTIVESLPMSILSVGDTVSKQMIKYVSQIPKESILDIQA***********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVEESEPVEDVSARLYGKTPLIMSEKDVDRDFVPIRQLNKDYVDKTVWVRGRLHTSRAKGKQCFVVIREQNFTIQGILSVGDTVSKQMIKYVSQIPKESILDIQAHVQATPTIVESLPMSILSVGDTVSKQMIKYVSQIPKESILDIQAHVQATPTIVES
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query194 2.2.26 [Sep-21-2011]
Q03577 531 Aspartate--tRNA ligase, c yes N/A 0.762 0.278 0.389 3e-24
Q5R9I5 501 Aspartate--tRNA ligase, c yes N/A 0.628 0.243 0.442 1e-23
P14868 501 Aspartate--tRNA ligase, c yes N/A 0.587 0.227 0.456 2e-23
P15178 501 Aspartate--tRNA ligase, c yes N/A 0.587 0.227 0.438 2e-22
Q922B2 501 Aspartate--tRNA ligase, c yes N/A 0.587 0.227 0.438 2e-22
Q3SYZ4 501 Aspartate--tRNA ligase, c yes N/A 0.587 0.227 0.438 1e-21
Q75JQ1 576 Aspartate--tRNA ligase, c yes N/A 0.603 0.203 0.378 7e-17
P04802 557 Aspartate--tRNA ligase, c yes N/A 0.716 0.249 0.354 2e-12
O74407 580 Aspartate--tRNA ligase, c yes N/A 0.551 0.184 0.376 5e-11
O73630 958 Nuclear factor NF-kappa-B N/A N/A 0.505 0.102 0.252 0.0005
>sp|Q03577|SYDC_CAEEL Aspartate--tRNA ligase, cytoplasmic OS=Caenorhabditis elegans GN=drs-1 PE=3 SV=1 Back     alignment and function desciption
 Score =  111 bits (277), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 58/149 (38%), Positives = 92/149 (61%), Gaps = 1/149 (0%)

Query: 2   ESEAQKVSKKALKKQAKEQEKKEKKDQRKSAQQNVEESEPVEDVSARLYGKTPLIMSEKD 61
           E E  K+SKK L K A++ +K EK  ++   QQ     +  ED S   YG   L+ S++ 
Sbjct: 6   EGEQPKLSKKELNKLARKAKKDEKAGEKGGNQQQAAAMDQ-EDASKDFYGSYGLVNSKEK 64

Query: 62  VDRDFVPIRQLNKDYVDKTVWVRGRLHTSRAKGKQCFVVIREQNFTIQGILSVGDTVSKQ 121
              +F+ ++++N     K VWVRGR+HT+R+KGK CF+V+R+  +T+Q  + + + +SKQ
Sbjct: 65  KVLNFLKVKEINVSNATKDVWVRGRIHTTRSKGKNCFLVLRQGVYTVQVAMFMNEKISKQ 124

Query: 122 MIKYVSQIPKESILDIQAHVQATPTIVES 150
           M+K+VS I KESI+D+ A +      +ES
Sbjct: 125 MLKFVSSISKESIVDVYATINKVDNPIES 153

Caenorhabditis elegans (taxid: 6239)
EC: 6EC: .EC: 1EC: .EC: 1EC: .EC: 1EC: 2
>sp|Q5R9I5|SYDC_PONAB Aspartate--tRNA ligase, cytoplasmic OS=Pongo abelii GN=DARS PE=2 SV=1 Back     alignment and function description
>sp|P14868|SYDC_HUMAN Aspartate--tRNA ligase, cytoplasmic OS=Homo sapiens GN=DARS PE=1 SV=2 Back     alignment and function description
>sp|P15178|SYDC_RAT Aspartate--tRNA ligase, cytoplasmic OS=Rattus norvegicus GN=Dars PE=2 SV=1 Back     alignment and function description
>sp|Q922B2|SYDC_MOUSE Aspartate--tRNA ligase, cytoplasmic OS=Mus musculus GN=Dars PE=2 SV=2 Back     alignment and function description
>sp|Q3SYZ4|SYDC_BOVIN Aspartate--tRNA ligase, cytoplasmic OS=Bos taurus GN=DARS PE=2 SV=1 Back     alignment and function description
>sp|Q75JQ1|SYDC1_DICDI Aspartate--tRNA ligase, cytoplasmic 1 OS=Dictyostelium discoideum GN=aspS1 PE=3 SV=1 Back     alignment and function description
>sp|P04802|SYDC_YEAST Aspartate--tRNA ligase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DPS1 PE=1 SV=3 Back     alignment and function description
>sp|O74407|SYDC_SCHPO Aspartate--tRNA ligase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dps1 PE=1 SV=1 Back     alignment and function description
>sp|O73630|NFKB2_XENLA Nuclear factor NF-kappa-B p100 subunit OS=Xenopus laevis GN=nfkb2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query194
66523683 533 PREDICTED: aspartyl-tRNA synthetase, cyt 0.737 0.268 0.533 5e-33
380022038 519 PREDICTED: LOW QUALITY PROTEIN: aspartat 0.690 0.258 0.524 2e-30
346471267 533 hypothetical protein [Amblyomma maculatu 0.773 0.281 0.450 1e-29
350424963 532 PREDICTED: aspartyl-tRNA synthetase, cyt 0.773 0.281 0.496 1e-29
241594922 487 aspartyl-tRNA synthetase, putative [Ixod 0.757 0.301 0.445 2e-29
340724480 534 PREDICTED: aspartyl-tRNA synthetase, cyt 0.757 0.275 0.512 2e-29
332031478 542 Aspartyl-tRNA synthetase, cytoplasmic [A 0.752 0.269 0.5 2e-29
340724478 532 PREDICTED: aspartyl-tRNA synthetase, cyt 0.757 0.276 0.512 2e-29
307192131 527 Aspartyl-tRNA synthetase, cytoplasmic [H 0.592 0.218 0.554 4e-29
383854650 531 PREDICTED: aspartate--tRNA ligase, cytop 0.731 0.267 0.533 7e-29
>gi|66523683|ref|XP_393437.2| PREDICTED: aspartyl-tRNA synthetase, cytoplasmic [Apis mellifera] Back     alignment and taxonomy information
 Score =  146 bits (368), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 80/150 (53%), Positives = 110/150 (73%), Gaps = 7/150 (4%)

Query: 5   AQKVSKKALKKQAKEQEKKEKKDQRKS---AQQNVEESEPVEDVSARLYGKTPLIMS-EK 60
           + ++SKKALKKQ KE EK  KK +RKS   AQ N+ + E   D+S   YG+T LI S EK
Sbjct: 13  SDELSKKALKKQQKEVEKAIKKAERKSQIQAQSNIVQEE---DISIGKYGETGLIQSKEK 69

Query: 61  DVDRDFVPIRQLNKDYVDKTVWVRGRLHTSRAKGKQCFVVIREQNFTIQGILSVGDTVSK 120
             +R F+ I+ LN +  ++ VW+RGRLHTSRAKGKQCF+V+R+Q++TIQG+ +V + VSK
Sbjct: 70  YAERKFIDIKDLNPNLENQNVWLRGRLHTSRAKGKQCFIVLRQQSYTIQGLAAVNNKVSK 129

Query: 121 QMIKYVSQIPKESILDIQAHVQATPTIVES 150
           QMIK++S I KESI+DI+A V+   + +ES
Sbjct: 130 QMIKFISNITKESIVDIEAIVKCVSSQIES 159

Source: Apis mellifera

Species: Apis mellifera

Genus: Apis

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|380022038|ref|XP_003694862.1| PREDICTED: LOW QUALITY PROTEIN: aspartate--tRNA ligase, cytoplasmic-like [Apis florea] Back     alignment and taxonomy information
>gi|346471267|gb|AEO35478.1| hypothetical protein [Amblyomma maculatum] Back     alignment and taxonomy information
>gi|350424963|ref|XP_003493969.1| PREDICTED: aspartyl-tRNA synthetase, cytoplasmic-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|241594922|ref|XP_002404413.1| aspartyl-tRNA synthetase, putative [Ixodes scapularis] gi|215500406|gb|EEC09900.1| aspartyl-tRNA synthetase, putative [Ixodes scapularis] Back     alignment and taxonomy information
>gi|340724480|ref|XP_003400610.1| PREDICTED: aspartyl-tRNA synthetase, cytoplasmic-like isoform 2 [Bombus terrestris] Back     alignment and taxonomy information
>gi|332031478|gb|EGI70962.1| Aspartyl-tRNA synthetase, cytoplasmic [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|340724478|ref|XP_003400609.1| PREDICTED: aspartyl-tRNA synthetase, cytoplasmic-like isoform 1 [Bombus terrestris] Back     alignment and taxonomy information
>gi|307192131|gb|EFN75459.1| Aspartyl-tRNA synthetase, cytoplasmic [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|383854650|ref|XP_003702833.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Megachile rotundata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query194
FB|FBgn0002069 531 Aats-asp "Aspartyl-tRNA synthe 0.716 0.261 0.444 2e-25
UNIPROTKB|Q5ZJQ6 503 DARS "Uncharacterized protein" 0.546 0.210 0.471 1.6e-24
ZFIN|ZDB-GENE-061110-135 531 dars "aspartyl-tRNA synthetase 0.587 0.214 0.460 2.6e-24
UNIPROTKB|P14868 501 DARS "Aspartate--tRNA ligase, 0.546 0.211 0.462 2.1e-23
RGD|621167 501 Dars "aspartyl-tRNA synthetase 0.530 0.205 0.456 2.7e-23
UNIPROTKB|F1S0D9 501 DARS "Uncharacterized protein" 0.530 0.205 0.456 2.9e-23
MGI|MGI:2442544 501 Dars "aspartyl-tRNA synthetase 0.530 0.205 0.456 6e-23
UNIPROTKB|E2RNQ8 501 DARS "Uncharacterized protein" 0.546 0.211 0.452 1e-22
UNIPROTKB|F1MTX7 501 DARS "Aspartate--tRNA ligase, 0.546 0.211 0.452 1.1e-22
UNIPROTKB|Q3SYZ4 501 DARS "Aspartate--tRNA ligase, 0.546 0.211 0.452 1.1e-22
FB|FBgn0002069 Aats-asp "Aspartyl-tRNA synthetase" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 294 (108.6 bits), Expect = 2.0e-25, P = 2.0e-25
 Identities = 64/144 (44%), Positives = 93/144 (64%)

Query:    40 EPVEDVSARLYGKTPLIMS-EKDVDRDFVPIRQLNKDYVDKTVWVRGRLHTSRAKGKQCF 98
             +  ED +A  YG + +I S +K  +R+FVP+ +L+       VWVRGR+HTSRAKGKQCF
Sbjct:    47 DSAEDHAAGRYGLSEMIQSKDKRSERNFVPVSELSGQVGKGLVWVRGRVHTSRAKGKQCF 106

Query:    99 VVIREQNFTIQGILSVGDTVSKQMIKYVSQIPKESILDIQAHVQATPTIVESLPMSILSV 158
             +++R+Q+ T+Q IL+VGD +SKQM+K+   IPKESI+DIQA   A  + +ES     L +
Sbjct:   107 LILRQQSSTVQCILAVGDVISKQMVKFAGNIPKESIIDIQAKPVAVSSKIESCTEQSLEL 166

Query:   159 GDTVSKQMIKYVSQIPKESILDIQ 182
                 S + I  +SQ   +  L I+
Sbjct:   167 ----SVEQIFVISQAKAQLPLQIE 186
GO:0006422 "aspartyl-tRNA aminoacylation" evidence=ISS
GO:0004815 "aspartate-tRNA ligase activity" evidence=ISS
GO:0040007 "growth" evidence=IMP
GO:0005737 "cytoplasm" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0005875 "microtubule associated complex" evidence=IDA
GO:0022008 "neurogenesis" evidence=IMP
UNIPROTKB|Q5ZJQ6 DARS "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-061110-135 dars "aspartyl-tRNA synthetase" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|P14868 DARS "Aspartate--tRNA ligase, cytoplasmic" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|621167 Dars "aspartyl-tRNA synthetase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1S0D9 DARS "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:2442544 Dars "aspartyl-tRNA synthetase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E2RNQ8 DARS "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1MTX7 DARS "Aspartate--tRNA ligase, cytoplasmic" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q3SYZ4 DARS "Aspartate--tRNA ligase, cytoplasmic" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query194
PLN02850 530 PLN02850, PLN02850, aspartate-tRNA ligase 2e-37
cd04320102 cd04320, AspRS_cyto_N, AspRS_cyto_N: N-terminal, a 4e-25
PTZ00401 550 PTZ00401, PTZ00401, aspartyl-tRNA synthetase; Prov 3e-21
cd0410085 cd04100, Asp_Lys_Asn_RS_N, Asp_Lys_Asn_RS_N: N-ter 1e-07
TIGR00458 428 TIGR00458, aspS_nondisc, nondiscriminating asparty 3e-07
cd04316108 cd04316, ND_PkAspRS_like_N, ND_PkAspRS_like_N: N-t 1e-05
COG0017 435 COG0017, AsnS, Aspartyl/asparaginyl-tRNA synthetas 8e-05
PRK03932 450 PRK03932, asnC, asparaginyl-tRNA synthetase; Valid 4e-04
PRK05159 437 PRK05159, aspC, aspartyl-tRNA synthetase; Provisio 7e-04
>gnl|CDD|215456 PLN02850, PLN02850, aspartate-tRNA ligase Back     alignment and domain information 
 Score =  134 bits (340), Expect = 2e-37
 Identities = 53/151 (35%), Positives = 86/151 (56%), Gaps = 5/151 (3%)

Query: 2   ESEAQKVSKKALKKQAKEQEKKEKKDQRKSAQQNVEESEPVEDVSARLYGKTPLIMSEKD 61
           E   +K+SKKA KK A + EK  ++   K+A  ++E+ +   D  A  YG  PL   +  
Sbjct: 7   EESGEKISKKAAKKAAAKAEKLRREATAKAAAASLEDED---DPLASNYGDVPLEELQSK 63

Query: 62  VD-RDFVPIRQLNKDYVDKTVWVRGRLHTSRAKGKQCFVVIREQNFTIQGILSVGD-TVS 119
           V  R++  +  L ++     V +RGR+HT R KGK  F+V+R+  FT+Q ++ V + TVS
Sbjct: 64  VTGREWTDVSDLGEELAGSEVLIRGRVHTIRGKGKSAFLVLRQSGFTVQCVVFVSEVTVS 123

Query: 120 KQMIKYVSQIPKESILDIQAHVQATPTIVES 150
           K M+KY  Q+ +ES++D++  V      V+ 
Sbjct: 124 KGMVKYAKQLSRESVVDVEGVVSVPKKPVKG 154

Length = 530
>gnl|CDD|239815 cd04320, AspRS_cyto_N, AspRS_cyto_N: N-terminal, anticodon recognition domain of the type found in Saccharomyces cerevisiae and human cytoplasmic aspartyl-tRNA synthetase (AspRS) Back     alignment and domain information
>gnl|CDD|173592 PTZ00401, PTZ00401, aspartyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|239766 cd04100, Asp_Lys_Asn_RS_N, Asp_Lys_Asn_RS_N: N-terminal, anticodon recognition domain of class 2b aminoacyl-tRNA synthetases (aaRSs) Back     alignment and domain information
>gnl|CDD|129550 TIGR00458, aspS_nondisc, nondiscriminating aspartyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|239811 cd04316, ND_PkAspRS_like_N, ND_PkAspRS_like_N: N-terminal, anticodon recognition domain of the type found in the homodimeric non-discriminating (ND) Pyrococcus kodakaraensis aspartyl-tRNA synthetase (AspRS) Back     alignment and domain information
>gnl|CDD|223096 COG0017, AsnS, Aspartyl/asparaginyl-tRNA synthetases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|235176 PRK03932, asnC, asparaginyl-tRNA synthetase; Validated Back     alignment and domain information
>gnl|CDD|235354 PRK05159, aspC, aspartyl-tRNA synthetase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 194
KOG0556|consensus 533 100.0
PLN02850 530 aspartate-tRNA ligase 99.97
PTZ00401 550 aspartyl-tRNA synthetase; Provisional 99.96
cd04316108 ND_PkAspRS_like_N ND_PkAspRS_like_N: N-terminal, a 99.77
cd04320102 AspRS_cyto_N AspRS_cyto_N: N-terminal, anticodon r 99.74
KOG0555|consensus 545 99.69
PLN02502 553 lysyl-tRNA synthetase 99.63
cd04317135 EcAspRS_like_N EcAspRS_like_N: N-terminal, anticod 99.63
cd04319103 PhAsnRS_like_N PhAsnRS_like_N: N-terminal, anticod 99.63
cd0432384 AsnRS_cyto_like_N AsnRS_cyto_like_N: N-terminal, a 99.62
cd0410085 Asp_Lys_Asn_RS_N Asp_Lys_Asn_RS_N: N-terminal, ant 99.61
cd04322108 LysRS_N LysRS_N: N-terminal, anticodon recognition 99.61
COG0017 435 AsnS Aspartyl/asparaginyl-tRNA synthetases [Transl 99.6
PRK05159 437 aspC aspartyl-tRNA synthetase; Provisional 99.58
TIGR00458 428 aspS_arch aspartyl-tRNA synthetase, archaeal type. 99.56
PRK12820 706 bifunctional aspartyl-tRNA synthetase/aspartyl/glu 99.55
COG0173 585 AspS Aspartyl-tRNA synthetase [Translation, riboso 99.53
PLN02903 652 aminoacyl-tRNA ligase 99.5
PRK03932 450 asnC asparaginyl-tRNA synthetase; Validated 99.45
cd0431882 EcAsnRS_like_N EcAsnRS_like_N: N-terminal, anticod 99.45
KOG0556|consensus 533 99.45
PRK00476 588 aspS aspartyl-tRNA synthetase; Validated 99.45
TIGR00459 583 aspS_bact aspartyl-tRNA synthetase, bacterial type 99.42
cd0432186 ScAspRS_mt_like_N ScAspRS_mt_like_N: N-terminal, a 99.39
TIGR00457 453 asnS asparaginyl-tRNA synthetase. In a multiple se 99.33
PRK00484 491 lysS lysyl-tRNA synthetase; Reviewed 99.3
PLN02221 572 asparaginyl-tRNA synthetase 99.29
PLN02603 565 asparaginyl-tRNA synthetase 99.2
TIGR00499 496 lysS_bact lysyl-tRNA synthetase, eukaryotic and no 99.18
PRK12445 505 lysyl-tRNA synthetase; Reviewed 99.15
PRK02983 1094 lysS lysyl-tRNA synthetase; Provisional 99.14
PTZ00385 659 lysyl-tRNA synthetase; Provisional 99.13
KOG1885|consensus 560 99.04
PTZ00425 586 asparagine-tRNA ligase; Provisional 98.98
PTZ00417 585 lysine-tRNA ligase; Provisional 98.83
PF0133675 tRNA_anti-codon: OB-fold nucleic acid binding doma 98.79
PTZ00401 550 aspartyl-tRNA synthetase; Provisional 98.65
PLN02850 530 aspartate-tRNA ligase 98.65
COG1190 502 LysU Lysyl-tRNA synthetase (class II) [Translation 98.24
KOG2411|consensus 628 98.14
PLN02532 633 asparagine-tRNA synthetase 97.83
KOG0554|consensus 446 97.29
cd0448978 ExoVII_LU_OBF ExoVII_LU_OBF: A subfamily of OB fol 96.3
PF1374299 tRNA_anti_2: OB-fold nucleic acid binding domain 96.2
TIGR00617 608 rpa1 replication factor-a protein 1 (rpa1). This f 96.06
cd04474104 RPA1_DBD_A RPA1_DBD_A: A subfamily of OB folds cor 96.0
cd0448773 RecJ_OBF2_like RecJ_OBF2_like: A subfamily of OB f 95.86
cd04316108 ND_PkAspRS_like_N ND_PkAspRS_like_N: N-terminal, a 95.51
cd0448291 RPA2_OBF_like RPA2_OBF_like: A subgroup of unchara 95.21
COG1107 715 Archaea-specific RecJ-like exonuclease, contains D 94.97
cd0448392 hOBFC1_like hOBFC1_like: A subfamily of OB folds s 94.78
cd0352475 RPA2_OBF_family RPA2_OBF_family: A family of oligo 94.65
cd04320102 AspRS_cyto_N AspRS_cyto_N: N-terminal, anticodon r 94.15
cd04322108 LysRS_N LysRS_N: N-terminal, anticodon recognition 94.15
cd0447895 RPA2_DBD_D RPA2_DBD_D: A subfamily of OB folds cor 93.26
PRK12366 637 replication factor A; Reviewed 92.97
TIGR00458 428 aspS_arch aspartyl-tRNA synthetase, archaeal type. 92.62
cd0448584 DnaE_OBF DnaE_OBF: A subfamily of OB folds corresp 92.09
cd0449283 YhaM_OBF_like YhaM_OBF_like: A subfamily of OB fol 91.28
PRK07211 485 replication factor A; Reviewed 91.11
PRK07373449 DNA polymerase III subunit alpha; Reviewed 91.04
cd0432384 AsnRS_cyto_like_N AsnRS_cyto_like_N: N-terminal, a 90.78
PRK05159 437 aspC aspartyl-tRNA synthetase; Provisional 90.33
PRK12366 637 replication factor A; Reviewed 90.12
cd0449079 PolII_SU_OBF PolII_SU_OBF: A subfamily of OB folds 90.01
cd0410085 Asp_Lys_Asn_RS_N Asp_Lys_Asn_RS_N: N-terminal, ant 89.45
cd0431882 EcAsnRS_like_N EcAsnRS_like_N: N-terminal, anticod 89.15
PRK14699484 replication factor A; Provisional 88.95
PRK12820 706 bifunctional aspartyl-tRNA synthetase/aspartyl/glu 88.33
PF08661109 Rep_fac-A_3: Replication factor A protein 3; Inter 88.2
PRK056721046 dnaE2 error-prone DNA polymerase; Validated 87.99
PRK07211 485 replication factor A; Reviewed 87.56
COG1570 440 XseA Exonuclease VII, large subunit [DNA replicati 87.21
cd04319103 PhAsnRS_like_N PhAsnRS_like_N: N-terminal, anticod 86.09
PRK15491 374 replication factor A; Provisional 86.09
PRK073741170 dnaE DNA polymerase III subunit alpha; Validated 85.93
TIGR00156126 conserved hypothetical protein TIGR00156. As of th 85.76
PF04076103 BOF: Bacterial OB fold (BOF) protein; InterPro: IP 85.72
PRK056731135 dnaE DNA polymerase III subunit alpha; Validated 85.14
PRK068261151 dnaE DNA polymerase III DnaE; Reviewed 83.9
COG3111128 Periplasmic protein with OB-fold [Function unknown 83.37
cd04479101 RPA3 RPA3: A subfamily of OB folds similar to huma 83.37
PF12869144 tRNA_anti-like: tRNA_anti-like; InterPro: IPR02442 83.25
PRK00286 438 xseA exodeoxyribonuclease VII large subunit; Revie 83.02
PRK069201107 dnaE DNA polymerase III DnaE; Reviewed 82.85
COG0017 435 AsnS Aspartyl/asparaginyl-tRNA synthetases [Transl 82.78
PRK03932 450 asnC asparaginyl-tRNA synthetase; Validated 82.27
COG4085204 Predicted RNA-binding protein, contains TRAM domai 82.2
PRK10917 681 ATP-dependent DNA helicase RecG; Provisional 82.1
PRK10053130 hypothetical protein; Provisional 81.82
TIGR00457 453 asnS asparaginyl-tRNA synthetase. In a multiple se 80.34
>KOG0556|consensus Back     alignment and domain information 
Probab=100.00  E-value=2.3e-37  Score=273.04  Aligned_cols=169  Identities=37%  Similarity=0.538  Sum_probs=152.1

Q ss_pred             cccccCHHHHHHHHHHHHHHHHHHHHHHhhcchhcCCCccchhhhccCCccccccCCCCCCceEEcccccccCCCcEEEE
Q psy13182          4 EAQKVSKKALKKQAKEQEKKEKKDQRKSAQQNVEESEPVEDVSARLYGKTPLIMSEKDVDRDFVPIRQLNKDYVDKTVWV   83 (194)
Q Consensus         4 ~~~~~sk~alkK~~K~~~k~~kka~k~a~~~~~a~~~~~~d~~~~~Yg~~~l~qs~~~~~~~~~~i~~L~~~~~g~~V~v   83 (194)
                      +..++||+++||.+|+++|..++.++...++.+..++ ++|.++++||+++++||++.+++.|+.+.||+.+..|+.|||
T Consensus         9 E~gk~SKK~~kk~a~~~eK~~~k~e~~~~~~~a~~~~-~ed~~~~~yg~~~l~~s~~~~~~~~~~v~dl~~~~~~~~V~v   87 (533)
T KOG0556|consen    9 EDGKLSKKALKKLAKKLEKLRKKQEREETAAKAREAE-AEDYAKERYGDLSLIQSQSKEGRELTDVSDLDESNDGSEVLV   87 (533)
T ss_pred             ccccccHHHHHHHHHHHHHHHhhhhhhhhhhhhhhhh-hhhHHhhhcCcccccccccccccceeehhhhhhhcCCceEEE
Confidence            3334999999999999999999877654322222222 568899999999999999999999999999999999999999


Q ss_pred             EEEEEeeecCCCeEEEEEEecceEEEEEEecccc--ccHHHHHHHhcCCCccEEEEEEEEEecCcccCCCceeeeeec--
Q psy13182         84 RGRLHTSRAKGKQCFVVIREQNFTIQGILSVGDT--VSKQMIKYVSQIPKESILDIQAHVQATPTIVESLPMSILSVG--  159 (194)
Q Consensus        84 rgrv~~~R~~Gk~~Fl~lRd~~~~vQ~v~~~~~~--~s~~m~k~~~~l~rESiV~V~G~V~~~~~~i~~~t~~~~El~--  159 (194)
                      |||||+.|..||+|||+||++..++||+++.+++  ++++|++|+.+|++||+|+|+|+|.+++.||+|||++++|||  
T Consensus        88 RgrVhtsr~~GK~~FlvLRq~~~tVQ~~~~~~~~~~isk~Mvkf~~~is~ESiV~v~g~v~k~~~~i~scT~qdvEi~v~  167 (533)
T KOG0556|consen   88 RGRVHTSRLKGKLCFLVLRQQGSTVQCLVAVNEDGTISKQMVKFAGSISKESIVDVRGVVVKVKEPIKSCTVQDVEIHVR  167 (533)
T ss_pred             EEEEeeccccceEEEEEEeccCceEEEEEEcCCCchHHHHHHHHHhhcCcceEEEEEEEEecCCCcccccccceeEEEEE
Confidence            9999999999999999999999999999988754  999999999999999999999999999999999999999999  


Q ss_pred             --cccchhhcccccCC
Q psy13182        160 --DTVSKQMIKYVSQI  173 (194)
Q Consensus       160 --~~is~~~~~~~~~l  173 (194)
                        ++||.+..++|.++
T Consensus       168 ~iyviS~a~~~LPl~v  183 (533)
T KOG0556|consen  168 KIYVISIALPNLPLQV  183 (533)
T ss_pred             EEEEEecccccCCeee
Confidence              68999999999886

>PLN02850 aspartate-tRNA ligase Back     alignment and domain information
>PTZ00401 aspartyl-tRNA synthetase; Provisional Back     alignment and domain information
>cd04316 ND_PkAspRS_like_N ND_PkAspRS_like_N: N-terminal, anticodon recognition domain of the type found in the homodimeric non-discriminating (ND) Pyrococcus kodakaraensis aspartyl-tRNA synthetase (AspRS) Back     alignment and domain information
>cd04320 AspRS_cyto_N AspRS_cyto_N: N-terminal, anticodon recognition domain of the type found in Saccharomyces cerevisiae and human cytoplasmic aspartyl-tRNA synthetase (AspRS) Back     alignment and domain information
>KOG0555|consensus Back     alignment and domain information
>PLN02502 lysyl-tRNA synthetase Back     alignment and domain information
>cd04317 EcAspRS_like_N EcAspRS_like_N: N-terminal, anticodon recognition domain of the type found in Escherichia coli aspartyl-tRNA synthetase (AspRS), the human mitochondrial (mt) AspRS-2, the discriminating (D) Thermus thermophilus AspRS-1, and the nondiscriminating (ND) Helicobacter pylori AspRS Back     alignment and domain information
>cd04319 PhAsnRS_like_N PhAsnRS_like_N: N-terminal, anticodon recognition domain of the type found in Pyrococcus horikoshii AsnRS asparaginyl-tRNA synthetase (AsnRS) Back     alignment and domain information
>cd04323 AsnRS_cyto_like_N AsnRS_cyto_like_N: N-terminal, anticodon recognition domain of the type found in human and Saccharomyces cerevisiae cytoplasmic asparaginyl-tRNA synthetase (AsnRS), in Brugia malayai AsnRs and, in various putative bacterial AsnRSs Back     alignment and domain information
>cd04100 Asp_Lys_Asn_RS_N Asp_Lys_Asn_RS_N: N-terminal, anticodon recognition domain of class 2b aminoacyl-tRNA synthetases (aaRSs) Back     alignment and domain information
>cd04322 LysRS_N LysRS_N: N-terminal, anticodon recognition domain of lysyl-tRNA synthetases (LysRS) Back     alignment and domain information
>COG0017 AsnS Aspartyl/asparaginyl-tRNA synthetases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK05159 aspC aspartyl-tRNA synthetase; Provisional Back     alignment and domain information
>TIGR00458 aspS_arch aspartyl-tRNA synthetase, archaeal type Back     alignment and domain information
>PRK12820 bifunctional aspartyl-tRNA synthetase/aspartyl/glutamyl-tRNA amidotransferase subunit C; Provisional Back     alignment and domain information
>COG0173 AspS Aspartyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02903 aminoacyl-tRNA ligase Back     alignment and domain information
>PRK03932 asnC asparaginyl-tRNA synthetase; Validated Back     alignment and domain information
>cd04318 EcAsnRS_like_N EcAsnRS_like_N: N-terminal, anticodon recognition domain of the type found in Escherichia coli asparaginyl-tRNA synthetase (AsnRS) and, in Arabidopsis thaliana and Saccharomyces cerevisiae mitochondrial (mt) AsnRS Back     alignment and domain information
>KOG0556|consensus Back     alignment and domain information
>PRK00476 aspS aspartyl-tRNA synthetase; Validated Back     alignment and domain information
>TIGR00459 aspS_bact aspartyl-tRNA synthetase, bacterial type Back     alignment and domain information
>cd04321 ScAspRS_mt_like_N ScAspRS_mt_like_N: N-terminal, anticodon recognition domain of the type found in Saccharomyces cerevisiae mitochondrial (mt) aspartyl-tRNA synthetase (AspRS) Back     alignment and domain information
>TIGR00457 asnS asparaginyl-tRNA synthetase Back     alignment and domain information
>PRK00484 lysS lysyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PLN02221 asparaginyl-tRNA synthetase Back     alignment and domain information
>PLN02603 asparaginyl-tRNA synthetase Back     alignment and domain information
>TIGR00499 lysS_bact lysyl-tRNA synthetase, eukaryotic and non-spirochete bacterial Back     alignment and domain information
>PRK12445 lysyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK02983 lysS lysyl-tRNA synthetase; Provisional Back     alignment and domain information
>PTZ00385 lysyl-tRNA synthetase; Provisional Back     alignment and domain information
>KOG1885|consensus Back     alignment and domain information
>PTZ00425 asparagine-tRNA ligase; Provisional Back     alignment and domain information
>PTZ00417 lysine-tRNA ligase; Provisional Back     alignment and domain information
>PF01336 tRNA_anti-codon: OB-fold nucleic acid binding domain; InterPro: IPR004365 The OB-fold (oligonucleotide/oligosaccharide-binding fold) is found in all three kingdoms and its common architecture presents a binding face that has adapted to bind different ligands Back     alignment and domain information
>PTZ00401 aspartyl-tRNA synthetase; Provisional Back     alignment and domain information
>PLN02850 aspartate-tRNA ligase Back     alignment and domain information
>COG1190 LysU Lysyl-tRNA synthetase (class II) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2411|consensus Back     alignment and domain information
>PLN02532 asparagine-tRNA synthetase Back     alignment and domain information
>KOG0554|consensus Back     alignment and domain information
>cd04489 ExoVII_LU_OBF ExoVII_LU_OBF: A subfamily of OB folds corresponding to the N-terminal OB-fold domain of Escherichia coli exodeoxyribonuclease VII (ExoVII) large subunit Back     alignment and domain information
>PF13742 tRNA_anti_2: OB-fold nucleic acid binding domain Back     alignment and domain information
>TIGR00617 rpa1 replication factor-a protein 1 (rpa1) Back     alignment and domain information
>cd04474 RPA1_DBD_A RPA1_DBD_A: A subfamily of OB folds corresponding to the second OB fold, the ssDNA-binding domain (DBD)-A, of human RPA1 (also called RPA70) Back     alignment and domain information
>cd04487 RecJ_OBF2_like RecJ_OBF2_like: A subfamily of OB folds corresponding to the second OB fold (OBF2) of archaeal-specific proteins with similarity to eubacterial RecJ Back     alignment and domain information
>cd04316 ND_PkAspRS_like_N ND_PkAspRS_like_N: N-terminal, anticodon recognition domain of the type found in the homodimeric non-discriminating (ND) Pyrococcus kodakaraensis aspartyl-tRNA synthetase (AspRS) Back     alignment and domain information
>cd04482 RPA2_OBF_like RPA2_OBF_like: A subgroup of uncharacterized archaeal OB folds with similarity to the OB fold of the central ssDNA-binding domain (DBD)-D of human RPA2 (also called RPA32) Back     alignment and domain information
>COG1107 Archaea-specific RecJ-like exonuclease, contains DnaJ-type Zn finger domain [DNA replication, recombination, and repair] Back     alignment and domain information
>cd04483 hOBFC1_like hOBFC1_like: A subfamily of OB folds similar to that found in human OB fold containing protein 1 (hOBFC1) Back     alignment and domain information
>cd03524 RPA2_OBF_family RPA2_OBF_family: A family of oligonucleotide binding (OB) folds with similarity to the OB fold of the single strand (ss) DNA-binding domain (DBD)-D of human RPA2 (also called RPA32) Back     alignment and domain information
>cd04320 AspRS_cyto_N AspRS_cyto_N: N-terminal, anticodon recognition domain of the type found in Saccharomyces cerevisiae and human cytoplasmic aspartyl-tRNA synthetase (AspRS) Back     alignment and domain information
>cd04322 LysRS_N LysRS_N: N-terminal, anticodon recognition domain of lysyl-tRNA synthetases (LysRS) Back     alignment and domain information
>cd04478 RPA2_DBD_D RPA2_DBD_D: A subfamily of OB folds corresponding to the OB fold of the central ssDNA-binding domain (DBD)-D of human RPA2 (also called RPA32) Back     alignment and domain information
>PRK12366 replication factor A; Reviewed Back     alignment and domain information
>TIGR00458 aspS_arch aspartyl-tRNA synthetase, archaeal type Back     alignment and domain information
>cd04485 DnaE_OBF DnaE_OBF: A subfamily of OB folds corresponding to the C-terminal OB-fold nucleic acid binding domain of Thermus aquaticus and Escherichia coli type C replicative DNA polymerase III alpha subunit (DnaE) Back     alignment and domain information
>cd04492 YhaM_OBF_like YhaM_OBF_like: A subfamily of OB folds similar to that found in Bacillus subtilis YhaM and Staphylococcus aureus cmp-binding factor-1 (SaCBF1) Back     alignment and domain information
>PRK07211 replication factor A; Reviewed Back     alignment and domain information
>PRK07373 DNA polymerase III subunit alpha; Reviewed Back     alignment and domain information
>cd04323 AsnRS_cyto_like_N AsnRS_cyto_like_N: N-terminal, anticodon recognition domain of the type found in human and Saccharomyces cerevisiae cytoplasmic asparaginyl-tRNA synthetase (AsnRS), in Brugia malayai AsnRs and, in various putative bacterial AsnRSs Back     alignment and domain information
>PRK05159 aspC aspartyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK12366 replication factor A; Reviewed Back     alignment and domain information
>cd04490 PolII_SU_OBF PolII_SU_OBF: A subfamily of OB folds corresponding to the OB fold found in Pyrococcus abyssi DNA polymerase II (PolII) small subunit Back     alignment and domain information
>cd04100 Asp_Lys_Asn_RS_N Asp_Lys_Asn_RS_N: N-terminal, anticodon recognition domain of class 2b aminoacyl-tRNA synthetases (aaRSs) Back     alignment and domain information
>cd04318 EcAsnRS_like_N EcAsnRS_like_N: N-terminal, anticodon recognition domain of the type found in Escherichia coli asparaginyl-tRNA synthetase (AsnRS) and, in Arabidopsis thaliana and Saccharomyces cerevisiae mitochondrial (mt) AsnRS Back     alignment and domain information
>PRK14699 replication factor A; Provisional Back     alignment and domain information
>PRK12820 bifunctional aspartyl-tRNA synthetase/aspartyl/glutamyl-tRNA amidotransferase subunit C; Provisional Back     alignment and domain information
>PF08661 Rep_fac-A_3: Replication factor A protein 3; InterPro: IPR013970 Replication factor A is involved in eukaryotic DNA replication, recombination and repair Back     alignment and domain information
>PRK05672 dnaE2 error-prone DNA polymerase; Validated Back     alignment and domain information
>PRK07211 replication factor A; Reviewed Back     alignment and domain information
>COG1570 XseA Exonuclease VII, large subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>cd04319 PhAsnRS_like_N PhAsnRS_like_N: N-terminal, anticodon recognition domain of the type found in Pyrococcus horikoshii AsnRS asparaginyl-tRNA synthetase (AsnRS) Back     alignment and domain information
>PRK15491 replication factor A; Provisional Back     alignment and domain information
>PRK07374 dnaE DNA polymerase III subunit alpha; Validated Back     alignment and domain information
>TIGR00156 conserved hypothetical protein TIGR00156 Back     alignment and domain information
>PF04076 BOF: Bacterial OB fold (BOF) protein; InterPro: IPR005220 Proteins in this entry have an OB-fold fold (oligonucleotide/oligosaccharide binding motif) Back     alignment and domain information
>PRK05673 dnaE DNA polymerase III subunit alpha; Validated Back     alignment and domain information
>PRK06826 dnaE DNA polymerase III DnaE; Reviewed Back     alignment and domain information
>COG3111 Periplasmic protein with OB-fold [Function unknown] Back     alignment and domain information
>cd04479 RPA3 RPA3: A subfamily of OB folds similar to human RPA3 (also called RPA14) Back     alignment and domain information
>PF12869 tRNA_anti-like: tRNA_anti-like; InterPro: IPR024422 The function of the proteins in this entry is not known, but they contain a novel variant of the nucleic acid-binding OB fold [] Back     alignment and domain information
>PRK00286 xseA exodeoxyribonuclease VII large subunit; Reviewed Back     alignment and domain information
>PRK06920 dnaE DNA polymerase III DnaE; Reviewed Back     alignment and domain information
>COG0017 AsnS Aspartyl/asparaginyl-tRNA synthetases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK03932 asnC asparaginyl-tRNA synthetase; Validated Back     alignment and domain information
>COG4085 Predicted RNA-binding protein, contains TRAM domain [General function prediction only] Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>PRK10053 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00457 asnS asparaginyl-tRNA synthetase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query194
3i7f_A 548 Aspartyl Trna Synthetase From Entamoeba Histolytica 1e-07
1asy_A 490 Class Ii Aminoacyl Transfer Rna Synthetases: Crysta 2e-07
1eov_A 487 Free Aspartyl-Trna Synthetase (Asprs) (E.C. 6.1.1.1 8e-07
>pdb|3I7F|A Chain A, Aspartyl Trna Synthetase From Entamoeba Histolytica Length = 548 Back     alignment and structure 
Iteration: 1

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 46/84 (54%)
Query: 66  FVPIRQLNKDYVDKTVWVRGRLHTSRAKGKQCFVVIREQNFTIQGILSVGDTVSKQMIKY 125
           +  I +L     +KTV +R R+   R KG   F+ +R+  +T Q ++   +T+SK+ +++
Sbjct: 50  YTEIEELVPAMAEKTVTIRARVQAVRGKGNMVFLFLRKGIYTCQALVMKSETISKEFVQF 109
Query: 126 VSQIPKESILDIQAHVQATPTIVE 149
             +I  ESI DI   V+A    +E
Sbjct: 110 CQKISAESICDITGIVKAVEKPIE 133
>pdb|1ASY|A Chain A, Class Ii Aminoacyl Transfer Rna Synthetases: Crystal Structure Of Yeast Aspartyl-Trna Synthetase Complexed With Trna Asp Length = 490 Back     alignment and structure
>pdb|1EOV|A Chain A, Free Aspartyl-Trna Synthetase (Asprs) (E.C. 6.1.1.12) From Yeast Length = 487 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query194
3i7f_A 548 Aspartyl-tRNA synthetase; tRNA ligase, APO, ATP-bi 2e-33
1eov_A 487 ASPRS, aspartyl-tRNA synthetase; aminoacyl tRNA sy 7e-23
3nem_A 438 Aspartyl-tRNA synthetase; rossmann fold, OB fold, 3e-21
1wyd_A 429 Hypothetical aspartyl-tRNA synthetase; archaea, LI 2e-18
1n9w_A 422 Aspartyl-tRNA synthetase 2; biosynthetic protein; 5e-14
1x54_A 434 Asparaginyl-tRNA synthetase; aminoacyl-tRNA synthe 1e-09
2xgt_A 435 Asparaginyl-tRNA synthetase, cytoplasmic; ligase, 9e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
3m4p_A 456 Ehasnrs, asparaginyl-tRNA synthetase, putative; am 2e-05
>3i7f_A Aspartyl-tRNA synthetase; tRNA ligase, APO, ATP-binding, aminoacyl-tRNA synthetase, LI nucleotide-binding, protein biosynthesis; 2.80A {Entamoeba histolytica} Length = 548 Back     alignment and structure
 Score =  123 bits (310), Expect = 2e-33
 Identities = 33/131 (25%), Positives = 59/131 (45%), Gaps = 2/131 (1%)

Query: 22  KKEKKDQRKSAQQNVEESEPVEDVSARLYGKTPLIMSEKD--VDRDFVPIRQLNKDYVDK 79
                 ++K     V   +  E VS   +   P+  S+        +  I +L     +K
Sbjct: 4   SMAATQEKKPQLPPVVLLKTPELVSGENFKVMPMHQSQPCYKTGLKYTEIEELVPAMAEK 63

Query: 80  TVWVRGRLHTSRAKGKQCFVVIREQNFTIQGILSVGDTVSKQMIKYVSQIPKESILDIQA 139
           TV +R R+   R KG   F+ +R+  +T Q ++   +T+SK+ +++  +I  ESI DI  
Sbjct: 64  TVTIRARVQAVRGKGNMVFLFLRKGIYTCQALVMKSETISKEFVQFCQKISAESICDITG 123

Query: 140 HVQATPTIVES 150
            V+A    +E 
Sbjct: 124 IVKAVEKPIEK 134
>1eov_A ASPRS, aspartyl-tRNA synthetase; aminoacyl tRNA synthetase, tRNA ligase, APO-enzyme, OB-fold,; 2.30A {Saccharomyces cerevisiae} SCOP: b.40.4.1 d.104.1.1 PDB: 1asy_A* 1asz_A* Length = 487 Back     alignment and structure
>3nem_A Aspartyl-tRNA synthetase; rossmann fold, OB fold, ligase; HET: AMO ATP; 1.89A {Thermococcus kodakarensis} PDB: 3nel_A* 3nen_A 1b8a_A* Length = 438 Back     alignment and structure
>1wyd_A Hypothetical aspartyl-tRNA synthetase; archaea, LIGA; HET: EPE; 2.30A {Sulfolobus tokodaii} Length = 429 Back     alignment and structure
>1n9w_A Aspartyl-tRNA synthetase 2; biosynthetic protein; 2.30A {Thermus thermophilus} SCOP: b.40.4.1 d.104.1.1 PDB: 3kfu_A* Length = 422 Back     alignment and structure
>1x54_A Asparaginyl-tRNA synthetase; aminoacyl-tRNA synthetase, riken structural genomics/proteom initiative, RSGI, structural genomics, ligase; HET: 4AD; 1.45A {Pyrococcus horikoshii} PDB: 1x55_A* 1x56_A Length = 434 Back     alignment and structure
>2xgt_A Asparaginyl-tRNA synthetase, cytoplasmic; ligase, ATP-binding, protein biosynthesis; HET: NSS; 1.90A {Brugia malayi} PDB: 2xti_A* Length = 435 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3m4p_A Ehasnrs, asparaginyl-tRNA synthetase, putative; aminoacyl-tRNA synthetase, tRNA ligase, AARS, translation, ATP-binding, nucleotide-binding; HET: 4AD; 2.83A {Entamoeba histolytica} PDB: 3m4q_A Length = 456 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query194
3i7f_A 548 Aspartyl-tRNA synthetase; tRNA ligase, APO, ATP-bi 99.93
1eov_A 487 ASPRS, aspartyl-tRNA synthetase; aminoacyl tRNA sy 99.83
3nem_A 438 Aspartyl-tRNA synthetase; rossmann fold, OB fold, 99.6
1l0w_A 580 Aspartyl-tRNA synthetase; space-grown crystal, dim 99.54
1c0a_A 585 Aspartyl tRNA synthetase; protein-RNA complex, lig 99.53
1wyd_A 429 Hypothetical aspartyl-tRNA synthetase; archaea, LI 99.53
1x54_A 434 Asparaginyl-tRNA synthetase; aminoacyl-tRNA synthe 99.53
3m4p_A 456 Ehasnrs, asparaginyl-tRNA synthetase, putative; am 99.45
1n9w_A 422 Aspartyl-tRNA synthetase 2; biosynthetic protein; 99.45
1e1o_A 504 Lysyl-tRNA synthetase, heat inducible; ligase, ami 99.36
3a74_A 493 Lysyl-tRNA synthetase; aminoacyl tRNA synthetase, 99.35
4ex5_A 529 Lysine--tRNA ligase; structural genomics, niaid, n 99.33
4ah6_A 617 Aspartate--tRNA ligase, mitochondrial; 3.70A {Homo 99.28
3bju_A 521 Lysyl-tRNA synthetase; aminoacyl-tRNA synthetase, 99.26
2xgt_A 435 Asparaginyl-tRNA synthetase, cytoplasmic; ligase, 99.23
3i7f_A 548 Aspartyl-tRNA synthetase; tRNA ligase, APO, ATP-bi 97.07
1jmc_A246 Protein (replication protein A (RPA)); human ssDNA 96.96
4gop_C 444 Putative uncharacterized protein; OB fold, ssDNA b 96.43
1ynx_A114 Replication factor-A protein 1; canonical OB fold, 95.79
2k50_A115 Replication factor A related protein; uncharacteri 95.67
3au7_A402 TIAS, putative uncharacterized protein; ATP hydrol 94.92
3kdf_D132 Replication protein A 32 kDa subunit; wheat GERM c 93.41
4gop_B136 Putative uncharacterized protein; OB fold, ssDNA b 92.94
3kf6_A159 Protein STN1; OB fold, chromosomal protein, DNA-bi 92.81
3dm3_A105 Replication factor A; probably plays AN essential 92.29
3nem_A 438 Aspartyl-tRNA synthetase; rossmann fold, OB fold, 89.81
3e0e_A97 Replication protein A; structural genomics, PSI-2, 89.06
1o7i_A119 SSB, SSO2364, single stranded DNA binding protein; 88.09
1eov_A 487 ASPRS, aspartyl-tRNA synthetase; aminoacyl tRNA sy 87.87
2pi2_A270 Replication protein A 32 kDa subunit; FULL-length 86.97
2kqr_A113 Asparaginyl-tRNA synthetase, cytoplasmic; aminoacy 86.38
3kdf_A121 Replication protein A 14 kDa subunit; wheat GERM c 85.82
2kbn_A109 Conserved protein; nucleic acid binding protein, b 85.31
1x54_A 434 Asparaginyl-tRNA synthetase; aminoacyl-tRNA synthe 84.97
1e1o_A 504 Lysyl-tRNA synthetase, heat inducible; ligase, ami 81.23
>3i7f_A Aspartyl-tRNA synthetase; tRNA ligase, APO, ATP-binding, aminoacyl-tRNA synthetase, LI nucleotide-binding, protein biosynthesis; 2.80A {Entamoeba histolytica} Back     alignment and structure
Probab=99.93  E-value=8.9e-26  Score=208.36  Aligned_cols=146  Identities=25%  Similarity=0.369  Sum_probs=126.6

Q ss_pred             ccchhhhccCCccccccC--CCCCCceEEcccccccCCCcEEEEEEEEEeeecCCCeEEEEEEecceEEEEEEecccccc
Q psy13182         42 VEDVSARLYGKTPLIMSE--KDVDRDFVPIRQLNKDYVDKTVWVRGRLHTSRAKGKQCFVVIREQNFTIQGILSVGDTVS  119 (194)
Q Consensus        42 ~~d~~~~~Yg~~~l~qs~--~~~~~~~~~i~~L~~~~~g~~V~vrgrv~~~R~~Gk~~Fl~lRd~~~~vQ~v~~~~~~~s  119 (194)
                      ++|.++++||++||+||+  .+++++|+.|++|+.++.|+.|+|+||||+.|.+|+++|+.|||+++++|+|+...+..+
T Consensus        24 ~~~~~~~~yg~~~~~~~~~~~~~~~~~~~i~~l~~~~~g~~V~v~Gwv~~~R~~gkl~Fi~LrD~~g~iQ~v~~~~~~~~  103 (548)
T 3i7f_A           24 PELVSGENFKVMPMHQSQPCYKTGLKYTEIEELVPAMAEKTVTIRARVQAVRGKGNMVFLFLRKGIYTCQALVMKSETIS  103 (548)
T ss_dssp             CCCCCCSSEEECCCCSSCGGGCCCCCBCCGGGCSGGGTTCEEEEEEEEEEEEECSSEEEEEEEETTEEEEEEEECSSSSC
T ss_pred             ccchhhhhcCcCccccccccccCCCceEEhhhcchhcCCCEEEEEEEEEEEecCCCeEEEEEEECCeeEEEEEECCCccC
Confidence            468899999999999999  789999999999998899999999999999999999999999999999999998754578


Q ss_pred             HHHHHHHhcCCCccEEEEEEEEEecCcccCCCceeeeeec----cccchhhcccccCCCC------------CceEeEEE
Q psy13182        120 KQMIKYVSQIPKESILDIQAHVQATPTIVESLPMSILSVG----DTVSKQMIKYVSQIPK------------ESILDIQA  183 (194)
Q Consensus       120 ~~m~k~~~~l~rESiV~V~G~V~~~~~~i~~~t~~~~El~----~~is~~~~~~~~~l~~------------esi~~~~~  183 (194)
                      ++|++|+..|+.||+|.|+|+|.+++.++.+|+.+++||+    .++|++...+|+++..            ++|.+|.+
T Consensus       104 ~~~~~~~~~l~~es~V~V~G~v~~~~~~~~~~~~~~~El~~~~i~vls~a~~~lP~~~~d~~~~~~~~~~~~~~~~~~~~  183 (548)
T 3i7f_A          104 KEFVQFCQKISAESICDITGIVKAVEKPIEKATQQDVEIHVTSIAVVSLAEYPLPMQIEDLTFPSSVFKKQEEDIAKVDE  183 (548)
T ss_dssp             HHHHHHHHTCCTTEEEEEEEEEEECSSCCTTSSSCSEEEEEEEEEEEECCCBSCSSCSGGGSCCHHHHHHHHHHTTCC--
T ss_pred             HHHHHHHhCCCCCCEEEEEEEEEeCCcccccCCCCcEEEEEeEEEEEecCCCCCCCCchhcccccccccccccccccccc
Confidence            8999999999999999999999999999999999999999    3578887888888743            25677777


Q ss_pred             EEec
Q psy13182        184 HVQA  187 (194)
Q Consensus       184 ~~~~  187 (194)
                      ++.+
T Consensus       184 ~~~~  187 (548)
T 3i7f_A          184 KIAK  187 (548)
T ss_dssp             ----
T ss_pred             cccc
Confidence            7655
>1eov_A ASPRS, aspartyl-tRNA synthetase; aminoacyl tRNA synthetase, tRNA ligase, APO-enzyme, OB-fold,; 2.30A {Saccharomyces cerevisiae} SCOP: b.40.4.1 d.104.1.1 PDB: 1asy_A* 1asz_A* Back     alignment and structure
>3nem_A Aspartyl-tRNA synthetase; rossmann fold, OB fold, ligase; HET: AMO ATP; 1.89A {Thermococcus kodakarensis} PDB: 3nel_A* 3nen_A 1b8a_A* Back     alignment and structure
>1l0w_A Aspartyl-tRNA synthetase; space-grown crystal, dimeric enzyme, flexible domains, ligase; 2.01A {Thermus thermophilus} SCOP: b.40.4.1 d.74.4.1 d.104.1.1 PDB: 1efw_A* 1g51_A Back     alignment and structure
>1c0a_A Aspartyl tRNA synthetase; protein-RNA complex, ligase/RNA complex; HET: 4SU H2U QUO G7M 5MU PSU AMP AMO; 2.40A {Escherichia coli} SCOP: b.40.4.1 d.74.4.1 d.104.1.1 PDB: 1il2_A* 1eqr_A* Back     alignment and structure
>1wyd_A Hypothetical aspartyl-tRNA synthetase; archaea, LIGA; HET: EPE; 2.30A {Sulfolobus tokodaii} Back     alignment and structure
>1x54_A Asparaginyl-tRNA synthetase; aminoacyl-tRNA synthetase, riken structural genomics/proteom initiative, RSGI, structural genomics, ligase; HET: 4AD; 1.45A {Pyrococcus horikoshii} PDB: 1x55_A* 1x56_A Back     alignment and structure
>3m4p_A Ehasnrs, asparaginyl-tRNA synthetase, putative; aminoacyl-tRNA synthetase, tRNA ligase, AARS, translation, ATP-binding, nucleotide-binding; HET: 4AD; 2.83A {Entamoeba histolytica} PDB: 3m4q_A Back     alignment and structure
>1n9w_A Aspartyl-tRNA synthetase 2; biosynthetic protein; 2.30A {Thermus thermophilus} SCOP: b.40.4.1 d.104.1.1 PDB: 3kfu_A* Back     alignment and structure
>1e1o_A Lysyl-tRNA synthetase, heat inducible; ligase, aminoacyl-tRNA synthetase, protein biosynthesis; HET: LYS; 2.12A {Escherichia coli} SCOP: b.40.4.1 d.104.1.1 PDB: 1e1t_A* 1e22_A* 1e24_A* 1lyl_A 1bbu_A* 1bbw_A 1krs_A 1krt_A Back     alignment and structure
>3a74_A Lysyl-tRNA synthetase; aminoacyl tRNA synthetase, ligase, protein biosynthesis, AMI tRNA synthetase, ATP-binding, magnesium; HET: B4P LYN; 1.80A {Geobacillus stearothermophilus} PDB: 3e9h_A* 3e9i_A* Back     alignment and structure
>4ex5_A Lysine--tRNA ligase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: LYS; 2.40A {Burkholderia thailandensis} Back     alignment and structure
>4ah6_A Aspartate--tRNA ligase, mitochondrial; 3.70A {Homo sapiens} Back     alignment and structure
>3bju_A Lysyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP- binding, cytoplasm, ligase, nucleotide-binding, phosphoprotein, polymorphism; HET: LYS ATP; 2.31A {Homo sapiens} Back     alignment and structure
>2xgt_A Asparaginyl-tRNA synthetase, cytoplasmic; ligase, ATP-binding, protein biosynthesis; HET: NSS; 1.90A {Brugia malayi} PDB: 2xti_A* Back     alignment and structure
>3i7f_A Aspartyl-tRNA synthetase; tRNA ligase, APO, ATP-binding, aminoacyl-tRNA synthetase, LI nucleotide-binding, protein biosynthesis; 2.80A {Entamoeba histolytica} Back     alignment and structure
>1jmc_A Protein (replication protein A (RPA)); human ssDNA binding replication protein A(RPA), single stranded DNA-binding protein, protein-ssDNA complex; HET: DNA; 2.40A {Homo sapiens} SCOP: b.40.4.3 b.40.4.3 PDB: 1fgu_A Back     alignment and structure
>4gop_C Putative uncharacterized protein; OB fold, ssDNA binding, DNA binding protein-DNA complex; HET: DNA; 3.10A {Ustilago maydis} Back     alignment and structure
>1ynx_A Replication factor-A protein 1; canonical OB fold, DNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2k50_A Replication factor A related protein; uncharacterized protein, structural genomics, PSI-2; NMR {Methanothermobacterthermautotrophicus str} Back     alignment and structure
>3au7_A TIAS, putative uncharacterized protein; ATP hydrolysis, RNA binding protein; 2.60A {Archaeoglobus fulgidus} PDB: 3amt_A* 3amu_A* Back     alignment and structure
>3kdf_D Replication protein A 32 kDa subunit; wheat GERM cell free, protein complex, center for eukaryotic structural genomics, PSI; HET: MSE; 1.98A {Homo sapiens} SCOP: b.40.4.3 PDB: 2pqa_A 1quq_A 1l1o_B Back     alignment and structure
>4gop_B Putative uncharacterized protein; OB fold, ssDNA binding, DNA binding protein-DNA complex; HET: DNA; 3.10A {Ustilago maydis} Back     alignment and structure
>3kf6_A Protein STN1; OB fold, chromosomal protein, DNA-binding, nucleus, telomere; 1.65A {Schizosaccharomyces pombe} Back     alignment and structure
>3dm3_A Replication factor A; probably plays AN essential for replication of the chromosome, DNA recombination and repair; 2.40A {Methanocaldococcus jannaschii} Back     alignment and structure
>3nem_A Aspartyl-tRNA synthetase; rossmann fold, OB fold, ligase; HET: AMO ATP; 1.89A {Thermococcus kodakarensis} PDB: 3nel_A* 3nen_A 1b8a_A* Back     alignment and structure
>3e0e_A Replication protein A; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 1.60A {Methanococcus maripaludis} PDB: 2k5v_A Back     alignment and structure
>1o7i_A SSB, SSO2364, single stranded DNA binding protein; OB fold; 1.2A {Sulfolobus solfataricus} SCOP: b.40.4.3 Back     alignment and structure
>1eov_A ASPRS, aspartyl-tRNA synthetase; aminoacyl tRNA synthetase, tRNA ligase, APO-enzyme, OB-fold,; 2.30A {Saccharomyces cerevisiae} SCOP: b.40.4.1 d.104.1.1 PDB: 1asy_A* 1asz_A* Back     alignment and structure
>2pi2_A Replication protein A 32 kDa subunit; FULL-length RPA14/32, ssDNA binding protein, OB-fold, dioxan replication, DNA binding protein; 2.00A {Homo sapiens} SCOP: b.40.4.3 PDB: 2z6k_A 1dpu_A 1z1d_A Back     alignment and structure
>2kqr_A Asparaginyl-tRNA synthetase, cytoplasmic; aminoacyl-tRNA synthetase, ATP-binding, ligas nucleotide-binding, protein biosynthesis; NMR {Brugia malayi} Back     alignment and structure
>3kdf_A Replication protein A 14 kDa subunit; wheat GERM cell free, protein complex, center for eukaryotic structural genomics, PSI; HET: MSE; 1.98A {Homo sapiens} SCOP: b.40.4.3 PDB: 1quq_B 1l1o_A Back     alignment and structure
>2kbn_A Conserved protein; nucleic acid binding protein, beta barrel, structural genomics, PSI-2, protein structure initiative; NMR {Methanosarcina mazei} PDB: 2ken_A Back     alignment and structure
>1x54_A Asparaginyl-tRNA synthetase; aminoacyl-tRNA synthetase, riken structural genomics/proteom initiative, RSGI, structural genomics, ligase; HET: 4AD; 1.45A {Pyrococcus horikoshii} PDB: 1x55_A* 1x56_A Back     alignment and structure
>1e1o_A Lysyl-tRNA synthetase, heat inducible; ligase, aminoacyl-tRNA synthetase, protein biosynthesis; HET: LYS; 2.12A {Escherichia coli} SCOP: b.40.4.1 d.104.1.1 PDB: 1e1t_A* 1e22_A* 1e24_A* 1lyl_A 1bbu_A* 1bbw_A 1krs_A 1krt_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 194
d1eova1134 b.40.4.1 (A:71-204) Aspartyl-tRNA synthetase (AspR 3e-09
d1b8aa1103 b.40.4.1 (A:1-103) Aspartyl-tRNA synthetase (AspRS 9e-09
d1n9wa193 b.40.4.1 (A:1-93) Aspartyl-tRNA synthetase (AspRS) 8e-08
d1c0aa1106 b.40.4.1 (A:1-106) Aspartyl-tRNA synthetase (AspRS 7e-07
d1l0wa1104 b.40.4.1 (A:1-104) Aspartyl-tRNA synthetase (AspRS 9e-05
>d1eova1 b.40.4.1 (A:71-204) Aspartyl-tRNA synthetase (AspRS) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 134 Back     information, alignment and structure

class: All beta proteins
fold: OB-fold
superfamily: Nucleic acid-binding proteins
family: Anticodon-binding domain
domain: Aspartyl-tRNA synthetase (AspRS)
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score = 50.8 bits (121), Expect = 3e-09
 Identities = 31/113 (27%), Positives = 52/113 (46%), Gaps = 6/113 (5%)

Query: 46  SARLYGKTPLIMSEKDVDRDFVPIR---QLNKDYVDKTVWVRGRLHTSRAKGKQ-CFVVI 101
           +   YGK PLI S          ++          DK V  R R+H +R +G    F+ +
Sbjct: 1   AKDNYGKLPLIQSRDSDRTGQKRVKFVDLDEAKDSDKEVLFRARVHNTRQQGATLAFLTL 60

Query: 102 REQNFTIQGILSVG--DTVSKQMIKYVSQIPKESILDIQAHVQATPTIVESLP 152
           R+Q   IQG++      T+SK M+K+   +  ESI+ ++  V+     ++S  
Sbjct: 61  RQQASLIQGLVKANKEGTISKNMVKWAGSLNLESIVLVRGIVKKVDEPIKSAT 113
>d1b8aa1 b.40.4.1 (A:1-103) Aspartyl-tRNA synthetase (AspRS) {Archaeon Pyrococcus kodakaraensis [TaxId: 311400]} Length = 103 Back     information, alignment and structure
>d1n9wa1 b.40.4.1 (A:1-93) Aspartyl-tRNA synthetase (AspRS) {Thermus thermophilus, AspRS-2 [TaxId: 274]} Length = 93 Back     information, alignment and structure
>d1c0aa1 b.40.4.1 (A:1-106) Aspartyl-tRNA synthetase (AspRS) {Escherichia coli [TaxId: 562]} Length = 106 Back     information, alignment and structure
>d1l0wa1 b.40.4.1 (A:1-104) Aspartyl-tRNA synthetase (AspRS) {Thermus thermophilus, AspRS-1 [TaxId: 274]} Length = 104 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query194
d1eova1134 Aspartyl-tRNA synthetase (AspRS) {Baker's yeast (S 99.94
d1b8aa1103 Aspartyl-tRNA synthetase (AspRS) {Archaeon Pyrococ 99.82
d1l0wa1104 Aspartyl-tRNA synthetase (AspRS) {Thermus thermoph 99.79
d1c0aa1106 Aspartyl-tRNA synthetase (AspRS) {Escherichia coli 99.79
d1n9wa193 Aspartyl-tRNA synthetase (AspRS) {Thermus thermoph 99.75
d1e1oa1143 Lysyl-tRNA synthetase (LysRS) {Escherichia coli, g 99.29
d1eova1134 Aspartyl-tRNA synthetase (AspRS) {Baker's yeast (S 97.85
d1b8aa1103 Aspartyl-tRNA synthetase (AspRS) {Archaeon Pyrococ 96.7
d1jmca1116 Replication protein A 70 KDa subunit (RPA70) {Huma 96.15
d1c0aa1106 Aspartyl-tRNA synthetase (AspRS) {Escherichia coli 93.71
d1l0wa1104 Aspartyl-tRNA synthetase (AspRS) {Thermus thermoph 92.68
d2pi2a1128 Replication protein A 32 KDa subunit (RPA32) fragm 92.39
d2pi2e1115 Replication protein A 14 KDa (RPA14) subunit {Huma 91.6
d1o7ia_115 Archaeal ssDNA-binding protein {Archaeon Sulfolobu 91.43
d1n9wa193 Aspartyl-tRNA synthetase (AspRS) {Thermus thermoph 87.71
d1nnxa_106 Hypothetical protein YgiW {Escherichia coli [TaxId 82.75
d1wjja_145 Hypothetical protein At4g28440 (F20O9.120) {Thale 81.42
>d1eova1 b.40.4.1 (A:71-204) Aspartyl-tRNA synthetase (AspRS) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All beta proteins
fold: OB-fold
superfamily: Nucleic acid-binding proteins
family: Anticodon-binding domain
domain: Aspartyl-tRNA synthetase (AspRS)
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=99.94  E-value=2e-26  Score=175.93  Aligned_cols=114  Identities=30%  Similarity=0.472  Sum_probs=103.0

Q ss_pred             hhhccCCccccccCC--CCCCceEEccccc-ccCCCcEEEEEEEEEeeecCC-CeEEEEEEecceEEEEEEeccc--ccc
Q psy13182         46 SARLYGKTPLIMSEK--DVDRDFVPIRQLN-KDYVDKTVWVRGRLHTSRAKG-KQCFVVIREQNFTIQGILSVGD--TVS  119 (194)
Q Consensus        46 ~~~~Yg~~~l~qs~~--~~~~~~~~i~~L~-~~~~g~~V~vrgrv~~~R~~G-k~~Fl~lRd~~~~vQ~v~~~~~--~~s  119 (194)
                      ++++||++||.||+.  ..+..++.+.++. ..+.|+.|+|+|||++.|.+| +++|+.|||+++++||++....  ..+
T Consensus         1 ~~~~yG~lp~~~s~~~~~~~~~r~~i~dl~~~~~~g~~V~v~GwV~~~R~~G~kl~F~~LrD~sg~iQ~~v~~~~~~~~~   80 (134)
T d1eova1           1 AKDNYGKLPLIQSRDSDRTGQKRVKFVDLDEAKDSDKEVLFRARVHNTRQQGATLAFLTLRQQASLIQGLVKANKEGTIS   80 (134)
T ss_dssp             CCSSEEECCCCCCCGGGCCCCCCCCGGGCCTTTTTTCEEEEEEEEEEEEECSSSEEEEEEEETTEEEEEEEECCSSSSSC
T ss_pred             ChhhcCCCccccccccccCCcEEEEeccccchhcCCCEEEEEEEEEEEEeCCCcEEEEEEEcCCCcEEEEEEeccccchh
Confidence            357999999999874  4567889999985 468899999999999999998 5899999999999999988753  467


Q ss_pred             HHHHHHHhcCCCccEEEEEEEEEecCcccCCCceeeeeec
Q psy13182        120 KQMIKYVSQIPKESILDIQAHVQATPTIVESLPMSILSVG  159 (194)
Q Consensus       120 ~~m~k~~~~l~rESiV~V~G~V~~~~~~i~~~t~~~~El~  159 (194)
                      .+|++|+.+|++||+|.|+|+|.+++.++.+|+.+++||+
T Consensus        81 ~~~~~~~~~l~~es~V~V~G~v~~~~~~~~~~~~~~~Ei~  120 (134)
T d1eova1          81 KNMVKWAGSLNLESIVLVRGIVKKVDEPIKSATVQNLEIH  120 (134)
T ss_dssp             HHHHHHHTTCCTTCEEEEEEEEEECSSCCTTSSEEEEEEE
T ss_pred             HHHHHHHhcCCCCCEEEEEEEEEeCCccCCCCCCCcEEEE
Confidence            8999999999999999999999999999999999999999
>d1b8aa1 b.40.4.1 (A:1-103) Aspartyl-tRNA synthetase (AspRS) {Archaeon Pyrococcus kodakaraensis [TaxId: 311400]} Back     information, alignment and structure
>d1l0wa1 b.40.4.1 (A:1-104) Aspartyl-tRNA synthetase (AspRS) {Thermus thermophilus, AspRS-1 [TaxId: 274]} Back     information, alignment and structure
>d1c0aa1 b.40.4.1 (A:1-106) Aspartyl-tRNA synthetase (AspRS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n9wa1 b.40.4.1 (A:1-93) Aspartyl-tRNA synthetase (AspRS) {Thermus thermophilus, AspRS-2 [TaxId: 274]} Back     information, alignment and structure
>d1e1oa1 b.40.4.1 (A:11-153) Lysyl-tRNA synthetase (LysRS) {Escherichia coli, gene lysU [TaxId: 562]} Back     information, alignment and structure
>d1eova1 b.40.4.1 (A:71-204) Aspartyl-tRNA synthetase (AspRS) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1b8aa1 b.40.4.1 (A:1-103) Aspartyl-tRNA synthetase (AspRS) {Archaeon Pyrococcus kodakaraensis [TaxId: 311400]} Back     information, alignment and structure
>d1jmca1 b.40.4.3 (A:183-298) Replication protein A 70 KDa subunit (RPA70) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c0aa1 b.40.4.1 (A:1-106) Aspartyl-tRNA synthetase (AspRS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l0wa1 b.40.4.1 (A:1-104) Aspartyl-tRNA synthetase (AspRS) {Thermus thermophilus, AspRS-1 [TaxId: 274]} Back     information, alignment and structure
>d2pi2a1 b.40.4.3 (A:44-171) Replication protein A 32 KDa subunit (RPA32) fragment {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pi2e1 b.40.4.3 (E:3-117) Replication protein A 14 KDa (RPA14) subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o7ia_ b.40.4.3 (A:) Archaeal ssDNA-binding protein {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1n9wa1 b.40.4.1 (A:1-93) Aspartyl-tRNA synthetase (AspRS) {Thermus thermophilus, AspRS-2 [TaxId: 274]} Back     information, alignment and structure
>d1nnxa_ b.40.10.1 (A:) Hypothetical protein YgiW {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wjja_ b.40.4.3 (A:) Hypothetical protein At4g28440 (F20O9.120) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure