Psyllid ID: psy13207


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------
MGPSPLQSEKCLNQWTRRSNLVDSRTSVTDVKFGPKQLGLVLATCAADGLVRIYEAPDVMNLSQWCLQHEVACPTLASCLTWNHSFSRFNSISIMYEAHSINAEHKDLIHDVAYDYYGLRMATCSSDQNIKVTRDVMGTRFDIETIGNFEDHYCTVWRVSWNITGTIVASSGDDGCVRLWKLKKKRKKKKEEEEEEN
cccccccccccccccEEEEEEEcccccEEEEEEcccccccEEEEEEccccEEEEEccccccccEEEEEEEEcccEEEcccccccEEEEEccccEEEEEEcccccccccEEEEEEcccccEEEEEEccccEEEEEccccccccEEEEEccccccccEEEEEEcccccEEEEEEccccEEEEEcccccEEEEEEEEccc
cccccccccccEEEEEEEEEEccccccEEEEEEcccccccEEEEEccccEEEEEEcccccEEEEEEccccEEEEEEcccccEEEcccccccEEEEEccccEEccccccEEEEEEcccccEEEEEccccEEEEEEccccccccEEEEEEEccccccEEEEEEcccccEEEEEccccEEEEEEcccccEEccccccccc
mgpsplqsekclnqwtrrsnlvdsrtsvtdvkfgpkqLGLVLATCAADGLvriyeapdvmnlsQWCLQhevacptlascltwnhsfsrfNSISIMYEAHSINAEHKDLIHDVAYDYYGlrmatcssdqnikVTRDvmgtrfdietignfedhYCTVWRVSWNITGTIVASSGDDGCVRLWKLKKKRKKKKEEEEEEN
mgpsplqseKCLNqwtrrsnlvdsrtsvtdvkfgpkqlGLVLATCAADGLVRIYEAPDVMNLSQWCLQHEVACPTLASCLTWNHSFSRFNSISIMYEAHSINAEHKDLIHDVAYDYYGLRMATcssdqnikVTRDVMGTRFDIETIGNFEDHYCTVWRVSWNITGTivassgddgcvrlwklkkkrkkkkeeeeeen
MGPSPLQSEKCLNQWTRRSNLVDSRTSVTDVKFGPKQLGLVLATCAADGLVRIYEAPDVMNLSQWCLQHEVACPTLASCLTWNHSFSRFNSISIMYEAHSINAEHKDLIHDVAYDYYGLRMATCSSDQNIKVTRDVMGTRFDIETIGNFEDHYCTVWRVSWNITGTIVASSGDDGCVRLWklkkkrkkkkeeeeeeN
**************WTR**NLVDSRTSVTDVKFGPKQLGLVLATCAADGLVRIYEAPDVMNLSQWCLQHEVACPTLASCLTWNHSFSRFNSISIMYEAHSINAEHKDLIHDVAYDYYGLRMATCSSDQNIKVTRDVMGTRFDIETIGNFEDHYCTVWRVSWNITGTIVASSGDDGCVRLWKL***************
************NQ*TRRSNLVDSRTSVTDVKFGPKQLGLVLATCAADGLVRIYEAPDVMNLSQWCLQHEVACPTLASCLTWNHSFSRFNSISIMYEAHSINAEHKDLIHDVAYDYYGLRMATCSSDQNIKVTRDVMGTRFDIETIGNFEDHYCTVWRVSWNITGTIVASSGDDGCVRLWKLKKK************
********EKCLNQWTRRSNLVDSRTSVTDVKFGPKQLGLVLATCAADGLVRIYEAPDVMNLSQWCLQHEVACPTLASCLTWNHSFSRFNSISIMYEAHSINAEHKDLIHDVAYDYYGLRMATCSSDQNIKVTRDVMGTRFDIETIGNFEDHYCTVWRVSWNITGTIVASSGDDGCVRLWKLK**************
********EKCLNQWTRRSNLVDSRTSVTDVKFGPKQLGLVLATCAADGLVRIYEAPDVMNLSQWCLQHEVACPTLASCLTWNHSFSRFNSISIMYEAHSINAEHKDLIHDVAYDYYGLRMATCSSDQNIKVTRDVMGTRFDIETIGNFEDHYCTVWRVSWNITGTIVASSGDDGCVRLWKLKKKRKKKKE******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGPSPLQSEKCLNQWTRRSNLVDSRTSVTDVKFGPKQLGLVLATCAADGLVRIYEAPDVMNLSQWCLQHEVACPTLASCLTWNHSFSRFNSISIMYEAHSINAEHKDLIHDVAYDYYGLRMATCSSDQNIKVTRDVMGTRFDIETIGNFEDHYCTVWRVSWNITGTIVASSGDDGCVRLWKLKKKRKKKKEEEEEEN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query197 2.2.26 [Sep-21-2011]
Q5RAN6360 Nucleoporin SEH1 OS=Pongo yes N/A 0.847 0.463 0.471 3e-44
Q96EE3360 Nucleoporin SEH1 OS=Homo yes N/A 0.847 0.463 0.471 3e-44
A7YY75360 Nucleoporin SEH1 OS=Bos t yes N/A 0.847 0.463 0.466 7e-44
Q8R2U0360 Nucleoporin SEH1 OS=Mus m yes N/A 0.857 0.469 0.461 2e-43
Q4FZW5360 Nucleoporin seh1-A OS=Xen N/A N/A 0.857 0.469 0.461 2e-42
Q5U4Y8360 Nucleoporin seh1 OS=Xenop yes N/A 0.857 0.469 0.461 2e-42
Q6GNF1360 Nucleoporin seh1-B OS=Xen N/A N/A 0.857 0.469 0.456 1e-41
C1BK83364 Nucleoporin seh1 OS=Osmer N/A N/A 0.868 0.469 0.436 3e-41
Q6TGU2364 Nucleoporin seh1 OS=Danio yes N/A 0.857 0.464 0.411 4e-41
Q10099339 Nucleoporin seh1 OS=Schiz yes N/A 0.837 0.486 0.337 3e-21
>sp|Q5RAN6|SEH1_PONAB Nucleoporin SEH1 OS=Pongo abelii GN=SEH1L PE=2 SV=1 Back     alignment and function desciption
 Score =  177 bits (450), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 98/208 (47%), Positives = 129/208 (62%), Gaps = 41/208 (19%)

Query: 13  NQWTRRSNLVDSRTSVTDVKFGPKQLGLVLATCAADGLVRIYEAPDVMNLSQWCLQHEVA 72
           + W +R+ LVDSRTSVTDVKF PK +GL+LATC+ADG+VRIYEAPDVMNLSQW LQHE++
Sbjct: 101 SHWVKRTTLVDSRTSVTDVKFAPKHMGLMLATCSADGIVRIYEAPDVMNLSQWSLQHEIS 160

Query: 73  CPTLASCLTWNHSFSRFNS--ISIMYEAHSINAEHK-----------------------D 107
           C    SC++WN S SR +S  I++  +  S NA  K                       D
Sbjct: 161 CKLSCSCISWNPSSSRAHSPMIAVGSDDSSPNAMAKVQIFEYNENTRKYAKAETLMTVTD 220

Query: 108 LIHDVAY------DYYGLRMATCSSDQNI--------KVTRDVMGTRFDIETIGNFEDHY 153
            +HD+A+       ++ L +AT   D  I        ++T     T+F+I  + +F++H 
Sbjct: 221 PVHDIAFAPNLGRSFHILAIAT--KDVRIFTLKPVRKELTSSGGPTKFEIHIVAHFDNHN 278

Query: 154 CTVWRVSWNITGTIVASSGDDGCVRLWK 181
             VWRVSWNITGT++ASSGDDGCVRLWK
Sbjct: 279 SQVWRVSWNITGTVLASSGDDGCVRLWK 306




Component of the Nup107-160 subcomplex of the nuclear pore complex (NPC). The Nup107-160 subcomplex is required for the assembly of a functional NPC. The Nup107-160 subcomplex is also required for normal kinetochore microtubule attachment, mitotic progression and chromosome segregation. This subunit plays a role in recruitment of the Nup107-160 subcomplex to the kinetochore.
Pongo abelii (taxid: 9601)
>sp|Q96EE3|SEH1_HUMAN Nucleoporin SEH1 OS=Homo sapiens GN=SEH1L PE=1 SV=3 Back     alignment and function description
>sp|A7YY75|SEH1_BOVIN Nucleoporin SEH1 OS=Bos taurus GN=SEH1L PE=2 SV=1 Back     alignment and function description
>sp|Q8R2U0|SEH1_MOUSE Nucleoporin SEH1 OS=Mus musculus GN=Seh1l PE=2 SV=1 Back     alignment and function description
>sp|Q4FZW5|SEH1A_XENLA Nucleoporin seh1-A OS=Xenopus laevis GN=seh1l-a PE=2 SV=1 Back     alignment and function description
>sp|Q5U4Y8|SEH1_XENTR Nucleoporin seh1 OS=Xenopus tropicalis GN=seh1l PE=2 SV=1 Back     alignment and function description
>sp|Q6GNF1|SEH1B_XENLA Nucleoporin seh1-B OS=Xenopus laevis GN=seh1l-b PE=2 SV=1 Back     alignment and function description
>sp|C1BK83|SEH1_OSMMO Nucleoporin seh1 OS=Osmerus mordax GN=seh1l PE=2 SV=1 Back     alignment and function description
>sp|Q6TGU2|SEH1_DANRE Nucleoporin seh1 OS=Danio rerio GN=seh1l PE=2 SV=2 Back     alignment and function description
>sp|Q10099|SEH1_SCHPO Nucleoporin seh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=seh1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query197
242009287 363 nucleoporin seh1, putative [Pediculus hu 0.928 0.504 0.461 5e-46
170038326 344 nucleoporin [Culex quinquefasciatus] gi| 0.893 0.511 0.464 1e-44
307212004 405 Nucleoporin SEH1-like [Harpegnathos salt 0.832 0.404 0.468 2e-44
307187571 405 Nucleoporin SEH1-like [Camponotus florid 0.852 0.414 0.497 5e-44
301775003 2971 PREDICTED: centrosomal protein of 192 kD 0.857 0.056 0.470 6e-44
240848713 356 nucleoporin SEH1-like [Acyrthosiphon pis 0.842 0.466 0.464 1e-43
157113074 361 nucleoporin, putative [Aedes aegypti] gi 0.893 0.487 0.469 2e-43
334325923 2865 PREDICTED: centrosomal protein of 192 kD 0.857 0.058 0.461 4e-43
383852726 408 PREDICTED: nucleoporin seh1-A-like [Mega 0.878 0.424 0.473 4e-43
332026068 405 Nucleoporin seh1-B [Acromyrmex echinatio 0.852 0.414 0.487 6e-43
>gi|242009287|ref|XP_002425421.1| nucleoporin seh1, putative [Pediculus humanus corporis] gi|212509238|gb|EEB12683.1| nucleoporin seh1, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  189 bits (480), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 102/221 (46%), Positives = 132/221 (59%), Gaps = 38/221 (17%)

Query: 1   MGPSPLQSEKCLNQWTRRSNLVDSRTSVTDVKFGPKQLGLVLATCAADGLVRIYEAPDVM 60
           +G      E+ +  W RR+NLVDSRTSVTDVKFGPK LGL+LAT +ADG+VRIYEAPD+M
Sbjct: 90  IGEGMGSGERGMRHWVRRTNLVDSRTSVTDVKFGPKSLGLILATSSADGVVRIYEAPDIM 149

Query: 61  NLSQWCLQHEVACPTLASCLTWNHSFSRF---------------NSISIMYEAHSINAEH 105
           NLSQW LQHE+ C    SCL+WN S SR                N   +    +S N+  
Sbjct: 150 NLSQWSLQHEILCKLPCSCLSWNTSLSRHHPPMLAIGSDDSNRSNGGKVFLYEYSENSRK 209

Query: 106 ----------KDLIHDVAY------DYYGLRMATCSSDQNIKVTRD-----VMGTRFDIE 144
                     +D +HD+++       Y+ L +AT   D  +   R+        +RF+IE
Sbjct: 210 WIKSETLSSVQDPVHDISFAPNMGRSYHMLAVAT--KDVRVFTIRESSSVSSGSSRFEIE 267

Query: 145 TIGNFEDHYCTVWRVSWNITGTIVASSGDDGCVRLWKLKKK 185
           +   FEDHY +VWRV+WNITGT++AS+GDDGCVRLWK   K
Sbjct: 268 SAAQFEDHYSSVWRVTWNITGTVLASTGDDGCVRLWKANYK 308




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|170038326|ref|XP_001847002.1| nucleoporin [Culex quinquefasciatus] gi|167881912|gb|EDS45295.1| nucleoporin [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|307212004|gb|EFN87899.1| Nucleoporin SEH1-like [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|307187571|gb|EFN72583.1| Nucleoporin SEH1-like [Camponotus floridanus] Back     alignment and taxonomy information
>gi|301775003|ref|XP_002922916.1| PREDICTED: centrosomal protein of 192 kDa-like [Ailuropoda melanoleuca] Back     alignment and taxonomy information
>gi|240848713|ref|NP_001155661.1| nucleoporin SEH1-like [Acyrthosiphon pisum] gi|239790508|dbj|BAH71811.1| ACYPI006367 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|157113074|ref|XP_001651880.1| nucleoporin, putative [Aedes aegypti] gi|157113076|ref|XP_001651881.1| nucleoporin, putative [Aedes aegypti] gi|108877883|gb|EAT42108.1| AAEL006311-PA [Aedes aegypti] gi|403182784|gb|EJY57629.1| AAEL006311-PB [Aedes aegypti] Back     alignment and taxonomy information
>gi|334325923|ref|XP_001371539.2| PREDICTED: centrosomal protein of 192 kDa-like [Monodelphis domestica] Back     alignment and taxonomy information
>gi|383852726|ref|XP_003701876.1| PREDICTED: nucleoporin seh1-A-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|332026068|gb|EGI66219.1| Nucleoporin seh1-B [Acromyrmex echinatior] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query197
UNIPROTKB|Q5RAN6360 SEH1L "Nucleoporin SEH1" [Pong 0.477 0.261 0.614 5.9e-44
UNIPROTKB|Q96EE3360 SEH1L "Nucleoporin SEH1" [Homo 0.477 0.261 0.614 7.6e-44
UNIPROTKB|I3LR40324 SEH1L "Uncharacterized protein 0.385 0.234 0.710 7.6e-44
UNIPROTKB|E1BYP7 419 SEH1L "Uncharacterized protein 0.502 0.236 0.584 1.2e-43
UNIPROTKB|A7YY75360 SEH1L "Nucleoporin SEH1" [Bos 0.477 0.261 0.604 1.6e-43
MGI|MGI:1919374360 Seh1l "SEH1-like (S. cerevisia 0.385 0.211 0.697 2.5e-43
UNIPROTKB|Q5U4Y8360 seh1l "Nucleoporin seh1" [Xeno 0.502 0.275 0.584 4.1e-43
UNIPROTKB|Q4FZW5360 seh1l-a "Nucleoporin seh1-A" [ 0.502 0.275 0.584 4.1e-43
UNIPROTKB|Q6GNF1360 seh1l-b "Nucleoporin seh1-B" [ 0.502 0.275 0.584 2.2e-42
ZFIN|ZDB-GENE-030131-6689364 seh1l "SEH1-like (S. cerevisia 0.502 0.271 0.564 5.9e-42
UNIPROTKB|Q5RAN6 SEH1L "Nucleoporin SEH1" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
 Score = 307 (113.1 bits), Expect = 5.9e-44, Sum P(2) = 5.9e-44
 Identities = 59/96 (61%), Positives = 74/96 (77%)

Query:    13 NQWTRRSNLVDSRTSVTDVKFGPKQLGLVLATCAADGLVRIYEAPDVMNLSQWCLQHEVA 72
             + W +R+ LVDSRTSVTDVKF PK +GL+LATC+ADG+VRIYEAPDVMNLSQW LQHE++
Sbjct:   101 SHWVKRTTLVDSRTSVTDVKFAPKHMGLMLATCSADGIVRIYEAPDVMNLSQWSLQHEIS 160

Query:    73 CPTLASCLTWNHSFSRFNS--ISIMYEAHSINAEHK 106
             C    SC++WN S SR +S  I++  +  S NA  K
Sbjct:   161 CKLSCSCISWNPSSSRAHSPMIAVGSDDSSPNAMAK 196


GO:0006999 "nuclear pore organization" evidence=ISS
GO:0007080 "mitotic metaphase plate congression" evidence=ISS
GO:0031080 "nuclear pore outer ring" evidence=ISS
GO:0051315 "attachment of spindle microtubules to kinetochore involved in mitotic sister chromatid segregation" evidence=ISS
GO:0000776 "kinetochore" evidence=ISS
UNIPROTKB|Q96EE3 SEH1L "Nucleoporin SEH1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|I3LR40 SEH1L "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E1BYP7 SEH1L "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|A7YY75 SEH1L "Nucleoporin SEH1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1919374 Seh1l "SEH1-like (S. cerevisiae" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q5U4Y8 seh1l "Nucleoporin seh1" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
UNIPROTKB|Q4FZW5 seh1l-a "Nucleoporin seh1-A" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|Q6GNF1 seh1l-b "Nucleoporin seh1-B" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-6689 seh1l "SEH1-like (S. cerevisiae)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query197
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 5e-09
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 2e-08
cd00200 289 cd00200, WD40, WD40 domain, found in a number of e 3e-08
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 4e-07
cd00200 289 cd00200, WD40, WD40 domain, found in a number of e 8e-06
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 1e-05
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 7e-05
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 1e-04
smart0032040 smart00320, WD40, WD40 repeats 1e-04
COG2319 466 COG2319, COG2319, FOG: WD40 repeat [General functi 0.001
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
 Score = 54.7 bits (130), Expect = 5e-09
 Identities = 42/188 (22%), Positives = 76/188 (40%), Gaps = 17/188 (9%)

Query: 12  LNQWTRRSNLVDSRTSVTDVKFGPKQLGLVLATCAADGLVRIYEAPDVMNLSQWCLQHEV 71
           L      S L      V+ + F P   GL++A+ ++DG +R+++      L      H  
Sbjct: 185 LRTGKPLSTLAGHTDPVSSLAFSPD-GGLLIASGSSDGTIRLWDLSTGKLLRSTLSGHSD 243

Query: 72  ACPTLASCLTWNHSF----SRFNSISI-----MYEAHSINAEHKDLIHDVAYDYYGLRMA 122
           +     S  + + S     S   +I +             + H   +  VA+   G  +A
Sbjct: 244 SV---VSSFSPDGSLLASGSSDGTIRLWDLRSSSSLLRTLSGHSSSVLSVAFSPDGKLLA 300

Query: 123 TCSSDQNIKVTRDVMGTRFDIETIGNFEDHYCTVWRVSWNITGTIVASSG-DDGCVRLWK 181
           + SSD  +++     G      T    + H   V  +S++  G+++ S G DDG +RLW 
Sbjct: 301 SGSSDGTVRLWDLETGKLLSSLT---LKGHEGPVSSLSFSPDGSLLVSGGSDDGTIRLWD 357

Query: 182 LKKKRKKK 189
           L+  +  K
Sbjct: 358 LRTGKPLK 365


Length = 466

>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 197
KOG0272|consensus459 100.0
KOG0272|consensus459 99.97
KOG0271|consensus480 99.97
KOG0263|consensus707 99.97
KOG0271|consensus 480 99.97
KOG0263|consensus707 99.97
KOG0315|consensus311 99.97
KOG0279|consensus315 99.97
KOG0286|consensus 343 99.96
KOG0285|consensus 460 99.96
KOG0273|consensus524 99.95
KOG0645|consensus312 99.95
KOG0284|consensus 464 99.95
KOG0645|consensus 312 99.95
KOG0319|consensus 775 99.94
KOG0295|consensus406 99.94
KOG0279|consensus315 99.94
KOG0266|consensus 456 99.94
KOG0266|consensus456 99.93
KOG0286|consensus343 99.93
KOG0281|consensus499 99.93
KOG0284|consensus 464 99.93
KOG0276|consensus 794 99.93
KOG0275|consensus 508 99.92
KOG0291|consensus 893 99.92
KOG0293|consensus519 99.92
KOG0277|consensus311 99.92
KOG0319|consensus 775 99.92
KOG0315|consensus311 99.92
KOG0282|consensus503 99.92
KOG0292|consensus 1202 99.91
KOG0318|consensus 603 99.91
KOG2445|consensus361 99.91
KOG0276|consensus 794 99.91
KOG0291|consensus 893 99.91
KOG0643|consensus327 99.91
PTZ00420 568 coronin; Provisional 99.91
PTZ00421 493 coronin; Provisional 99.91
KOG0313|consensus423 99.91
KOG0278|consensus334 99.9
KOG0273|consensus 524 99.9
KOG0285|consensus460 99.9
PLN00181793 protein SPA1-RELATED; Provisional 99.9
KOG0640|consensus430 99.9
KOG0281|consensus499 99.9
KOG0283|consensus 712 99.9
KOG0316|consensus307 99.89
KOG0302|consensus440 99.89
KOG0264|consensus422 99.89
KOG0306|consensus 888 99.89
KOG0265|consensus338 99.89
KOG1407|consensus313 99.89
KOG0313|consensus423 99.88
KOG0296|consensus 399 99.88
KOG0289|consensus506 99.88
KOG0318|consensus 603 99.88
KOG0277|consensus311 99.88
PTZ00421 493 coronin; Provisional 99.88
KOG0308|consensus 735 99.88
KOG0282|consensus 503 99.88
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.88
KOG2096|consensus420 99.88
KOG0316|consensus 307 99.88
KOG0292|consensus 1202 99.87
KOG0269|consensus 839 99.87
cd00200 289 WD40 WD40 domain, found in a number of eukaryotic 99.87
KOG0274|consensus 537 99.87
KOG0295|consensus 406 99.87
KOG1446|consensus311 99.87
KOG0264|consensus422 99.87
KOG0308|consensus 735 99.87
KOG0772|consensus 641 99.87
PTZ00420 568 coronin; Provisional 99.86
KOG0296|consensus399 99.86
KOG0310|consensus 487 99.86
KOG0772|consensus 641 99.86
KOG0283|consensus 712 99.86
PLN00181 793 protein SPA1-RELATED; Provisional 99.86
KOG0265|consensus 338 99.86
KOG0289|consensus506 99.86
KOG0275|consensus508 99.85
KOG0267|consensus 825 99.85
KOG0293|consensus 519 99.85
KOG0294|consensus362 99.85
KOG1332|consensus299 99.85
KOG0305|consensus484 99.84
KOG0973|consensus 942 99.84
KOG0268|consensus 433 99.84
KOG0640|consensus 430 99.83
KOG0647|consensus347 99.83
KOG1332|consensus299 99.83
KOG0274|consensus537 99.83
KOG4283|consensus 397 99.83
KOG0288|consensus459 99.83
KOG0639|consensus 705 99.82
KOG0646|consensus 476 99.82
KOG0305|consensus484 99.82
KOG1446|consensus 311 99.82
KOG0268|consensus433 99.82
KOG0973|consensus 942 99.82
KOG0303|consensus 472 99.81
KOG0641|consensus350 99.81
KOG0300|consensus481 99.8
KOG0301|consensus 745 99.8
KOG0310|consensus 487 99.79
KOG1188|consensus 376 99.79
KOG1007|consensus370 99.79
KOG4283|consensus 397 99.79
KOG4378|consensus 673 99.79
KOG0294|consensus 362 99.78
KOG0301|consensus 745 99.78
KOG1407|consensus313 99.77
KOG0269|consensus 839 99.76
KOG0278|consensus 334 99.76
KOG1036|consensus323 99.76
KOG4328|consensus498 99.76
KOG0302|consensus440 99.76
KOG0306|consensus 888 99.76
KOG1539|consensus 910 99.75
KOG0300|consensus481 99.75
KOG0307|consensus 1049 99.75
KOG0299|consensus 479 99.75
KOG0267|consensus 825 99.75
KOG1034|consensus 385 99.75
KOG0650|consensus733 99.74
KOG0639|consensus705 99.74
KOG0270|consensus463 99.74
KOG0641|consensus350 99.73
KOG0647|consensus347 99.73
KOG2445|consensus361 99.73
KOG0270|consensus463 99.73
KOG1408|consensus 1080 99.72
KOG0642|consensus577 99.71
KOG1445|consensus 1012 99.71
KOG1036|consensus 323 99.7
KOG0299|consensus 479 99.7
KOG1273|consensus 405 99.7
KOG1523|consensus 361 99.7
KOG1539|consensus 910 99.69
KOG0643|consensus 327 99.69
KOG2048|consensus 691 99.68
KOG1063|consensus 764 99.67
KOG1408|consensus 1080 99.67
KOG1274|consensus 933 99.66
KOG0307|consensus 1049 99.66
KOG1034|consensus385 99.65
KOG1310|consensus 758 99.65
KOG1009|consensus 434 99.64
KOG2096|consensus420 99.64
KOG2919|consensus406 99.64
KOG1063|consensus 764 99.64
KOG2110|consensus 391 99.63
KOG1524|consensus 737 99.63
KOG2055|consensus514 99.62
KOG1007|consensus370 99.61
KOG2106|consensus626 99.61
KOG0646|consensus 476 99.6
KOG0288|consensus459 99.6
KOG0290|consensus364 99.59
KOG2048|consensus 691 99.59
KOG2055|consensus514 99.58
KOG0649|consensus 325 99.58
KOG0644|consensus 1113 99.58
KOG1274|consensus 933 99.57
KOG0321|consensus 720 99.57
KOG0322|consensus323 99.56
KOG0771|consensus398 99.56
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.55
KOG0321|consensus 720 99.55
KOG4328|consensus 498 99.54
KOG2394|consensus 636 99.54
KOG0771|consensus398 99.53
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.53
KOG2106|consensus 626 99.52
KOG0290|consensus364 99.52
KOG0303|consensus 472 99.51
KOG1273|consensus 405 99.51
KOG2394|consensus 636 99.51
KOG1523|consensus 361 99.5
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.5
KOG1272|consensus 545 99.49
KOG1445|consensus 1012 99.49
KOG1538|consensus 1081 99.47
KOG4378|consensus 673 99.45
KOG4227|consensus 609 99.45
KOG1188|consensus 376 99.45
COG2319 466 FOG: WD40 repeat [General function prediction only 99.44
KOG1587|consensus555 99.44
KOG2111|consensus346 99.42
KOG1009|consensus 434 99.42
KOG0974|consensus 967 99.39
KOG2139|consensus 445 99.38
KOG0649|consensus325 99.37
KOG1963|consensus 792 99.35
KOG1240|consensus 1431 99.33
KOG1517|consensus1387 99.33
COG2319 466 FOG: WD40 repeat [General function prediction only 99.32
KOG1524|consensus 737 99.31
PRK01742429 tolB translocation protein TolB; Provisional 99.3
KOG2919|consensus406 99.29
KOG3881|consensus412 99.28
KOG2110|consensus 391 99.27
KOG0644|consensus 1113 99.24
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 99.24
KOG1538|consensus 1081 99.23
KOG1517|consensus1387 99.22
KOG1587|consensus555 99.21
KOG4497|consensus 447 99.2
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 99.2
KOG2111|consensus346 99.2
KOG0322|consensus323 99.2
PRK11028 330 6-phosphogluconolactonase; Provisional 99.19
KOG0642|consensus 577 99.18
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.15
KOG4547|consensus 541 99.11
PRK05137435 tolB translocation protein TolB; Provisional 99.1
PRK11028330 6-phosphogluconolactonase; Provisional 99.09
KOG0280|consensus339 99.09
KOG3914|consensus 390 99.09
KOG1064|consensus2439 99.07
KOG4190|consensus 1034 99.06
PRK02889427 tolB translocation protein TolB; Provisional 99.06
KOG4227|consensus 609 99.06
PRK04922433 tolB translocation protein TolB; Provisional 99.06
PRK03629429 tolB translocation protein TolB; Provisional 99.05
KOG2139|consensus 445 99.04
KOG1963|consensus 792 99.04
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 99.04
KOG0974|consensus 967 99.02
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.01
KOG1272|consensus 545 99.01
KOG2321|consensus 703 99.0
KOG1334|consensus 559 99.0
KOG1310|consensus 758 98.99
KOG1409|consensus 404 98.98
PRK01742429 tolB translocation protein TolB; Provisional 98.97
KOG1064|consensus2439 98.97
KOG2321|consensus 703 98.96
KOG4714|consensus319 98.95
KOG1240|consensus 1431 98.94
KOG1354|consensus 433 98.89
KOG1409|consensus 404 98.88
KOG1334|consensus559 98.87
PF02239 369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 98.86
PRK03629429 tolB translocation protein TolB; Provisional 98.81
KOG2695|consensus425 98.8
KOG0309|consensus 1081 98.8
KOG0280|consensus339 98.78
PRK00178430 tolB translocation protein TolB; Provisional 98.77
KOG2315|consensus 566 98.76
PRK05137435 tolB translocation protein TolB; Provisional 98.74
PRK04792448 tolB translocation protein TolB; Provisional 98.7
PRK04922433 tolB translocation protein TolB; Provisional 98.69
KOG1354|consensus 433 98.68
KOG3881|consensus412 98.68
PF11768 545 DUF3312: Protein of unknown function (DUF3312); In 98.64
KOG3914|consensus 390 98.62
KOG0882|consensus 558 98.61
KOG4497|consensus447 98.61
KOG4547|consensus 541 98.6
COG5170 460 CDC55 Serine/threonine protein phosphatase 2A, reg 98.57
KOG4532|consensus344 98.57
KOG0650|consensus733 98.56
PRK02889427 tolB translocation protein TolB; Provisional 98.54
PRK01029428 tolB translocation protein TolB; Provisional 98.52
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 98.51
KOG4714|consensus319 98.51
KOG2066|consensus 846 98.5
KOG2041|consensus 1189 98.47
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 98.45
KOG4190|consensus1034 98.43
PRK01029428 tolB translocation protein TolB; Provisional 98.37
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 98.36
COG2706 346 3-carboxymuconate cyclase [Carbohydrate transport 98.35
PF02239 369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 98.33
smart0032040 WD40 WD40 repeats. Note that these repeats are per 98.31
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 98.3
smart0032040 WD40 WD40 repeats. Note that these repeats are per 98.27
KOG2041|consensus 1189 98.23
PF11768 545 DUF3312: Protein of unknown function (DUF3312); In 98.2
PRK00178430 tolB translocation protein TolB; Provisional 98.19
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 98.19
KOG0309|consensus 1081 98.14
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 98.07
COG4946 668 Uncharacterized protein related to the periplasmic 98.07
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 98.07
KOG2695|consensus425 98.0
PRK04792448 tolB translocation protein TolB; Provisional 97.98
KOG1275|consensus 1118 97.97
PRK04043419 tolB translocation protein TolB; Provisional 97.96
KOG1832|consensus 1516 97.95
KOG1645|consensus 463 97.93
KOG3617|consensus 1416 97.93
KOG1008|consensus 783 97.91
COG4946 668 Uncharacterized protein related to the periplasmic 97.91
KOG4532|consensus344 97.91
KOG2315|consensus 566 97.89
COG5170 460 CDC55 Serine/threonine protein phosphatase 2A, reg 97.86
KOG4640|consensus 665 97.83
KOG1912|consensus 1062 97.76
KOG3621|consensus 726 97.73
KOG1645|consensus 463 97.72
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 97.69
KOG1912|consensus 1062 97.65
PF04053 443 Coatomer_WDAD: Coatomer WD associated region ; Int 97.65
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 97.6
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 97.6
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 97.59
KOG1920|consensus 1265 97.43
KOG1008|consensus 783 97.4
COG5354 561 Uncharacterized protein, contains Trp-Asp (WD) rep 97.38
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 97.33
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 97.29
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 97.26
KOG1275|consensus 1118 97.25
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 97.25
KOG4640|consensus 665 97.25
KOG2314|consensus 698 97.25
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 97.24
TIGR02658 352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 97.22
KOG2314|consensus 698 97.17
PF08553 794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 97.13
KOG4649|consensus 354 97.12
KOG2114|consensus 933 97.09
KOG1920|consensus 1265 97.08
COG5354 561 Uncharacterized protein, contains Trp-Asp (WD) rep 97.08
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 97.06
PF08596 395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 96.88
KOG2444|consensus238 96.87
PRK04043419 tolB translocation protein TolB; Provisional 96.85
PF04841 410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 96.75
KOG3617|consensus 1416 96.67
KOG0882|consensus 558 96.64
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 96.55
KOG2114|consensus 933 96.54
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 96.53
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 96.53
PF12234 631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 96.19
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 96.12
TIGR03300 377 assembly_YfgL outer membrane assembly lipoprotein 96.06
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 96.04
KOG2066|consensus 846 96.02
KOG2395|consensus 644 95.96
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 95.81
PF00930 353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 95.71
PRK02888 635 nitrous-oxide reductase; Validated 95.7
PF03178 321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 95.7
KOG3621|consensus 726 95.61
KOG2079|consensus 1206 95.5
PF07569 219 Hira: TUP1-like enhancer of split; InterPro: IPR01 95.36
KOG2079|consensus 1206 95.36
COG0823425 TolB Periplasmic component of the Tol biopolymer t 95.34
PRK02888 635 nitrous-oxide reductase; Validated 95.07
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 94.8
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 94.72
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 94.71
PHA02713557 hypothetical protein; Provisional 94.63
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 94.52
KOG4499|consensus310 94.39
PF05694 461 SBP56: 56kDa selenium binding protein (SBP56); Int 94.01
KOG1916|consensus 1283 93.96
PRK13616 591 lipoprotein LpqB; Provisional 93.88
KOG1832|consensus 1516 93.83
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 93.11
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 92.77
PF15390 671 DUF4613: Domain of unknown function (DUF4613) 92.72
PF11715 547 Nup160: Nucleoporin Nup120/160; InterPro: IPR02171 92.51
PF10168 717 Nup88: Nuclear pore component; InterPro: IPR019321 92.44
PF12657173 TFIIIC_delta: Transcription factor IIIC subunit de 92.4
PF0767639 PD40: WD40-like Beta Propeller Repeat; InterPro: I 92.3
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 92.04
PF04053 443 Coatomer_WDAD: Coatomer WD associated region ; Int 92.0
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 91.67
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 91.65
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 91.48
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 91.39
PF15390 671 DUF4613: Domain of unknown function (DUF4613) 91.29
KOG2377|consensus 657 91.06
PF14727 418 PHTB1_N: PTHB1 N-terminus 91.04
COG5167 776 VID27 Protein involved in vacuole import and degra 90.26
COG3204316 Uncharacterized protein conserved in bacteria [Fun 90.14
PF08728 717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 89.4
PF02897 414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 89.16
KOG4649|consensus 354 88.72
KOG3630|consensus 1405 88.59
COG0823425 TolB Periplasmic component of the Tol biopolymer t 88.14
PF11715 547 Nup160: Nucleoporin Nup120/160; InterPro: IPR02171 88.11
KOG1897|consensus 1096 87.44
PHA03098534 kelch-like protein; Provisional 87.27
PF07569219 Hira: TUP1-like enhancer of split; InterPro: IPR01 87.13
KOG4460|consensus 741 86.99
PF10168 717 Nup88: Nuclear pore component; InterPro: IPR019321 86.83
KOG4441|consensus571 86.73
PHA02713557 hypothetical protein; Provisional 86.43
PF08728 717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 86.02
COG3386307 Gluconolactonase [Carbohydrate transport and metab 85.94
PF12234 631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 85.05
KOG2280|consensus 829 84.55
KOG1916|consensus 1283 84.55
PF0143628 NHL: NHL repeat; InterPro: IPR001258 The NHL repea 84.3
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 84.23
KOG4499|consensus310 83.72
PRK13616591 lipoprotein LpqB; Provisional 83.31
PF06433 342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 83.03
PF14761 215 HPS3_N: Hermansky-Pudlak syndrome 3 82.8
TIGR0227642 beta_rpt_yvtn 40-residue YVTN family beta-propelle 82.46
PF07995 331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 82.1
TIGR03606 454 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH 81.04
KOG2444|consensus238 80.7
PF1234127 DUF3639: Protein of unknown function (DUF3639) ; I 80.51
PF00780 275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 80.25
PF0173186 Arylesterase: Arylesterase; InterPro: IPR002640 Th 80.16
KOG4441|consensus571 80.02
>KOG0272|consensus Back     alignment and domain information
Probab=100.00  E-value=1.6e-32  Score=197.64  Aligned_cols=179  Identities=20%  Similarity=0.236  Sum_probs=158.5

Q ss_pred             Ccccccccceeeeee-----eecCCCcceeEEEECCCCCCcEEEEEeCCCcEEEEEcCCcccccceeccceeccCCCeee
Q psy13207          5 PLQSEKCLNQWTRRS-----NLVDSRTSVTDVKFGPKQLGLVLATCAADGLVRIYEAPDVMNLSQWCLQHEVACPTLASC   79 (197)
Q Consensus         5 ~~~~~~~~~~w~~~~-----~~~~h~~~v~~~~~~~~~~~~~l~s~~~dg~v~iw~~~~~~~~~~~~~~~~~~~~~~~~~   79 (197)
                      +...|+++++|+...     .|.+|...|..++|+|+  |++|+|+|.|.+-++||+.++..+.     ..--+...|.+
T Consensus       236 t~s~Dgtvklw~~~~e~~l~~l~gH~~RVs~VafHPs--G~~L~TasfD~tWRlWD~~tk~ElL-----~QEGHs~~v~~  308 (459)
T KOG0272|consen  236 TASADGTVKLWKLSQETPLQDLEGHLARVSRVAFHPS--GKFLGTASFDSTWRLWDLETKSELL-----LQEGHSKGVFS  308 (459)
T ss_pred             eeccCCceeeeccCCCcchhhhhcchhhheeeeecCC--CceeeecccccchhhcccccchhhH-----hhcccccccce
Confidence            457899999999875     48899999999999999  9999999999999999999876442     22223789999


Q ss_pred             EEEccCCCcccce-----eEEEE------eeEecccCCCceeEEEEcCCCeEEEEeeCCCeEEEEEccCCcccceeeeee
Q psy13207         80 LTWNHSFSRFNSI-----SIMYE------AHSINAEHKDLIHDVAYDYYGLRMATCSSDQNIKVTRDVMGTRFDIETIGN  148 (197)
Q Consensus        80 ~~~~~~~~~~~~~-----~~~~~------~~~~~~~~~~~i~~~~~~~~~~~~~s~~~d~~i~~~d~~~~~~~~~~~~~~  148 (197)
                      ++|.++|..++++     -++||      +-.+. +|..+|.+++|+|+...++||+.|++++|||++.     ...+..
T Consensus       309 iaf~~DGSL~~tGGlD~~~RvWDlRtgr~im~L~-gH~k~I~~V~fsPNGy~lATgs~Dnt~kVWDLR~-----r~~ly~  382 (459)
T KOG0272|consen  309 IAFQPDGSLAATGGLDSLGRVWDLRTGRCIMFLA-GHIKEILSVAFSPNGYHLATGSSDNTCKVWDLRM-----RSELYT  382 (459)
T ss_pred             eEecCCCceeeccCccchhheeecccCcEEEEec-ccccceeeEeECCCceEEeecCCCCcEEEeeecc-----ccccee
Confidence            9999999998877     59999      55667 8999999999998888889999999999999986     567889


Q ss_pred             ecCceecEEEEEEcc-CCCEEEEEeCCCcEEEEEcCCCcchhhhhhhhh
Q psy13207        149 FEDHYCTVWRVSWNI-TGTIVASSGDDGCVRLWKLKKKRKKKKEEEEEE  196 (197)
Q Consensus       149 ~~~h~~~v~~~~~~p-~~~~l~~~~~dg~i~iw~~~~~~~~~~~~~~~e  196 (197)
                      +.+|.+-|+.+.|+| .|.+|+|++.|++++||..++..+.+.+..||+
T Consensus       383 ipAH~nlVS~Vk~~p~~g~fL~TasyD~t~kiWs~~~~~~~ksLaGHe~  431 (459)
T KOG0272|consen  383 IPAHSNLVSQVKYSPQEGYFLVTASYDNTVKIWSTRTWSPLKSLAGHEG  431 (459)
T ss_pred             cccccchhhheEecccCCeEEEEcccCcceeeecCCCcccchhhcCCcc
Confidence            999999999999999 689999999999999999999888888888875



>KOG0272|consensus Back     alignment and domain information
>KOG0271|consensus Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>KOG0271|consensus Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>KOG0295|consensus Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>KOG0275|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>KOG0277|consensus Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>KOG0292|consensus Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>KOG2445|consensus Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>KOG0643|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0313|consensus Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0640|consensus Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>KOG0283|consensus Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>KOG0302|consensus Back     alignment and domain information
>KOG0264|consensus Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>KOG0313|consensus Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>KOG0277|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0308|consensus Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG2096|consensus Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>KOG0292|consensus Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>KOG0295|consensus Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>KOG0264|consensus Back     alignment and domain information
>KOG0308|consensus Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>KOG0283|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>KOG0275|consensus Back     alignment and domain information
>KOG0267|consensus Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>KOG1332|consensus Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>KOG0640|consensus Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>KOG1332|consensus Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>KOG4283|consensus Back     alignment and domain information
>KOG0288|consensus Back     alignment and domain information
>KOG0639|consensus Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information
>KOG0641|consensus Back     alignment and domain information
>KOG0300|consensus Back     alignment and domain information
>KOG0301|consensus Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>KOG1188|consensus Back     alignment and domain information
>KOG1007|consensus Back     alignment and domain information
>KOG4283|consensus Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>KOG0301|consensus Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>KOG4328|consensus Back     alignment and domain information
>KOG0302|consensus Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>KOG0300|consensus Back     alignment and domain information
>KOG0307|consensus Back     alignment and domain information
>KOG0299|consensus Back     alignment and domain information
>KOG0267|consensus Back     alignment and domain information
>KOG1034|consensus Back     alignment and domain information
>KOG0650|consensus Back     alignment and domain information
>KOG0639|consensus Back     alignment and domain information
>KOG0270|consensus Back     alignment and domain information
>KOG0641|consensus Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>KOG2445|consensus Back     alignment and domain information
>KOG0270|consensus Back     alignment and domain information
>KOG1408|consensus Back     alignment and domain information
>KOG0642|consensus Back     alignment and domain information
>KOG1445|consensus Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>KOG0299|consensus Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>KOG1523|consensus Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>KOG0643|consensus Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>KOG1063|consensus Back     alignment and domain information
>KOG1408|consensus Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>KOG0307|consensus Back     alignment and domain information
>KOG1034|consensus Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>KOG1009|consensus Back     alignment and domain information
>KOG2096|consensus Back     alignment and domain information
>KOG2919|consensus Back     alignment and domain information
>KOG1063|consensus Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>KOG1524|consensus Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>KOG1007|consensus Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>KOG0288|consensus Back     alignment and domain information
>KOG0290|consensus Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>KOG0644|consensus Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>KOG0321|consensus Back     alignment and domain information
>KOG0322|consensus Back     alignment and domain information
>KOG0771|consensus Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG0321|consensus Back     alignment and domain information
>KOG4328|consensus Back     alignment and domain information
>KOG2394|consensus Back     alignment and domain information
>KOG0771|consensus Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>KOG0290|consensus Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>KOG2394|consensus Back     alignment and domain information
>KOG1523|consensus Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG1272|consensus Back     alignment and domain information
>KOG1445|consensus Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>KOG4227|consensus Back     alignment and domain information
>KOG1188|consensus Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG1587|consensus Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>KOG1009|consensus Back     alignment and domain information
>KOG0974|consensus Back     alignment and domain information
>KOG2139|consensus Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>KOG1963|consensus Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG1524|consensus Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2919|consensus Back     alignment and domain information
>KOG3881|consensus Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>KOG0644|consensus Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>KOG1587|consensus Back     alignment and domain information
>KOG4497|consensus Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>KOG0322|consensus Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG0642|consensus Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG4547|consensus Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG0280|consensus Back     alignment and domain information
>KOG3914|consensus Back     alignment and domain information
>KOG1064|consensus Back     alignment and domain information
>KOG4190|consensus Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4227|consensus Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2139|consensus Back     alignment and domain information
>KOG1963|consensus Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG0974|consensus Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG1272|consensus Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>KOG1334|consensus Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>KOG1409|consensus Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1064|consensus Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>KOG4714|consensus Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>KOG1354|consensus Back     alignment and domain information
>KOG1409|consensus Back     alignment and domain information
>KOG1334|consensus Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2695|consensus Back     alignment and domain information
>KOG0309|consensus Back     alignment and domain information
>KOG0280|consensus Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2315|consensus Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1354|consensus Back     alignment and domain information
>KOG3881|consensus Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>KOG3914|consensus Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>KOG4497|consensus Back     alignment and domain information
>KOG4547|consensus Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG4532|consensus Back     alignment and domain information
>KOG0650|consensus Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG4714|consensus Back     alignment and domain information
>KOG2066|consensus Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG4190|consensus Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>KOG0309|consensus Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2695|consensus Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1275|consensus Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1832|consensus Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>KOG1008|consensus Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG4532|consensus Back     alignment and domain information
>KOG2315|consensus Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG4640|consensus Back     alignment and domain information
>KOG1912|consensus Back     alignment and domain information
>KOG3621|consensus Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG1912|consensus Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG1920|consensus Back     alignment and domain information
>KOG1008|consensus Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG1275|consensus Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>KOG4640|consensus Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>KOG4649|consensus Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>KOG1920|consensus Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>KOG2444|consensus Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG2066|consensus Back     alignment and domain information
>KOG2395|consensus Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>KOG3621|consensus Back     alignment and domain information
>KOG2079|consensus Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>KOG2079|consensus Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>KOG1916|consensus Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>KOG1832|consensus Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>PF11715 Nup160: Nucleoporin Nup120/160; InterPro: IPR021717 Nup120 is conserved from fungi to plants to humans, and is homologous with the Nup160 of vertebrates Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>PF12657 TFIIIC_delta: Transcription factor IIIC subunit delta N-term; InterPro: IPR024761 This entry represents a domain found towards the N terminus of the 90 kDa subunit of transcription factor IIIC (also known as subunit 9 in yeast []) Back     alignment and domain information
>PF07676 PD40: WD40-like Beta Propeller Repeat; InterPro: IPR011659 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>KOG2377|consensus Back     alignment and domain information
>PF14727 PHTB1_N: PTHB1 N-terminus Back     alignment and domain information
>COG5167 VID27 Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG4649|consensus Back     alignment and domain information
>KOG3630|consensus Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PF11715 Nup160: Nucleoporin Nup120/160; InterPro: IPR021717 Nup120 is conserved from fungi to plants to humans, and is homologous with the Nup160 of vertebrates Back     alignment and domain information
>KOG1897|consensus Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>KOG4460|consensus Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>KOG4441|consensus Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>KOG2280|consensus Back     alignment and domain information
>KOG1916|consensus Back     alignment and domain information
>PF01436 NHL: NHL repeat; InterPro: IPR001258 The NHL repeat, named after NCL-1, HT2A and Lin-41, is found largely in a large number of eukaryotic and prokaryotic proteins Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PF14761 HPS3_N: Hermansky-Pudlak syndrome 3 Back     alignment and domain information
>TIGR02276 beta_rpt_yvtn 40-residue YVTN family beta-propeller repeat Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family Back     alignment and domain information
>KOG2444|consensus Back     alignment and domain information
>PF12341 DUF3639: Protein of unknown function (DUF3639) ; InterPro: IPR022100 This domain family is found in eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>PF01731 Arylesterase: Arylesterase; InterPro: IPR002640 The serum paraoxonases/arylesterases are enzymes that catalyse the hydrolysis of the toxic metabolites of a variety of organophosphorus insecticides Back     alignment and domain information
>KOG4441|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query197
3f3f_A351 Crystal Structure Of The Nucleoporin Pair Nup85-Seh 8e-16
3f3f_A 351 Crystal Structure Of The Nucleoporin Pair Nup85-Seh 9e-09
3ewe_A349 Crystal Structure Of The Nup85SEH1 COMPLEX Length = 8e-16
3ewe_A 349 Crystal Structure Of The Nup85SEH1 COMPLEX Length = 1e-08
3f3p_A351 Crystal Structure Of The Nucleoporin Pair Nup85-Seh 1e-15
3f3p_A 351 Crystal Structure Of The Nucleoporin Pair Nup85-Seh 1e-08
3jro_A 753 Nup84-Nup145c-Sec13 Edge Element Of The Npc Lattice 2e-10
2pm9_B 297 Crystal Structure Of Yeast Sec1331 VERTEX ELEMENT O 2e-10
3jrp_A 379 Sec13 With Nup145c (Aa109-179) Insertion Blade Leng 3e-10
2pm6_B 297 Crystal Structure Of Yeast Sec1331 EDGE ELEMENT OF 4e-10
2pm7_B 297 Crystal Structure Of Yeast Sec1331 EDGE ELEMENT OF 3e-09
3bg0_A 316 Architecture Of A Coat For The Nuclear Pore Membran 3e-09
1nr0_A 611 Two Seven-Bladed Beta-Propeller Domains Revealed By 1e-04
>pdb|3F3F|A Chain A, Crystal Structure Of The Nucleoporin Pair Nup85-Seh1, Space Group P21 Length = 351 Back     alignment and structure

Iteration: 1

Score = 80.1 bits (196), Expect = 8e-16, Method: Compositional matrix adjust. Identities = 68/246 (27%), Positives = 101/246 (41%), Gaps = 72/246 (29%) Query: 5 PLQSEKCLNQWTRRSNLVDSRTSVTDVKFGPKQLGLVLATCAADGLVRIYEAPDVMNLSQ 64 P Q E +W + L DS+ S+ VKF P LGL LA DG++R+Y+A + +L Sbjct: 90 PDQEECSGRRWNKLCTLNDSKGSLYSVKFAPAHLGLKLACLGNDGILRLYDALEPSDLRS 149 Query: 65 WCLQHEVACPTLAS--------CLTWNHSFSRFN---------SISIMYEAHS-----IN 102 W L E+ ++ CL+W SRF+ +I+Y+ + Sbjct: 150 WTLTSEMKVLSIPPANHLQSDFCLSW--CPSRFSPEKLAVSALEQAIIYQRGKDGKLHVA 207 Query: 103 AE---HKDLIHDVAY-----DYYGLRMATCSS---------------------------D 127 A+ HK LI +++ +Y L C D Sbjct: 208 AKLPGHKSLIRSISWAPSIGRWYQLIATGCKDGRIRIFKITEKLSPLASEESLTNSNMFD 267 Query: 128 QNIKVTRDVMG-------------TRFDIETIGNFEDHYCTVWRVSWNITGTIVASSGDD 174 + V D G + +E + +DH VW VSWN+TGTI++S+GDD Sbjct: 268 NSADVDMDAQGRSDSNTEEKAELQSNLQVELLSEHDDHNGEVWSVSWNLTGTILSSAGDD 327 Query: 175 GCVRLW 180 G VRLW Sbjct: 328 GKVRLW 333
>pdb|3F3F|A Chain A, Crystal Structure Of The Nucleoporin Pair Nup85-Seh1, Space Group P21 Length = 351 Back     alignment and structure
>pdb|3EWE|A Chain A, Crystal Structure Of The Nup85SEH1 COMPLEX Length = 349 Back     alignment and structure
>pdb|3EWE|A Chain A, Crystal Structure Of The Nup85SEH1 COMPLEX Length = 349 Back     alignment and structure
>pdb|3F3P|A Chain A, Crystal Structure Of The Nucleoporin Pair Nup85-Seh1, Space Group P21212 Length = 351 Back     alignment and structure
>pdb|3F3P|A Chain A, Crystal Structure Of The Nucleoporin Pair Nup85-Seh1, Space Group P21212 Length = 351 Back     alignment and structure
>pdb|3JRO|A Chain A, Nup84-Nup145c-Sec13 Edge Element Of The Npc Lattice Length = 753 Back     alignment and structure
>pdb|2PM9|B Chain B, Crystal Structure Of Yeast Sec1331 VERTEX ELEMENT OF THE Copii Vesicular Coat Length = 297 Back     alignment and structure
>pdb|3JRP|A Chain A, Sec13 With Nup145c (Aa109-179) Insertion Blade Length = 379 Back     alignment and structure
>pdb|2PM6|B Chain B, Crystal Structure Of Yeast Sec1331 EDGE ELEMENT OF THE Copii Vesicular Coat, Native Version Length = 297 Back     alignment and structure
>pdb|2PM7|B Chain B, Crystal Structure Of Yeast Sec1331 EDGE ELEMENT OF THE Copii Vesicular Coat, Selenomethionine Version Length = 297 Back     alignment and structure
>pdb|3BG0|A Chain A, Architecture Of A Coat For The Nuclear Pore Membrane Length = 316 Back     alignment and structure
>pdb|1NR0|A Chain A, Two Seven-Bladed Beta-Propeller Domains Revealed By The Structure Of A C. Elegans Homologue Of Yeast Actin Interacting Protein 1 (Aip1). Length = 611 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query197
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 99.97
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 99.97
3ow8_A321 WD repeat-containing protein 61; structural genomi 99.97
3ow8_A321 WD repeat-containing protein 61; structural genomi 99.97
2ynn_A 304 Coatomer subunit beta'; protein transport, peptide 99.97
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 99.97
3fm0_A 345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 99.97
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 99.96
4g56_B357 MGC81050 protein; protein arginine methyltransfera 99.96
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 99.96
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 99.96
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 99.96
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 99.96
2pm7_B297 Protein transport protein SEC13, protein transport 99.96
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 99.96
1got_B 340 GT-beta; complex (GTP-binding/transducer), G prote 99.96
4ery_A 312 WD repeat-containing protein 5; WD40, WIN motif, b 99.96
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.96
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 99.96
2pm7_B297 Protein transport protein SEC13, protein transport 99.96
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 99.96
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 99.96
3fm0_A 345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 99.96
2pbi_B 354 Guanine nucleotide-binding protein subunit beta 5; 99.96
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 99.96
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 99.96
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 99.96
4e54_B435 DNA damage-binding protein 2; beta barrel, double 99.96
4g56_B357 MGC81050 protein; protein arginine methyltransfera 99.95
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 99.95
3frx_A 319 Guanine nucleotide-binding protein subunit beta- l 99.95
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 99.95
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 99.95
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.95
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 99.95
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.95
2ymu_A577 WD-40 repeat protein; unknown function, two domain 99.95
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.95
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 99.95
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 99.95
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 99.94
3jrp_A 379 Fusion protein of protein transport protein SEC13 99.94
1k8k_C 372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 99.94
2ymu_A577 WD-40 repeat protein; unknown function, two domain 99.94
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.94
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 99.94
3jrp_A379 Fusion protein of protein transport protein SEC13 99.94
2xzm_R 343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 99.94
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 99.94
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 99.94
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.93
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 99.93
3dw8_B 447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.93
4e54_B 435 DNA damage-binding protein 2; beta barrel, double 99.93
2j04_B 524 YDR362CP, TAU91; beta propeller, type 2 promoters, 99.93
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 99.93
3v7d_B 464 Cell division control protein 4; WD 40 domain, pho 99.93
3gre_A 437 Serine/threonine-protein kinase VPS15; seven-blade 99.93
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 99.93
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 99.93
3dm0_A 694 Maltose-binding periplasmic protein fused with RAC 99.93
3k26_A 366 Polycomb protein EED; WD40, structural genomics, N 99.93
3dw8_B 447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.93
3zwl_B 369 Eukaryotic translation initiation factor 3 subuni; 99.93
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 99.93
1gxr_A 337 ESG1, transducin-like enhancer protein 1; transcri 99.93
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.93
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 99.93
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 99.93
3ei3_B 383 DNA damage-binding protein 2; UV-damage, DDB, nucl 99.93
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.92
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 99.92
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.92
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 99.92
3gre_A 437 Serine/threonine-protein kinase VPS15; seven-blade 99.92
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 99.92
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.92
3jro_A 753 Fusion protein of protein transport protein SEC13 99.92
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.92
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 99.92
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.92
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.92
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 99.92
2pm9_A 416 Protein WEB1, protein transport protein SEC31; bet 99.92
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 99.92
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 99.92
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 99.92
2vdu_B 450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.92
4a11_B 408 DNA excision repair protein ERCC-8; DNA binding pr 99.91
3jro_A 753 Fusion protein of protein transport protein SEC13 99.91
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 99.91
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 99.91
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.91
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 99.91
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 99.91
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 99.91
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.91
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.91
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.9
3odt_A 313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.9
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 99.9
4a11_B 408 DNA excision repair protein ERCC-8; DNA binding pr 99.9
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.9
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 99.9
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.9
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.9
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 99.9
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.89
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 99.89
2ovr_B 445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 99.89
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 99.89
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.89
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.88
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.88
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.88
1yfq_A 342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.88
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 99.88
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 99.88
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.87
4ggc_A 318 P55CDC, cell division cycle protein 20 homolog; ce 99.86
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.86
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.83
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.81
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.78
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.78
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.77
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.76
3bws_A 433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.76
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.74
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.73
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.71
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 99.64
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.62
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.6
1ri6_A 343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.6
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.57
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.53
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.53
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.52
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.52
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 99.51
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.5
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.5
3u4y_A 331 Uncharacterized protein; structural genomics, PSI- 99.49
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.49
3vgz_A 353 Uncharacterized protein YNCE; beta-propeller, prot 99.49
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.48
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.48
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.47
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.46
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 99.45
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.43
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.43
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.4
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.39
1xip_A 388 Nucleoporin NUP159; beta-propeller, transport prot 99.37
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.36
1pby_B 337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.35
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.34
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.34
1jmx_B 349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.33
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 99.29
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.26
1jof_A 365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.23
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.23
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.22
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.18
3pe7_A 388 Oligogalacturonate lyase; seven-bladed beta-propel 99.17
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.15
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.15
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.14
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.14
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.14
2dg1_A 333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.07
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.0
3pe7_A 388 Oligogalacturonate lyase; seven-bladed beta-propel 98.99
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 98.98
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 98.91
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 98.9
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 98.89
3c5m_A 396 Oligogalacturonate lyase; blade-shaped beta-propel 98.87
3no2_A 276 Uncharacterized protein; six-bladed beta-propeller 98.87
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 98.87
1xip_A 388 Nucleoporin NUP159; beta-propeller, transport prot 98.84
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 98.83
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 98.81
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 98.81
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 98.78
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 98.77
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 98.76
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 98.7
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 98.69
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 98.66
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 98.66
2gop_A 347 Trilobed protease; beta propeller, open velcro, hy 98.66
2z2n_A 299 Virginiamycin B lyase; seven-bladed beta-propeller 98.63
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 98.57
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 98.57
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 98.49
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 98.44
3dsm_A 328 Uncharacterized protein bacuni_02894; seven_blated 98.43
2ghs_A 326 AGR_C_1268P; regucalcin, structural genomics, join 98.4
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 98.36
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 98.35
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 98.35
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 98.35
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 98.33
2qc5_A 300 Streptogramin B lactonase; beta propeller, lyase; 98.31
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 98.31
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 98.25
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 98.23
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 98.2
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.2
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 98.2
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 98.14
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.13
2qe8_A 343 Uncharacterized protein; structural genomics, join 98.13
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 98.12
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 98.05
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 98.04
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 97.94
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.84
2qe8_A343 Uncharacterized protein; structural genomics, join 97.84
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 97.82
3sjl_D 386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 97.82
3sjl_D 386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 97.75
2ece_A462 462AA long hypothetical selenium-binding protein; 97.69
2mad_H 373 Methylamine dehydrogenase (heavy subunit); oxidore 97.63
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 97.42
2ece_A462 462AA long hypothetical selenium-binding protein; 97.3
3c75_H 426 MADH, methylamine dehydrogenase heavy chain; coppe 97.28
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 97.24
3tc9_A 430 Hypothetical hydrolase; 6-bladed beta-propeller, i 97.2
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 96.96
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 96.88
1mda_H 368 Methylamine dehydrogenase (heavy subunit); electro 96.78
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 96.64
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 96.59
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 96.52
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 96.48
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 96.46
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 96.42
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 96.38
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 96.38
2fp8_A322 Strictosidine synthase; six bladed beta propeller 96.34
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 96.14
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 96.03
3q7m_A 376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 95.96
2fp8_A322 Strictosidine synthase; six bladed beta propeller 95.86
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 95.71
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 95.66
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 95.59
4hw6_A 433 Hypothetical protein, IPT/TIG domain protein; puta 95.58
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 95.58
3pbp_A 452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 95.55
4a2l_A 795 BT_4663, two-component system sensor histidine kin 95.42
2p9w_A 334 MAL S 1 allergenic protein; beta propeller; 1.35A 95.35
3kya_A 496 Putative phosphatase; structural genomics, joint c 95.32
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 95.32
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 94.97
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 94.33
3v64_C 349 Agrin; beta propeller, laminin-G, signaling, prote 93.27
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 93.11
4a2l_A 795 BT_4663, two-component system sensor histidine kin 93.01
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 93.01
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 92.81
3v65_B386 Low-density lipoprotein receptor-related protein; 92.81
3v9f_A 781 Two-component system sensor histidine kinase/RESP 92.64
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 92.13
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 91.9
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 91.75
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 91.37
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 91.29
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 91.21
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 91.17
3sov_A 318 LRP-6, low-density lipoprotein receptor-related pr 90.89
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 90.66
1cru_A 454 Protein (soluble quinoprotein glucose dehydrogena; 89.95
2ism_A 352 Putative oxidoreductase; BL41XU spring-8, bladed b 89.76
3kya_A496 Putative phosphatase; structural genomics, joint c 89.15
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 88.27
1ijq_A 316 LDL receptor, low-density lipoprotein receptor; be 88.06
3v65_B386 Low-density lipoprotein receptor-related protein; 87.79
4gq2_M 950 Nucleoporin NUP120; beta propeller alpha helical, 87.57
2p4o_A 306 Hypothetical protein; putative lactonase, structur 87.5
3das_A 347 Putative oxidoreductase; aldose sugar dehydrogenas 87.45
4gq2_M 950 Nucleoporin NUP120; beta propeller alpha helical, 86.88
2p4o_A306 Hypothetical protein; putative lactonase, structur 86.83
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 86.82
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 86.78
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 85.78
3v9f_A 781 Two-component system sensor histidine kinase/RESP 84.66
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 83.64
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 83.48
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 83.23
3pbp_A 452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 83.11
4fhn_B 1139 Nucleoporin NUP120; protein complex,structural pro 82.75
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 82.72
3amr_A 355 3-phytase; beta-propeller, phytate, MYO-inositol h 82.49
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 82.47
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 82.24
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 82.05
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 80.01
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
Probab=99.97  E-value=1.3e-29  Score=186.79  Aligned_cols=173  Identities=16%  Similarity=0.238  Sum_probs=147.6

Q ss_pred             cccccccceeeee----------eeecCCCcceeEEEECCCCCCcEEEEEeCCCcEEEEEcCCcccccceeccceeccCC
Q psy13207          6 LQSEKCLNQWTRR----------SNLVDSRTSVTDVKFGPKQLGLVLATCAADGLVRIYEAPDVMNLSQWCLQHEVACPT   75 (197)
Q Consensus         6 ~~~~~~~~~w~~~----------~~~~~h~~~v~~~~~~~~~~~~~l~s~~~dg~v~iw~~~~~~~~~~~~~~~~~~~~~   75 (197)
                      +..|+++++|++.          ..+.+|...|.+++|+|+  +.+|++|+.|++|++||+.+++.+..+.     .+..
T Consensus        36 ~s~D~~v~~W~~~~~~~~~~~~~~~~~~h~~~v~~~~~s~d--g~~l~s~s~D~~v~~wd~~~~~~~~~~~-----~h~~  108 (319)
T 3frx_A           36 ASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCTLTAD--GAYALSASWDKTLRLWDVATGETYQRFV-----GHKS  108 (319)
T ss_dssp             EETTSEEEEEEEEEETTEEEEEEEEEECCSSCEEEEEECTT--SSEEEEEETTSEEEEEETTTTEEEEEEE-----CCSS
T ss_pred             ecCCccEEEecCCCCCccccccceEEeCCcccEEEEEECCC--CCEEEEEeCCCEEEEEECCCCCeeEEEc-----cCCC
Confidence            4678999999864          357899999999999999  9999999999999999999876543322     2367


Q ss_pred             CeeeEEEccCCCcccce-----eEEEE-----eeEecccCCCceeEEEEcCC------CeEEEEeeCCCeEEEEEccCCc
Q psy13207         76 LASCLTWNHSFSRFNSI-----SIMYE-----AHSINAEHKDLIHDVAYDYY------GLRMATCSSDQNIKVTRDVMGT  139 (197)
Q Consensus        76 ~~~~~~~~~~~~~~~~~-----~~~~~-----~~~~~~~~~~~i~~~~~~~~------~~~~~s~~~d~~i~~~d~~~~~  139 (197)
                      .|.+++|+|++..++++     +++|+     +..+. +|...|.+++|++.      ...+++++.|+.|++||+++  
T Consensus       109 ~v~~~~~~~~~~~l~s~s~D~~i~vwd~~~~~~~~~~-~h~~~v~~~~~~~~~~~~~~~~~l~s~~~d~~i~~wd~~~--  185 (319)
T 3frx_A          109 DVMSVDIDKKASMIISGSRDKTIKVWTIKGQCLATLL-GHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQ--  185 (319)
T ss_dssp             CEEEEEECTTSCEEEEEETTSCEEEEETTSCEEEEEC-CCSSCEEEEEECCC------CCEEEEEETTSCEEEEETTT--
T ss_pred             cEEEEEEcCCCCEEEEEeCCCeEEEEECCCCeEEEEe-ccCCcEEEEEEccCCCCCCCccEEEEEeCCCEEEEEECCc--
Confidence            89999999999998776     89999     56677 89999999999842      23459999999999999976  


Q ss_pred             ccceeeeeeecCceecEEEEEEccCCCEEEEEeCCCcEEEEEcCCCcchhhh
Q psy13207        140 RFDIETIGNFEDHYCTVWRVSWNITGTIVASSGDDGCVRLWKLKKKRKKKKE  191 (197)
Q Consensus       140 ~~~~~~~~~~~~h~~~v~~~~~~p~~~~l~~~~~dg~i~iw~~~~~~~~~~~  191 (197)
                         ......+.+|...|.+++|+|+|++|++++.||+|++||+++.+....+
T Consensus       186 ---~~~~~~~~~h~~~v~~~~~sp~g~~l~s~~~dg~i~iwd~~~~~~~~~~  234 (319)
T 3frx_A          186 ---FQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTL  234 (319)
T ss_dssp             ---TEEEEEECCCCSCEEEEEECTTSSEEEEEETTCEEEEEETTTTEEEEEE
T ss_pred             ---chhheeecCCCCcEEEEEEcCCCCEEEEEeCCCeEEEEECCCCcEEEEe
Confidence               5677788899999999999999999999999999999999987655444



>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>4gq2_M Nucleoporin NUP120; beta propeller alpha helical, component of nuclear pore COMP transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4fhm_B Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>4gq2_M Nucleoporin NUP120; beta propeller alpha helical, component of nuclear pore COMP transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4fhm_B Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 197
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 3e-08
d1vyhc1 317 b.69.4.1 (C:92-408) Platelet-activating factor ace 1e-05
d1vyhc1 317 b.69.4.1 (C:92-408) Platelet-activating factor ace 0.002
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 3e-08
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 3e-06
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 4e-05
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 2e-07
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 6e-07
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 3e-07
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 0.004
d1k8kc_ 371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 1e-06
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 3e-05
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 4e-04
d1sq9a_ 393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 5e-04
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 5e-04
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 8e-04
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 0.001
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 0.001
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 0.003
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure

class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Platelet-activating factor acetylhydrolase IB subunit alpha
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 50.5 bits (119), Expect = 3e-08
 Identities = 14/80 (17%), Positives = 33/80 (41%), Gaps = 11/80 (13%)

Query: 105 HKDLIHDVAYDYYGLRMATCSSDQNIKVTRDVMGTRFDIET---IGNFEDHYCTVWRVSW 161
           H + +  V +   G  + +C+ D+ ++V        +D +    +     H   V  + +
Sbjct: 246 HDNWVRGVLFHSGGKFILSCADDKTLRV--------WDYKNKRCMKTLNAHEHFVTSLDF 297

Query: 162 NITGTIVASSGDDGCVRLWK 181
           + T   V +   D  V++W+
Sbjct: 298 HKTAPYVVTGSVDQTVKVWE 317


>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query197
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.96
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.96
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.96
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.95
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.95
d1gxra_ 337 Groucho/tle1, C-terminal domain {Human (Homo sapie 99.94
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.94
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 99.94
d1vyhc1 317 Platelet-activating factor acetylhydrolase IB subu 99.94
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.93
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 99.93
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.93
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.93
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 99.92
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.91
d1erja_ 388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 99.9
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.9
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.9
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.9
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.87
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.87
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.87
d1nexb2 355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.85
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.84
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.82
d1nexb2 355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.81
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.81
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.78
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.78
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.75
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.73
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.72
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.66
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.63
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.63
d1hzua2 426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.46
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.43
d1ri6a_ 333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.35
d1l0qa2 301 Surface layer protein {Archaeon Methanosarcina maz 99.31
d1pbyb_ 337 Quinohemoprotein amine dehydrogenase B chain {Para 99.28
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.27
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.25
d1ri6a_ 333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.23
d1jmxb_ 346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.2
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.06
d2madh_ 373 Methylamine dehydrogenase, H-chain {Gram negative 99.0
d2bgra1 470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 98.89
d2bgra1 470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 98.7
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 98.68
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.41
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 98.31
d1mdah_ 368 Methylamine dehydrogenase, H-chain {Paracoccus den 98.26
d1qnia2 441 Nitrous oxide reductase, N-terminal domain {Pseudo 98.18
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 98.07
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.0
d1jofa_ 365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 97.89
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 97.88
d2p4oa1 302 Hypothetical protein All0351 homologue {Nostoc pun 97.84
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 97.82
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 97.74
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 97.63
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 97.55
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 97.35
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 97.22
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 96.89
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 96.87
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 96.74
d1xfda1 465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 96.52
d1xfda1 465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 95.76
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 93.95
d1k32a2 281 Tricorn protease N-terminal domain {Archaeon Therm 93.11
d1xipa_ 381 Nucleoporin NUP159 {Baker's yeast (Saccharomyces c 93.03
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 91.3
d1k3ia3 387 Galactose oxidase, central domain {Fungi (Fusarium 91.0
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 89.55
d1crua_ 450 Soluble quinoprotein glucose dehydrogenase {Acinet 85.98
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: beta1-subunit of the signal-transducing G protein heterotrimer
species: Cow (Bos taurus) [TaxId: 9913]
Probab=99.96  E-value=1.3e-27  Score=173.96  Aligned_cols=166  Identities=14%  Similarity=0.208  Sum_probs=134.5

Q ss_pred             eeeeeecCCCcceeEEEECCCCCCcEEEEEeCCCcEEEEEcCCcccccceeccceeccCCCeeeEEEccCCCccccee--
Q psy13207         16 TRRSNLVDSRTSVTDVKFGPKQLGLVLATCAADGLVRIYEAPDVMNLSQWCLQHEVACPTLASCLTWNHSFSRFNSIS--   93 (197)
Q Consensus        16 ~~~~~~~~h~~~v~~~~~~~~~~~~~l~s~~~dg~v~iw~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--   93 (197)
                      ....+|+||.++|++++|+|+  +.+|+||+.||+|+|||+.+++.+..+..     +...|.+++|+|++.+++++.  
T Consensus        46 ~~~~tL~GH~~~I~~l~~s~~--~~~l~sgs~Dg~v~iWd~~~~~~~~~~~~-----~~~~v~~v~~~~~~~~l~~~~~d  118 (340)
T d1tbga_          46 RTRRTLRGHLAKIYAMHWGTD--SRLLVSASQDGKLIIWDSYTTNKVHAIPL-----RSSWVMTCAYAPSGNYVACGGLD  118 (340)
T ss_dssp             CEEEEECCCSSCEEEEEECTT--SSEEEEEETTTEEEEEETTTTEEEEEEEC-----SCSCEEEEEECTTSSEEEEEETT
T ss_pred             eeeEEECCCCCCEEEEEECCC--CCEEEEEECCCceeeeecccceeEEEEec-----ccccEEeeEeeccceeeeeeccc
Confidence            455689999999999999999  99999999999999999998765543321     267899999999998876541  


Q ss_pred             --------------------------------------------------------------------------------
Q psy13207         94 --------------------------------------------------------------------------------   93 (197)
Q Consensus        94 --------------------------------------------------------------------------------   93 (197)
                                                                                                      
T Consensus       119 ~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  198 (340)
T d1tbga_         119 NICSIYNLKTREGNVRVSRELAGHTGYLSCCRFLDDNQIVTSSGDTTCALWDIETGQQTTTFTGHTGDVMSLSLAPDTRL  198 (340)
T ss_dssp             CCEEEEESSSSCSCCCEEEEECCCSSCEEEEEEEETTEEEEEETTTEEEEEETTTTEEEEEEECCSSCEEEEEECTTSSE
T ss_pred             ceeecccccccccccccceecccccccccccccccccccccccccccccccccccccccccccccceeEeeeccccccce
Confidence                                                                                            


Q ss_pred             ----------EEEE------eeEecccCCCceeEEEEcCCCeEEEEeeCCCeEEEEEccCCcccceeeee--eecCceec
Q psy13207         94 ----------IMYE------AHSINAEHKDLIHDVAYDYYGLRMATCSSDQNIKVTRDVMGTRFDIETIG--NFEDHYCT  155 (197)
Q Consensus        94 ----------~~~~------~~~~~~~~~~~i~~~~~~~~~~~~~s~~~d~~i~~~d~~~~~~~~~~~~~--~~~~h~~~  155 (197)
                                ++||      +..+. +|...|++++|+++.-+|++|+.|+.|++||++.     ...+.  ....+...
T Consensus       199 ~~~~~~d~~v~i~d~~~~~~~~~~~-~h~~~i~~v~~~p~~~~l~s~s~d~~i~~~~~~~-----~~~~~~~~~~~~~~~  272 (340)
T d1tbga_         199 FVSGACDASAKLWDVREGMCRQTFT-GHESDINAICFFPNGNAFATGSDDATCRLFDLRA-----DQELMTYSHDNIICG  272 (340)
T ss_dssp             EEEEETTTEEEEEETTTTEEEEEEC-CCSSCEEEEEECTTSSEEEEEETTSCEEEEETTT-----TEEEEEECCTTCCSC
T ss_pred             eEEeecCceEEEEECCCCcEEEEEe-CCCCCeEEEEECCCCCEEEEEeCCCeEEEEeecc-----cccccccccccccCc
Confidence                      4555      45566 7999999999995544449999999999999976     33333  34456778


Q ss_pred             EEEEEEccCCCEEEEEeCCCcEEEEEcCCCcchhhhhhh
Q psy13207        156 VWRVSWNITGTIVASSGDDGCVRLWKLKKKRKKKKEEEE  194 (197)
Q Consensus       156 v~~~~~~p~~~~l~~~~~dg~i~iw~~~~~~~~~~~~~~  194 (197)
                      |.+++|+|++++|++|+.||.|++||+.+++....+..|
T Consensus       273 i~~~~~s~~~~~l~~g~~dg~i~iwd~~~~~~~~~~~~H  311 (340)
T d1tbga_         273 ITSVSFSKSGRLLLAGYDDFNCNVWDALKADRAGVLAGH  311 (340)
T ss_dssp             EEEEEECSSSCEEEEEETTSCEEEEETTTCCEEEEECCC
T ss_pred             eEEEEECCCCCEEEEEECCCEEEEEECCCCcEEEEEcCC
Confidence            999999999999999999999999999988777666544



>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1xipa_ b.69.14.1 (A:) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure