Psyllid ID: psy13224

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160
MEAAMTAELRPKLRLLHPVTSAMCTQFPDPRLIQYDCGKLQSLDVILRKLKAGGHRVLIFTQMTRMLDVLEAFLNFHGHIYLRLDGTTKVDQRQVLMERFNMDARIFCFILSTRSGGVGINLTGADTVVFYDSDWNPTMDAQAQDRCHRIGQTRDVHIYR
cHHHHHHHHccccccccccccccccccccccHHHHccccHHHHHHHHHHHHHcccEEEEEHHHHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHHHcccccEEEEEEEccccccccccccccEEEEEcccccHHHHHHHHHHHHHHcccccEEEcc
cHHHHHHHHHHHHcccccccccccccccccHHEEEcccHHHHHHHHHHHHHHcccEEEEEHHHHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHHHcccccEEEEEEEEcccccEEEEccccEEEEEEcccccHHHHHHHHHHHHcccccEEEEEc
MEAAMTAelrpklrllhpvtsamctqfpdprliqydcgklQSLDVILRKLKAGGHRVLIFTQMTRMLDVLEAFLNFHGHIylrldgttkvDQRQVLMERFNMDARIFCFILstrsggvginltgadtvvfydsdwnptmdaqaqdrchrigqtrdvhiyr
meaamtaelrpklrllhpvTSAMCTQFPDPRLIQYDCGKLQSLDVILRKLKAGGHRVLIFTQMTRMLDVLEAFLNFHGHIYLRLDGTTKVDQRQVLMERFNMDARIFCFILSTRSGGVGINLTGADTVVFYDSDWNPTMdaqaqdrchrigqtrdvhiyr
MEAAMTAELRPKLRLLHPVTSAMCTQFPDPRLIQYDCGKLQSLDVILRKLKAGGHRVLIFTQMTRMLDVLEAFLNFHGHIYLRLDGTTKVDQRQVLMERFNMDARIFCFILSTRSGGVGINLTGADTVVFYDSDWNPTMDAQAQDRCHRIGQTRDVHIYR
************LRLLHPVTSAMCTQFPDPRLIQYDCGKLQSLDVILRKLKAGGHRVLIFTQMTRMLDVLEAFLNFHGHIYLRLDGTTKVDQRQVLMERFNMDARIFCFILSTRSGGVGINLTGADTVVFYDSDWNPTMDA****RCHRI**********
*********RPKLRLLHPVTSAMCTQFPDPRLIQYDCGKLQSLDVILRKLKAGGHRVLIFTQMTRMLDVLEAFLNFHGHIYLRLDGTTKVDQRQVLMERFNMDARIFCFILSTRSGGVGINLTGADTVVFYDSDWNPTMDAQAQDRCHRIGQTRDVHIYR
********LRPKLRLLHPVTSAMCTQFPDPRLIQYDCGKLQSLDVILRKLKAGGHRVLIFTQMTRMLDVLEAFLNFHGHIYLRLDGTTKVDQRQVLMERFNMDARIFCFILSTRSGGVGINLTGADTVVFYDSDWNPTMDAQAQDRCHRIGQTRDVHIYR
MEAAMTAELRPKLRLLHPVTSAMCTQFPDPRLIQYDCGKLQSLDVILRKLKAGGHRVLIFTQMTRMLDVLEAFLNFHGHIYLRLDGTTKVDQRQVLMERFNMDARIFCFILSTRSGGVGINLTGADTVVFYDSDWNPTMDAQAQDRCHRIGQTRDVHIYR
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEAAMTAELRPKLRLLHPVTSAMCTQFPDPRLIQYDCGKLQSLDVILRKLKAGGHRVLIFTQMTRMLDVLEAFLNFHGHIYLRLDGTTKVDQRQVLMERFNMDARIFCFILSTRSGGVGINLTGADTVVFYDSDWNPTMDAQAQDRCHRIGQTRDVHIYR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query160 2.2.26 [Sep-21-2011]
Q9NDJ2 3198 Helicase domino OS=Drosop no N/A 1.0 0.050 0.818 2e-80
Q6ZRS2 3230 Helicase SRCAP OS=Homo sa yes N/A 0.993 0.049 0.792 6e-76
Q7S133 1845 Helicase swr-1 OS=Neurosp N/A N/A 0.9 0.078 0.756 1e-65
Q4IAK7 1691 Helicase SWR1 OS=Gibberel yes N/A 0.862 0.081 0.782 3e-65
Q5ARK3 1698 Helicase swr1 OS=Emericel yes N/A 0.906 0.085 0.751 1e-63
Q4WAS9 1695 Helicase swr1 OS=Neosarto yes N/A 0.937 0.088 0.726 7e-63
O13682 1288 Helicase swr1 OS=Schizosa yes N/A 0.956 0.118 0.699 4e-62
Q6FK48 1450 Helicase SWR1 OS=Candida yes N/A 0.906 0.1 0.689 2e-61
Q05471 1514 Helicase SWR1 OS=Saccharo yes N/A 0.906 0.095 0.696 2e-61
Q759G7 1486 Helicase SWR1 OS=Ashbya g yes N/A 0.906 0.097 0.703 3e-61
>sp|Q9NDJ2|DOM_DROME Helicase domino OS=Drosophila melanogaster GN=dom PE=1 SV=2 Back     alignment and function desciption
 Score =  297 bits (760), Expect = 2e-80,   Method: Composition-based stats.
 Identities = 131/160 (81%), Positives = 146/160 (91%)

Query: 1    MEAAMTAELRPKLRLLHPVTSAMCTQFPDPRLIQYDCGKLQSLDVILRKLKAGGHRVLIF 60
            +E  +   LRPKL LLHP+ S M T+FPDPRLIQYDCGKLQ++D +LR+LK  GHRVLIF
Sbjct: 1621 IENIVDQALRPKLALLHPIISEMTTKFPDPRLIQYDCGKLQTMDRLLRQLKVNGHRVLIF 1680

Query: 61   TQMTRMLDVLEAFLNFHGHIYLRLDGTTKVDQRQVLMERFNMDARIFCFILSTRSGGVGI 120
            TQMT+MLDVLEAFLN+HGHIYLRLDG+T+V+QRQ+LMERFN D RIFCFILSTRSGGVGI
Sbjct: 1681 TQMTKMLDVLEAFLNYHGHIYLRLDGSTRVEQRQILMERFNGDKRIFCFILSTRSGGVGI 1740

Query: 121  NLTGADTVVFYDSDWNPTMDAQAQDRCHRIGQTRDVHIYR 160
            NLTGADTV+FYDSDWNPTMDAQAQDRCHRIGQTRDVHIYR
Sbjct: 1741 NLTGADTVIFYDSDWNPTMDAQAQDRCHRIGQTRDVHIYR 1780
Mediates the ATP-dependent exchange of unmodified histone H2AV for its phosphorylated and acetylated form H2AVK5acS138ph, leading to transcriptional regulation of selected genes by chromatin remodeling. Involved in Notch signaling. Represses E2F target genes. Required for somatic stem cell self-renewal but not for germline stem cell self-renewal. Involved in oogenesis.
Drosophila melanogaster (taxid: 7227)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: -
>sp|Q6ZRS2|SRCAP_HUMAN Helicase SRCAP OS=Homo sapiens GN=SRCAP PE=1 SV=3 Back     alignment and function description
>sp|Q7S133|SWR1_NEUCR Helicase swr-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=swr-1 PE=3 SV=1 Back     alignment and function description
>sp|Q4IAK7|SWR1_GIBZE Helicase SWR1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=SWR1 PE=3 SV=1 Back     alignment and function description
>sp|Q5ARK3|SWR1_EMENI Helicase swr1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=swr1 PE=3 SV=2 Back     alignment and function description
>sp|Q4WAS9|SWR1_ASPFU Helicase swr1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=swr1 PE=3 SV=1 Back     alignment and function description
>sp|O13682|SWR1_SCHPO Helicase swr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swr1 PE=3 SV=1 Back     alignment and function description
>sp|Q6FK48|SWR1_CANGA Helicase SWR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SWR1 PE=3 SV=1 Back     alignment and function description
>sp|Q05471|SWR1_YEAST Helicase SWR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWR1 PE=1 SV=1 Back     alignment and function description
>sp|Q759G7|SWR1_ASHGO Helicase SWR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SWR1 PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query160
322790023 3700 hypothetical protein SINV_15320 [Solenop 0.987 0.042 0.860 2e-81
383848572 2855 PREDICTED: uncharacterized protein LOC10 1.0 0.056 0.856 1e-80
345483873 2793 PREDICTED: hypothetical protein LOC10011 1.0 0.057 0.856 1e-80
312381365 2541 hypothetical protein AND_06360 [Anophele 0.993 0.062 0.849 1e-80
194881876 3193 GG22110 [Drosophila erecta] gi|190658234 1.0 0.050 0.837 2e-80
195121866 3199 GI19071 [Drosophila mojavensis] gi|19391 1.0 0.050 0.831 2e-80
195486513 3195 domino [Drosophila yakuba] gi|194177645| 1.0 0.050 0.825 4e-80
158295468 2856 AGAP006165-PB [Anopheles gambiae str. PE 0.993 0.055 0.842 4e-80
158295466 3418 AGAP006165-PA [Anopheles gambiae str. PE 0.993 0.046 0.842 5e-80
350402319 2846 PREDICTED: hypothetical protein LOC10074 1.0 0.056 0.856 6e-80
>gi|322790023|gb|EFZ15099.1| hypothetical protein SINV_15320 [Solenopsis invicta] Back     alignment and taxonomy information
 Score =  306 bits (784), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 136/158 (86%), Positives = 146/158 (92%)

Query: 3    AAMTAELRPKLRLLHPVTSAMCTQFPDPRLIQYDCGKLQSLDVILRKLKAGGHRVLIFTQ 62
            A +  +L PKL L HP++S M TQFPDPRLIQYDCGKLQSLD +LRKLK+G HRVLIFTQ
Sbjct: 1518 ADLQRQLSPKLSLFHPISSHMLTQFPDPRLIQYDCGKLQSLDCLLRKLKSGNHRVLIFTQ 1577

Query: 63   MTRMLDVLEAFLNFHGHIYLRLDGTTKVDQRQVLMERFNMDARIFCFILSTRSGGVGINL 122
            MTRMLDVLEAFLNFHGHIYLRLDGTT+VDQRQ+LMERFN D RIFCFILSTRSGGVG+NL
Sbjct: 1578 MTRMLDVLEAFLNFHGHIYLRLDGTTRVDQRQILMERFNGDKRIFCFILSTRSGGVGVNL 1637

Query: 123  TGADTVVFYDSDWNPTMDAQAQDRCHRIGQTRDVHIYR 160
            TGADTV+FYDSDWNPTMDAQAQDRCHRIGQTRDVHIYR
Sbjct: 1638 TGADTVIFYDSDWNPTMDAQAQDRCHRIGQTRDVHIYR 1675

Source: Solenopsis invicta

Species: Solenopsis invicta

Genus: Solenopsis

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|383848572|ref|XP_003699923.1| PREDICTED: uncharacterized protein LOC100874765 [Megachile rotundata] Back     alignment and taxonomy information
>gi|345483873|ref|XP_003424900.1| PREDICTED: hypothetical protein LOC100115939 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|312381365|gb|EFR27128.1| hypothetical protein AND_06360 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|194881876|ref|XP_001975047.1| GG22110 [Drosophila erecta] gi|190658234|gb|EDV55447.1| GG22110 [Drosophila erecta] Back     alignment and taxonomy information
>gi|195121866|ref|XP_002005439.1| GI19071 [Drosophila mojavensis] gi|193910507|gb|EDW09374.1| GI19071 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|195486513|ref|XP_002091544.1| domino [Drosophila yakuba] gi|194177645|gb|EDW91256.1| domino [Drosophila yakuba] Back     alignment and taxonomy information
>gi|158295468|ref|XP_001688808.1| AGAP006165-PB [Anopheles gambiae str. PEST] gi|157016052|gb|EDO63814.1| AGAP006165-PB [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|158295466|ref|XP_316223.4| AGAP006165-PA [Anopheles gambiae str. PEST] gi|157016051|gb|EAA11849.4| AGAP006165-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|350402319|ref|XP_003486443.1| PREDICTED: hypothetical protein LOC100745602 [Bombus impatiens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query160
FB|FBgn0020306 3198 dom "domino" [Drosophila melan 1.0 0.050 0.818 1.4e-68
UNIPROTKB|J9P9W7 1470 SRCAP "Uncharacterized protein 0.975 0.106 0.807 7.6e-65
UNIPROTKB|Q6ZRS2 3230 SRCAP "Helicase SRCAP" [Homo s 0.975 0.048 0.807 2.5e-64
UNIPROTKB|F1RG74 3230 SRCAP "Uncharacterized protein 0.975 0.048 0.807 3.2e-64
UNIPROTKB|E1BC33 3242 LOC788113 "Uncharacterized pro 0.975 0.048 0.807 4.1e-64
RGD|1565642 3182 Srcap "Snf2-related CREBBP act 0.975 0.049 0.802 2.8e-63
ASPGD|ASPL0000041040 1698 AN9077 [Emericella nidulans (t 0.9 0.084 0.756 7.6e-56
POMBASE|SPAC11E3.01c 1288 swr1 "SNF2 family helicase Swr 0.956 0.118 0.699 8e-55
SGD|S000002742 1514 SWR1 "Swi2/Snf2-related ATPase 0.906 0.095 0.696 8.3e-54
DICTYBASE|DDB_G0267638 3069 DDB_G0267638 "CHR group protei 0.9 0.046 0.722 9.7e-54
FB|FBgn0020306 dom "domino" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 713 (256.0 bits), Expect = 1.4e-68, P = 1.4e-68
 Identities = 131/160 (81%), Positives = 146/160 (91%)

Query:     1 MEAAMTAELRPKLRLLHPVTSAMCTQFPDPRLIQYDCGKLQSLDVILRKLKAGGHRVLIF 60
             +E  +   LRPKL LLHP+ S M T+FPDPRLIQYDCGKLQ++D +LR+LK  GHRVLIF
Sbjct:  1621 IENIVDQALRPKLALLHPIISEMTTKFPDPRLIQYDCGKLQTMDRLLRQLKVNGHRVLIF 1680

Query:    61 TQMTRMLDVLEAFLNFHGHIYLRLDGTTKVDQRQVLMERFNMDARIFCFILSTRSGGVGI 120
             TQMT+MLDVLEAFLN+HGHIYLRLDG+T+V+QRQ+LMERFN D RIFCFILSTRSGGVGI
Sbjct:  1681 TQMTKMLDVLEAFLNYHGHIYLRLDGSTRVEQRQILMERFNGDKRIFCFILSTRSGGVGI 1740

Query:   121 NLTGADTVVFYDSDWNPTMDAQAQDRCHRIGQTRDVHIYR 160
             NLTGADTV+FYDSDWNPTMDAQAQDRCHRIGQTRDVHIYR
Sbjct:  1741 NLTGADTVIFYDSDWNPTMDAQAQDRCHRIGQTRDVHIYR 1780
GO:0004386 "helicase activity" evidence=IEA;NAS
GO:0008283 "cell proliferation" evidence=NAS
GO:0016458 "gene silencing" evidence=IGI
GO:0008094 "DNA-dependent ATPase activity" evidence=ISS
GO:0002165 "instar larval or pupal development" evidence=IMP
GO:0006325 "chromatin organization" evidence=IMP
GO:0048477 "oogenesis" evidence=IMP
GO:0005634 "nucleus" evidence=IC;IDA
GO:0035207 "negative regulation of hemocyte proliferation" evidence=TAS
GO:0030097 "hemopoiesis" evidence=TAS
GO:0005524 "ATP binding" evidence=IEA
GO:0003677 "DNA binding" evidence=IEA
GO:0000381 "regulation of alternative mRNA splicing, via spliceosome" evidence=IMP
GO:0000123 "histone acetyltransferase complex" evidence=IPI
GO:0045747 "positive regulation of Notch signaling pathway" evidence=IGI
GO:0035222 "wing disc pattern formation" evidence=IGI
GO:0010629 "negative regulation of gene expression" evidence=IMP
GO:0005515 "protein binding" evidence=IPI
GO:0070983 "dendrite guidance" evidence=IMP
GO:0022008 "neurogenesis" evidence=IMP
GO:2000637 "positive regulation of gene silencing by miRNA" evidence=IMP
UNIPROTKB|J9P9W7 SRCAP "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q6ZRS2 SRCAP "Helicase SRCAP" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RG74 SRCAP "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E1BC33 LOC788113 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|1565642 Srcap "Snf2-related CREBBP activator protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ASPGD|ASPL0000041040 AN9077 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
POMBASE|SPAC11E3.01c swr1 "SNF2 family helicase Swr1" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
SGD|S000002742 SWR1 "Swi2/Snf2-related ATPase structural component of the SWR1 complex" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0267638 DDB_G0267638 "CHR group protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6ZRS2SRCAP_HUMAN3, ., 6, ., 4, ., -0.79240.99370.0492yesN/A
Q05471SWR1_YEAST3, ., 6, ., 4, ., 1, 20.69650.90620.0957yesN/A
Q6CJ38SWR1_KLULA3, ., 6, ., 4, ., 1, 20.64740.9750.0992yesN/A
P0CO18SWR1_CRYNJ3, ., 6, ., 4, ., 1, 20.68660.93750.1203yesN/A
Q6BKC2SWR1_DEBHA3, ., 6, ., 4, ., 1, 20.66200.90620.0897yesN/A
Q4IAK7SWR1_GIBZE3, ., 6, ., 4, ., 1, 20.78260.86250.0816yesN/A
Q6FK48SWR1_CANGA3, ., 6, ., 4, ., 1, 20.68960.90620.1yesN/A
Q9NEL2SSL1_CAEEL3, ., 6, ., 4, ., -0.75550.84370.0563yesN/A
Q759G7SWR1_ASHGO3, ., 6, ., 4, ., 1, 20.70340.90620.0975yesN/A
O13682SWR1_SCHPO3, ., 6, ., 4, ., 1, 20.69930.95620.1187yesN/A
Q5ARK3SWR1_EMENI3, ., 6, ., 4, ., 1, 20.75170.90620.0853yesN/A
Q4WAS9SWR1_ASPFU3, ., 6, ., 4, ., 1, 20.72660.93750.0884yesN/A
Q6CA87SWR1_YARLI3, ., 6, ., 4, ., 1, 20.71030.90620.0818yesN/A
C0H4W3HEPF1_PLAF73, ., 6, ., 4, ., -0.50320.95620.0734yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.4LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query160
PLN03142 1033 PLN03142, PLN03142, Probable chromatin-remodeling 4e-50
COG0553866 COG0553, HepA, Superfamily II DNA/RNA helicases, S 2e-40
cd00079131 cd00079, HELICc, Helicase superfamily c-terminal d 2e-28
pfam0027178 pfam00271, Helicase_C, Helicase conserved C-termin 7e-22
smart0049082 smart00490, HELICc, helicase superfamily c-termina 1e-21
PTZ00110545 PTZ00110, PTZ00110, helicase; Provisional 0.004
>gnl|CDD|215601 PLN03142, PLN03142, Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information 
 Score =  171 bits (435), Expect = 4e-50
 Identities = 66/124 (53%), Positives = 88/124 (70%), Gaps = 1/124 (0%)

Query: 38  GKLQSLDVILRKLKAGGHRVLIFTQMTRMLDVLEAFLNFHGHIYLRLDGTTKVDQRQVLM 97
           GK+  LD +L KLK    RVLIF+QMTR+LD+LE +L + G+ Y R+DG T  + R   +
Sbjct: 471 GKMVLLDKLLPKLKERDSRVLIFSQMTRLLDILEDYLMYRGYQYCRIDGNTGGEDRDASI 530

Query: 98  ERFNMD-ARIFCFILSTRSGGVGINLTGADTVVFYDSDWNPTMDAQAQDRCHRIGQTRDV 156
           + FN   +  F F+LSTR+GG+GINL  AD V+ YDSDWNP +D QAQDR HRIGQ ++V
Sbjct: 531 DAFNKPGSEKFVFLLSTRAGGLGINLATADIVILYDSDWNPQVDLQAQDRAHRIGQKKEV 590

Query: 157 HIYR 160
            ++R
Sbjct: 591 QVFR 594

Length = 1033
>gnl|CDD|223627 COG0553, HepA, Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain Back     alignment and domain information
>gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain Back     alignment and domain information
>gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 160
KOG0385|consensus 971 99.97
KOG0387|consensus 923 99.97
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 99.97
KOG0391|consensus 1958 99.96
KOG0389|consensus941 99.95
KOG0384|consensus 1373 99.94
KOG0390|consensus776 99.94
PRK04914 956 ATP-dependent helicase HepA; Validated 99.93
KOG0392|consensus1549 99.92
KOG0388|consensus1185 99.92
KOG0386|consensus 1157 99.9
KOG0331|consensus519 99.89
KOG1002|consensus791 99.88
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 99.88
COG0553866 HepA Superfamily II DNA/RNA helicases, SNF2 family 99.87
KOG1015|consensus 1567 99.87
KOG0333|consensus673 99.87
PTZ00110545 helicase; Provisional 99.85
KOG4439|consensus901 99.85
KOG0330|consensus476 99.84
KOG0345|consensus 567 99.83
KOG0328|consensus400 99.83
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 99.83
COG0513 513 SrmB Superfamily II DNA and RNA helicases [DNA rep 99.83
KOG0342|consensus 543 99.82
KOG1000|consensus689 99.81
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 99.8
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 99.8
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 99.8
PRK11776 460 ATP-dependent RNA helicase DbpA; Provisional 99.8
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 99.79
PRK10590 456 ATP-dependent RNA helicase RhlE; Provisional 99.79
TIGR00614 470 recQ_fam ATP-dependent DNA helicase, RecQ family. 99.79
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 99.78
PRK13766 773 Hef nuclease; Provisional 99.78
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 99.77
PHA02558501 uvsW UvsW helicase; Provisional 99.77
KOG0340|consensus442 99.77
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 99.77
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recomb 99.76
KOG0341|consensus610 99.75
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 99.74
PTZ00424401 helicase 45; Provisional 99.74
KOG0343|consensus 758 99.74
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 99.73
KOG0335|consensus482 99.73
KOG0348|consensus 708 99.72
smart0049082 HELICc helicase superfamily c-terminal domain. 99.71
KOG0336|consensus629 99.71
TIGR00603 732 rad25 DNA repair helicase rad25. All proteins in t 99.71
KOG0332|consensus477 99.71
PRK12898656 secA preprotein translocase subunit SecA; Reviewed 99.69
PRK09200 790 preprotein translocase subunit SecA; Reviewed 99.68
KOG1001|consensus674 99.68
KOG0326|consensus459 99.68
KOG1016|consensus 1387 99.68
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 99.67
KOG0344|consensus 593 99.63
TIGR00963 745 secA preprotein translocase, SecA subunit. The pro 99.63
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, 99.63
TIGR03714 762 secA2 accessory Sec system translocase SecA2. Memb 99.62
KOG0338|consensus 691 99.61
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 99.61
KOG0327|consensus397 99.61
KOG0347|consensus 731 99.61
PRK13767 876 ATP-dependent helicase; Provisional 99.61
TIGR00631 655 uvrb excinuclease ABC, B subunit. This family is b 99.6
PRK05298652 excinuclease ABC subunit B; Provisional 99.6
KOG0350|consensus620 99.59
KOG0334|consensus 997 99.58
KOG0339|consensus 731 99.58
PRK12906 796 secA preprotein translocase subunit SecA; Reviewed 99.57
KOG4284|consensus 980 99.56
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 99.56
KOG0346|consensus 569 99.55
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 99.54
KOG0354|consensus 746 99.53
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 99.53
PRK10689 1147 transcription-repair coupling factor; Provisional 99.53
TIGR00643630 recG ATP-dependent DNA helicase RecG. 99.51
PRK12900 1025 secA preprotein translocase subunit SecA; Reviewed 99.51
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 99.5
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 99.42
PHA02653 675 RNA helicase NPH-II; Provisional 99.41
KOG0298|consensus1394 99.39
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 99.38
PRK02362 737 ski2-like helicase; Provisional 99.38
KOG0337|consensus 529 99.35
KOG0351|consensus 941 99.35
PRK12904 830 preprotein translocase subunit SecA; Reviewed 99.35
KOG0349|consensus 725 99.35
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 99.34
PRK01172 674 ski2-like helicase; Provisional 99.32
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 99.31
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 99.26
PRK13107 908 preprotein translocase subunit SecA; Reviewed 99.26
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 99.25
COG1201 814 Lhr Lhr-like helicases [General function predictio 99.23
KOG0352|consensus 641 99.23
PRK00254 720 ski2-like helicase; Provisional 99.19
PRK09401 1176 reverse gyrase; Reviewed 99.18
PRK09694 878 helicase Cas3; Provisional 99.17
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 99.16
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 99.11
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 99.01
PRK14701 1638 reverse gyrase; Provisional 99.01
COG1202 830 Superfamily II helicase, archaea-specific [General 98.96
TIGR00595 505 priA primosomal protein N'. All proteins in this f 98.95
PRK12903 925 secA preprotein translocase subunit SecA; Reviewed 98.87
COG1200677 RecG RecG-like helicase [DNA replication, recombin 98.81
PRK12326 764 preprotein translocase subunit SecA; Reviewed 98.8
KOG0953|consensus 700 98.78
KOG0353|consensus 695 98.78
COG0556 663 UvrB Helicase subunit of the DNA excision repair c 98.77
PRK05580 679 primosome assembly protein PriA; Validated 98.77
KOG1123|consensus 776 98.76
COG1203 733 CRISPR-associated helicase Cas3 [Defense mechanism 98.76
KOG0383|consensus696 98.7
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 98.57
PRK12901 1112 secA preprotein translocase subunit SecA; Reviewed 98.53
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 98.53
COG1197 1139 Mfd Transcription-repair coupling factor (superfam 98.52
COG4098441 comFA Superfamily II DNA/RNA helicase required for 98.49
CHL00122 870 secA preprotein translocase subunit SecA; Validate 98.4
COG1205 851 Distinct helicase family with a unique C-terminal 98.36
KOG0329|consensus387 98.28
TIGR00348667 hsdR type I site-specific deoxyribonuclease, HsdR 98.24
KOG4150|consensus 1034 98.2
PF13871 278 Helicase_C_4: Helicase_C-like 98.17
COG4096 875 HsdR Type I site-specific restriction-modification 98.14
COG1204 766 Superfamily II helicase [General function predicti 98.12
TIGR01407850 dinG_rel DnaQ family exonuclease/DinG family helic 97.96
PF13307167 Helicase_C_2: Helicase C-terminal domain; PDB: 4A1 97.94
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 97.88
PRK12902 939 secA preprotein translocase subunit SecA; Reviewed 97.79
KOG0952|consensus 1230 97.71
PRK08074928 bifunctional ATP-dependent DNA helicase/DNA polyme 97.65
COG1199654 DinG Rad3-related DNA helicases [Transcription / D 97.65
COG4889 1518 Predicted helicase [General function prediction on 97.63
PF02399 824 Herpes_ori_bp: Origin of replication binding prote 97.54
PF11496297 HDA2-3: Class II histone deacetylase complex subun 97.54
KOG0950|consensus 1008 97.43
PRK11747697 dinG ATP-dependent DNA helicase DinG; Provisional 97.4
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polyme 97.38
KOG0920|consensus 924 97.38
TIGR00604705 rad3 DNA repair helicase (rad3). All proteins in t 97.35
COG0653 822 SecA Preprotein translocase subunit SecA (ATPase, 97.34
PF06862442 DUF1253: Protein of unknown function (DUF1253); In 97.28
KOG0951|consensus 1674 97.26
KOG0947|consensus 1248 97.23
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 97.17
smart00492141 HELICc3 helicase superfamily c-terminal domain. 97.16
KOG0922|consensus 674 97.02
COG1198 730 PriA Primosomal protein N' (replication factor Y) 96.94
TIGR00595 505 priA primosomal protein N'. All proteins in this f 96.89
TIGR00596 814 rad1 DNA repair protein (rad1). This family is bas 96.82
smart00491142 HELICc2 helicase superfamily c-terminal domain. 96.8
PRK10917 681 ATP-dependent DNA helicase RecG; Provisional 96.77
PRK05580 679 primosome assembly protein PriA; Validated 96.77
KOG0948|consensus 1041 96.58
COG1198 730 PriA Primosomal protein N' (replication factor Y) 96.48
KOG0923|consensus 902 96.44
TIGR00643 630 recG ATP-dependent DNA helicase RecG. 96.28
PRK14873 665 primosome assembly protein PriA; Provisional 96.08
TIGR03117636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 96.07
KOG1513|consensus 1300 95.97
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 95.9
KOG0949|consensus 1330 95.64
PRK10689 1147 transcription-repair coupling factor; Provisional 95.14
KOG0926|consensus 1172 94.58
COG1200 677 RecG RecG-like helicase [DNA replication, recombin 93.96
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 93.23
TIGR02562 1110 cas3_yersinia CRISPR-associated helicase Cas3. The 92.69
TIGR00614 470 recQ_fam ATP-dependent DNA helicase, RecQ family. 92.24
KOG0924|consensus 1042 92.07
PF13607138 Succ_CoA_lig: Succinyl-CoA ligase like flavodoxin 90.75
PRK14701 1638 reverse gyrase; Provisional 90.34
PF10593239 Z1: Z1 domain; InterPro: IPR018310 This entry repr 89.96
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 89.45
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 88.89
PRK11776 460 ATP-dependent RNA helicase DbpA; Provisional 88.46
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 88.08
COG1197 1139 Mfd Transcription-repair coupling factor (superfam 88.07
PRK05728142 DNA polymerase III subunit chi; Validated 87.94
PRK06646154 DNA polymerase III subunit chi; Provisional 86.74
TIGR0036597 monothiol glutaredoxin, Grx4 family. The gene for 86.08
PTZ00062204 glutaredoxin; Provisional 85.94
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 85.88
COG1205 851 Distinct helicase family with a unique C-terminal 85.74
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 85.71
KOG2340|consensus698 85.32
PRK13766 773 Hef nuclease; Provisional 85.31
PF1324576 AAA_19: Part of AAA domain 85.18
PRK09401 1176 reverse gyrase; Reviewed 84.2
cd0152490 RHOD_Pyr_redox Member of the Rhodanese Homology Do 84.06
cd0302890 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-inte 83.9
COG4098 441 comFA Superfamily II DNA/RNA helicase required for 83.04
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 82.58
PF04364137 DNA_pol3_chi: DNA polymerase III chi subunit, HolC 82.5
cd0341875 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX b 81.82
TIGR00376 637 DNA helicase, putative. The gene product may repre 81.77
cd06533171 Glyco_transf_WecG_TagA The glycosyltransferase Wec 81.03
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 80.58
PRK10824115 glutaredoxin-4; Provisional 80.5
PF03808172 Glyco_tran_WecB: Glycosyl transferase WecB/TagA/Cp 80.43
COG2179175 Predicted hydrolase of the HAD superfamily [Genera 80.06
>KOG0385|consensus Back     alignment and domain information 
Probab=99.97  E-value=1.7e-30  Score=210.86  Aligned_cols=149  Identities=50%  Similarity=0.798  Sum_probs=134.7

Q ss_pred             cchhccchhhhhhhc---CCCCccccccCchHHHHHHHHHHHhcCCCeEEEEeccHHHHHHHHHHHHhcCCeEEEEECCC
Q psy13224         12 KLRLLHPVTSAMCTQ---FPDPRLIQYDCGKLQSLDVILRKLKAGGHRVLIFTQMTRMLDVLEAFLNFHGHIYLRLDGTT   88 (160)
Q Consensus        12 ~~~~~~~~~~~~~~~---~~~~~~~~~~~~K~~~l~~ll~~~~~~~~k~lif~~~~~~~~~l~~~l~~~~~~~~~~~g~~   88 (160)
                      .--|+||++..-..+   +....-+...|+|+..|.+||..+++.|.+||||+++..++|.|++++.-+++.|+.++|++
T Consensus       442 RKccnHPYLF~g~ePg~pyttdehLv~nSGKm~vLDkLL~~Lk~~GhRVLIFSQmt~mLDILeDyc~~R~y~ycRiDGSt  521 (971)
T KOG0385|consen  442 RKCCNHPYLFDGAEPGPPYTTDEHLVTNSGKMLVLDKLLPKLKEQGHRVLIFSQMTRMLDILEDYCMLRGYEYCRLDGST  521 (971)
T ss_pred             HHhcCCccccCCCCCCCCCCcchHHHhcCcceehHHHHHHHHHhCCCeEEEeHHHHHHHHHHHHHHHhcCceeEeecCCC
Confidence            345799998766443   22222356679999999999999999999999999999999999999999999999999999


Q ss_pred             CHHHHHHHHHHhccCC-CceEEEEeccccccccccccCCEEEEeCCCCCcChhhHHHHHHHhcCCCCceEEeC
Q psy13224         89 KVDQRQVLMERFNMDA-RIFCFILSTRSGGVGINLTGADTVVFYDSDWNPTMDAQAQDRCHRIGQTRDVHIYR  160 (160)
Q Consensus        89 ~~~~r~~~~~~f~~~~-~~~vll~~~~~~~~Gldl~~~~~vi~~~~~~~~~~~~Q~~gR~~R~gq~~~v~i~r  160 (160)
                      +.++|...++.|+.++ ...|+|++|.++|.|+|+..|++||+||.+|||..-.|++.|+||+||+|+|.|||
T Consensus       522 ~~eeR~~aI~~fn~~~s~~FiFlLSTRAGGLGINL~aADtVIlyDSDWNPQ~DLQAmDRaHRIGQ~K~V~V~R  594 (971)
T KOG0385|consen  522 SHEEREDAIEAFNAPPSEKFIFLLSTRAGGLGINLTAADTVILYDSDWNPQVDLQAMDRAHRIGQKKPVVVYR  594 (971)
T ss_pred             CcHHHHHHHHhcCCCCcceEEEEEeccccccccccccccEEEEecCCCCchhhhHHHHHHHhhCCcCceEEEE
Confidence            9999999999999654 58889999999999999999999999999999999999999999999999999997

>KOG0387|consensus Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>KOG0391|consensus Back     alignment and domain information
>KOG0389|consensus Back     alignment and domain information
>KOG0384|consensus Back     alignment and domain information
>KOG0390|consensus Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>KOG0392|consensus Back     alignment and domain information
>KOG0388|consensus Back     alignment and domain information
>KOG0386|consensus Back     alignment and domain information
>KOG0331|consensus Back     alignment and domain information
>KOG1002|consensus Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1015|consensus Back     alignment and domain information
>KOG0333|consensus Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>KOG4439|consensus Back     alignment and domain information
>KOG0330|consensus Back     alignment and domain information
>KOG0345|consensus Back     alignment and domain information
>KOG0328|consensus Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0342|consensus Back     alignment and domain information
>KOG1000|consensus Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>KOG0340|consensus Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0341|consensus Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>KOG0343|consensus Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>KOG0335|consensus Back     alignment and domain information
>KOG0348|consensus Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>KOG0336|consensus Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>KOG0332|consensus Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG1001|consensus Back     alignment and domain information
>KOG0326|consensus Back     alignment and domain information
>KOG1016|consensus Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>KOG0344|consensus Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>KOG0338|consensus Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>KOG0327|consensus Back     alignment and domain information
>KOG0347|consensus Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>KOG0350|consensus Back     alignment and domain information
>KOG0334|consensus Back     alignment and domain information
>KOG0339|consensus Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG4284|consensus Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>KOG0346|consensus Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>KOG0354|consensus Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>KOG0298|consensus Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0337|consensus Back     alignment and domain information
>KOG0351|consensus Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0349|consensus Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>KOG0352|consensus Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0953|consensus Back     alignment and domain information
>KOG0353|consensus Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>KOG1123|consensus Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>KOG0383|consensus Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>KOG0329|consensus Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>KOG4150|consensus Back     alignment and domain information
>PF13871 Helicase_C_4: Helicase_C-like Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0952|consensus Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>PF11496 HDA2-3: Class II histone deacetylase complex subunits 2 and 3; InterPro: IPR021006 This entry contains the class II histone deacetylase complex subunits HDA2 and HDA3 is found in fungi Back     alignment and domain information
>KOG0950|consensus Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>KOG0920|consensus Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>KOG0947|consensus Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>smart00492 HELICc3 helicase superfamily c-terminal domain Back     alignment and domain information
>KOG0922|consensus Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>TIGR00596 rad1 DNA repair protein (rad1) Back     alignment and domain information
>smart00491 HELICc2 helicase superfamily c-terminal domain Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>KOG0948|consensus Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0923|consensus Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>KOG1513|consensus Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>KOG0949|consensus Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>KOG0926|consensus Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>KOG0924|consensus Back     alignment and domain information
>PF13607 Succ_CoA_lig: Succinyl-CoA ligase like flavodoxin domain; PDB: 2CSU_A Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>PF10593 Z1: Z1 domain; InterPro: IPR018310 This entry represents the Z1 domain of unknown function that is found in a group of putative endonucleases Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK05728 DNA polymerase III subunit chi; Validated Back     alignment and domain information
>PRK06646 DNA polymerase III subunit chi; Provisional Back     alignment and domain information
>TIGR00365 monothiol glutaredoxin, Grx4 family Back     alignment and domain information
>PTZ00062 glutaredoxin; Provisional Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>KOG2340|consensus Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>cd01524 RHOD_Pyr_redox Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd03028 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PF04364 DNA_pol3_chi: DNA polymerase III chi subunit, HolC; InterPro: IPR007459 The DNA polymerase III holoenzyme (2 Back     alignment and domain information
>cd03418 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>cd06533 Glyco_transf_WecG_TagA The glycosyltransferase WecG/TagA superfamily contains Escherichia coli WecG, Bacillus subtilis TagA and related proteins Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>PRK10824 glutaredoxin-4; Provisional Back     alignment and domain information
>PF03808 Glyco_tran_WecB: Glycosyl transferase WecB/TagA/CpsF family; InterPro: IPR004629 The WecG member of this superfamily, believed to be UDP-N-acetyl-D-mannosaminuronic acid transferase, plays a role in Enterobacterial common antigen (eca) synthesis in Escherichia coli Back     alignment and domain information
>COG2179 Predicted hydrolase of the HAD superfamily [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query160
3mwy_W 800 Crystal Structure Of The Chromodomain-atpase Portio 6e-34
1z3i_X 644 Structure Of The Swi2SNF2 CHROMATIN REMODELING DOMA 6e-21
1z5z_A271 Sulfolobus Solfataricus Swi2SNF2 ATPASE C-Terminal 2e-14
1z6a_A500 Sulfolobus Solfataricus Swi2SNF2 ATPASE CORE DOMAIN 3e-14
1z63_A500 Sulfolobus Solfataricus Swi2SNF2 ATPASE CORE IN COM 2e-13
>pdb|3MWY|W Chain W, Crystal Structure Of The Chromodomain-atpase Portion Of The Yeast Chd1 Chromatin Remodeler Length = 800 Back     alignment and structure 
Iteration: 1

 Score =  139 bits (351), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 68/124 (54%), Positives = 86/124 (69%), Gaps = 1/124 (0%)
Query: 38  GKLQSLDVILRKLKAGGHRVLIFTQMTRMLDVLEAFLNFHGHIYLRLDGTTKVDQRQVLM 97
           GK+  LD +L +LK  GHRVLIF+QM RMLD+L  +L+  G  + RLDGT    QR++ +
Sbjct: 556 GKMVLLDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLSIKGINFQRLDGTVPSAQRRISI 615
Query: 98  ERFNM-DARIFCFILSTRSGGVGINLTGADTVVFYDSDWNPTMDAQAQDRCHRIGQTRDV 156
           + FN  D+  F F+LSTR+GG+GINL  ADTVV +DSDWNP  D QA  R HRIGQ   V
Sbjct: 616 DHFNSPDSNDFVFLLSTRAGGLGINLMTADTVVIFDSDWNPQADLQAMARAHRIGQKNHV 675
Query: 157 HIYR 160
            +YR
Sbjct: 676 MVYR 679
>pdb|1Z3I|X Chain X, Structure Of The Swi2SNF2 CHROMATIN REMODELING DOMAIN OF EUKARYOTIC Rad54 Length = 644 Back     alignment and structure
>pdb|1Z5Z|A Chain A, Sulfolobus Solfataricus Swi2SNF2 ATPASE C-Terminal Domain Length = 271 Back     alignment and structure
>pdb|1Z6A|A Chain A, Sulfolobus Solfataricus Swi2SNF2 ATPASE CORE DOMAIN Length = 500 Back     alignment and structure
>pdb|1Z63|A Chain A, Sulfolobus Solfataricus Swi2SNF2 ATPASE CORE IN COMPLEX With Dsdna Length = 500 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query160
3mwy_W 800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 8e-70
1z3i_X 644 Similar to RAD54-like; recombination ATPase helica 2e-69
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 3e-47
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 8e-46
3hgt_A328 HDA1 complex subunit 3; RECA-like domain, SWI2/SNF 2e-40
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 2e-32
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 5e-09
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 1e-05
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 6e-04
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 8e-04
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Length = 800 Back     alignment and structure
 Score =  223 bits (571), Expect = 8e-70
 Identities = 70/136 (51%), Positives = 89/136 (65%), Gaps = 2/136 (1%)

Query: 26  QFPDPRLIQYDCGKLQSLDVILRKLKAGGHRVLIFTQMTRMLDVLEAFLNFHGHIYLRLD 85
           +     LI    GK+  LD +L +LK  GHRVLIF+QM RMLD+L  +L+  G  + RLD
Sbjct: 545 ENVLRGLIMS-SGKMVLLDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLSIKGINFQRLD 603

Query: 86  GTTKVDQRQVLMERFNM-DARIFCFILSTRSGGVGINLTGADTVVFYDSDWNPTMDAQAQ 144
           GT    QR++ ++ FN  D+  F F+LSTR+GG+GINL  ADTVV +DSDWNP  D QA 
Sbjct: 604 GTVPSAQRRISIDHFNSPDSNDFVFLLSTRAGGLGINLMTADTVVIFDSDWNPQADLQAM 663

Query: 145 DRCHRIGQTRDVHIYR 160
            R HRIGQ   V +YR
Sbjct: 664 ARAHRIGQKNHVMVYR 679
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Length = 644 Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Length = 271 Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Length = 500 Back     alignment and structure
>3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A Length = 328 Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Length = 968 Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Length = 472 Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Length = 510 Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Length = 696 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query160
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 99.98
3mwy_W 800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 99.95
1z3i_X 644 Similar to RAD54-like; recombination ATPase helica 99.95
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 99.94
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 99.93
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 99.92
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 99.92
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 99.91
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 99.91
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 99.9
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 99.89
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 99.81
3i32_A 300 Heat resistant RNA dependent ATPase; RNA helicase, 99.87
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 99.87
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 99.87
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 99.84
3hgt_A328 HDA1 complex subunit 3; RECA-like domain, SWI2/SNF 99.84
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 99.84
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 99.82
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 99.82
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 99.82
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 99.82
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 99.82
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 99.8
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 99.8
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 99.8
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 99.8
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 99.79
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 99.79
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 99.78
4gl2_A 699 Interferon-induced helicase C domain-containing P; 99.78
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 99.78
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 99.78
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 99.78
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA com 99.77
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 99.77
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 99.76
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 99.75
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 99.75
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 99.7
3h1t_A590 Type I site-specific restriction-modification syst 99.69
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.68
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 99.68
3jux_A 822 Protein translocase subunit SECA; protein transloc 99.68
1c4o_A 664 DNA nucleotide excision repair enzyme UVRB; uvrabc 99.67
2d7d_A 661 Uvrabc system protein B; helicase, protein-DNA-ADP 99.66
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 99.64
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 99.64
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 99.61
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 99.58
1yks_A 440 Genome polyprotein [contains: flavivirin protease 99.56
2jlq_A 451 Serine protease subunit NS3; ribonucleoprotein, nu 99.54
3rc3_A 677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 99.54
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 99.54
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 99.53
2wv9_A 673 Flavivirin protease NS2B regulatory subunit, FLAV 99.52
2z83_A 459 Helicase/nucleoside triphosphatase; hydrolase, mem 99.52
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 99.51
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 99.5
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 99.5
2whx_A 618 Serine protease/ntpase/helicase NS3; transcription 99.49
2v6i_A 431 RNA helicase; membrane, hydrolase, transmembrane, 99.49
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 99.48
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 99.47
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 99.43
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 99.43
3o8b_A 666 HCV NS3 protease/helicase; ntpase, RNA, translocat 99.39
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 99.36
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 98.89
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 98.81
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 98.79
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 98.15
2vl7_A540 XPD; helicase, unknown function; 2.25A {Sulfolobus 98.13
4a15_A620 XPD helicase, ATP-dependent DNA helicase TA0057; h 96.96
1gm5_A 780 RECG; helicase, replication restart; HET: DNA ADP; 96.08
3oiy_A 414 Reverse gyrase helicase domain; topoisomerase, DNA 95.86
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 94.94
2l82_A162 Designed protein OR32; structural genomics, northe 94.16
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 93.84
1wp9_A 494 ATP-dependent RNA helicase, putative; ATPase, DNA 92.36
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 91.64
3crv_A551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 91.19
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 91.17
3zyw_A111 Glutaredoxin-3; metal binding protein; 1.84A {Homo 91.01
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 90.92
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 90.91
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 90.8
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 89.85
1xti_A 391 Probable ATP-dependent RNA helicase P47; alpha-bet 89.25
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 89.21
3tbk_A 555 RIG-I helicase domain; DECH helicase, ATP binding, 89.14
3gx8_A121 Monothiol glutaredoxin-5, mitochondrial; TRX fold, 88.71
4a2q_A 797 RIG-I, retinoic acid inducible protein I; hydrolas 88.65
2wem_A118 Glutaredoxin-related protein 5; chromosome 14 open 88.59
3g5j_A134 Putative ATP/GTP binding protein; N-terminal domai 88.54
4a2p_A 556 RIG-I, retinoic acid inducible protein I; hydrolas 87.76
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 87.68
3ipz_A109 Monothiol glutaredoxin-S14, chloroplastic; electro 87.44
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 87.4
2db3_A 434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 86.96
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 86.46
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 85.12
2yan_A105 Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {H 84.85
2lnd_A112 De novo designed protein, PFK fold; structural gen 84.69
1s2m_A 400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 83.81
2wci_A135 Glutaredoxin-4; redox-active center, iron-sulfur c 83.48
3gk5_A108 Uncharacterized rhodanese-related protein TVG08686 83.15
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 82.99
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 82.74
2i4i_A 417 ATP-dependent RNA helicase DDX3X; DEAD, structural 82.5
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 81.76
4b3f_X 646 DNA-binding protein smubp-2; hydrolase, helicase; 81.39
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
Probab=99.98  E-value=2.2e-32  Score=205.21  Aligned_cols=143  Identities=29%  Similarity=0.456  Sum_probs=113.7

Q ss_pred             cchhccchhhhhhhcCCCCccccccCchHHHHHHHHHHHhcCCCeEEEEeccHHHHHHHHHHHHhc-CCeEEEEECCCCH
Q psy13224         12 KLRLLHPVTSAMCTQFPDPRLIQYDCGKLQSLDVILRKLKAGGHRVLIFTQMTRMLDVLEAFLNFH-GHIYLRLDGTTKV   90 (160)
Q Consensus        12 ~~~~~~~~~~~~~~~~~~~~~~~~~~~K~~~l~~ll~~~~~~~~k~lif~~~~~~~~~l~~~l~~~-~~~~~~~~g~~~~   90 (160)
                      ...++||.+..-      .......++|+..|.++|..+.+.++|+||||++..+++.+.+.|... |+.+..++|+++.
T Consensus        76 rq~~~hP~l~~~------~~~~~~~s~K~~~L~~ll~~~~~~~~kvlIFs~~~~~~~~l~~~L~~~~g~~~~~l~G~~~~  149 (271)
T 1z5z_A           76 KQIVDHPALLKG------GEQSVRRSGKMIRTMEIIEEALDEGDKIAIFTQFVDMGKIIRNIIEKELNTEVPFLYGELSK  149 (271)
T ss_dssp             HHHTTCTHHHHC------SCCCSTTCHHHHHHHHHHHHHHHTTCCEEEEESCHHHHHHHHHHHHHHHCSCCCEECTTSCH
T ss_pred             HHHcCCHHHhcC------CccccccCHHHHHHHHHHHHHHhCCCeEEEEeccHHHHHHHHHHHHHhcCCcEEEEECCCCH
Confidence            345678866541      112344689999999999998888899999999999999999999985 9999999999999


Q ss_pred             HHHHHHHHHhccCCCceEEEEeccccccccccccCCEEEEeCCCCCcChhhHHHHHHHhcCCCCceEEeC
Q psy13224         91 DQRQVLMERFNMDARIFCFILSTRSGGVGINLTGADTVVFYDSDWNPTMDAQAQDRCHRIGQTRDVHIYR  160 (160)
Q Consensus        91 ~~r~~~~~~f~~~~~~~vll~~~~~~~~Gldl~~~~~vi~~~~~~~~~~~~Q~~gR~~R~gq~~~v~i~r  160 (160)
                      ++|..+++.|++++...++|++++++++|+|++.+++||+||+||||..+.||+||++|+||+++|.||+
T Consensus       150 ~~R~~~i~~F~~~~~~~v~L~st~~~g~Glnl~~a~~VI~~d~~wnp~~~~Q~~gR~~R~Gq~~~v~v~~  219 (271)
T 1z5z_A          150 KERDDIISKFQNNPSVKFIVLSVKAGGFGINLTSANRVIHFDRWWNPAVEDQATDRVYRIGQTRNVIVHK  219 (271)
T ss_dssp             HHHHHHHHHHHHCTTCCEEEEECCTTCCCCCCTTCSEEEECSCCSCTTTC--------------CCEEEE
T ss_pred             HHHHHHHHHhcCCCCCCEEEEehhhhcCCcCcccCCEEEEECCCCChhHHHHHHHhccccCCCCceEEEE
Confidence            9999999999976677789999999999999999999999999999999999999999999999999985
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>2l82_A Designed protein OR32; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, de novo protein; NMR {Artificial gene} Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>3zyw_A Glutaredoxin-3; metal binding protein; 1.84A {Homo sapiens} Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>3gx8_A Monothiol glutaredoxin-5, mitochondrial; TRX fold, electron transport, mitochondrion, redox-active center, transit peptide, transport; 1.67A {Saccharomyces cerevisiae} Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>3g5j_A Putative ATP/GTP binding protein; N-terminal domain of ATP/GTP binding protein, PSI, MCSG, STR genomics, protein structure initiative; HET: PGE; 1.76A {Clostridium difficile} Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>3ipz_A Monothiol glutaredoxin-S14, chloroplastic; electron transport, PL redox-active center, transit peptide, transport, oxidoreduc; 2.40A {Arabidopsis thaliana} PDB: 2lku_A Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>2yan_A Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {Homo sapiens} Back     alignment and structure
>2lnd_A De novo designed protein, PFK fold; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Artificial gene} Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>2wci_A Glutaredoxin-4; redox-active center, iron-sulfur cluster scaffolder, Fe2S2, homodimer, transport, glutathione, thioredoxin fold; HET: GSH; 1.90A {Escherichia coli} PDB: 1yka_A Back     alignment and structure
>3gk5_A Uncharacterized rhodanese-related protein TVG0868615; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Thermoplasma volcanium GSS1} Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 160
d1z3ix1 346 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fi 3e-19
d1wp9a2286 c.37.1.19 (A:201-486) putative ATP-dependent RNA h 2e-14
d1z5za1244 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 h 4e-13
d2fwra1200 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Ar 1e-10
d1gkub2 248 c.37.1.16 (B:251-498) Helicase-like "domain" of re 7e-07
d1hv8a2155 c.37.1.19 (A:211-365) Putative DEAD box RNA helica 3e-06
d1a1va2 299 c.37.1.14 (A:326-624) HCV helicase domain {Human h 6e-05
d1fuka_162 c.37.1.19 (A:) Initiation factor 4a {Baker's yeast 8e-04
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Length = 346 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Rad54-like, Rad54L
species: Zebra fish (Danio rerio) [TaxId: 7955]

 Score = 80.4 bits (197), Expect = 3e-19
 Identities = 49/140 (35%), Positives = 77/140 (55%), Gaps = 2/140 (1%)

Query: 23  MCTQFPDPRLIQYDCGKLQSLDVILRKLK-AGGHRVLIFTQMTRMLDVLEAFLNFHGHIY 81
               +    +     GK+  LD IL   +     +V++ +  T+ LD+ E       ++Y
Sbjct: 86  FPQNYSTKAVEPQLSGKMLVLDYILAMTRTTTSDKVVLVSNYTQTLDLFEKLCRNRRYLY 145

Query: 82  LRLDGTTKVDQRQVLMERFNMDARI-FCFILSTRSGGVGINLTGADTVVFYDSDWNPTMD 140
           +RLDGT  + +R  ++ERFN  +   F F+LS+++GG G+NL GA+ +V +D DWNP  D
Sbjct: 146 VRLDGTMSIKKRAKIVERFNNPSSPEFIFMLSSKAGGCGLNLIGANRLVMFDPDWNPAND 205

Query: 141 AQAQDRCHRIGQTRDVHIYR 160
            QA  R  R GQ +  +IYR
Sbjct: 206 EQAMARVWRDGQKKTCYIYR 225
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 286 Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Length = 244 Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 200 Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 248 Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 155 Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 299 Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 162 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query160
d1z3ix1 346 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 99.97
d1z5za1244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 99.97
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.94
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.94
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 99.94
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 99.94
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.93
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 99.91
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 99.9
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.89
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.88
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 99.88
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 99.87
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 99.72
d1gkub2 248 Helicase-like "domain" of reverse gyrase {Archaeon 99.63
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.56
d1gm5a4206 RecG helicase domain {Thermotoga maritima [TaxId: 99.53
d1a1va2 299 HCV helicase domain {Human hepatitis C virus (HCV) 99.52
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 99.42
d1tf5a4175 Translocation ATPase SecA, nucleotide-binding doma 99.22
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 99.17
d1yksa2 299 YFV helicase domain {Yellow fever virus [TaxId: 11 99.04
d1nkta4219 Translocation ATPase SecA, nucleotide-binding doma 98.79
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 97.33
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 97.27
d2eyqa2117 Transcription-repair coupling factor, TRCF {Escher 91.53
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 90.21
d1byka_ 255 Trehalose repressor, C-terminal domain {Escherichi 83.94
d1em8a_147 DNA polymerase III chi subunit {Escherichia coli [ 80.92
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Rad54-like, Rad54L
species: Zebra fish (Danio rerio) [TaxId: 7955]

Probab=99.97  E-value=6.3e-32  Score=206.87  Aligned_cols=127  Identities=39%  Similarity=0.683  Sum_probs=118.2

Q ss_pred             cccCchHHHHHHHHHHHh-cCCCeEEEEeccHHHHHHHHHHHHhcCCeEEEEECCCCHHHHHHHHHHhccCC-CceEEEE
Q psy13224         34 QYDCGKLQSLDVILRKLK-AGGHRVLIFTQMTRMLDVLEAFLNFHGHIYLRLDGTTKVDQRQVLMERFNMDA-RIFCFIL  111 (160)
Q Consensus        34 ~~~~~K~~~l~~ll~~~~-~~~~k~lif~~~~~~~~~l~~~l~~~~~~~~~~~g~~~~~~r~~~~~~f~~~~-~~~vll~  111 (160)
                      ...|+|+..|.+++..+. ..|+|+|||+++..+++.|.+.|+..|+++..++|+++..+|..+++.|+++. ...++|+
T Consensus        97 ~~~S~Kl~~L~~ll~~~~~~~g~KvlIFs~~~~~ld~l~~~l~~~g~~~~~l~G~~~~~~R~~~i~~F~~~~~~~~vlLl  176 (346)
T d1z3ix1          97 PQLSGKMLVLDYILAMTRTTTSDKVVLVSNYTQTLDLFEKLCRNRRYLYVRLDGTMSIKKRAKIVERFNNPSSPEFIFML  176 (346)
T ss_dssp             GGGSHHHHHHHHHHHHHHHHCCCEEEEEESCHHHHHHHHHHHHHHTCCEEEECSSCCHHHHHHHHHHHHSTTCCCCEEEE
T ss_pred             cccCHHHHHHHHHHHHHHHhcCCceeEEeehhhhhHHHHHHHhhhhccccccccchhHHHHHHHHHhhhcccccceeeee
Confidence            345899999999998774 56789999999999999999999999999999999999999999999998654 3568999


Q ss_pred             eccccccccccccCCEEEEeCCCCCcChhhHHHHHHHhcCCCCceEEeC
Q psy13224        112 STRSGGVGINLTGADTVVFYDSDWNPTMDAQAQDRCHRIGQTRDVHIYR  160 (160)
Q Consensus       112 ~~~~~~~Gldl~~~~~vi~~~~~~~~~~~~Q~~gR~~R~gq~~~v~i~r  160 (160)
                      ++.+++.|+|++.|++||+|||+|||..+.|++||+||+||+++|+|||
T Consensus       177 s~~agg~GlnL~~a~~vi~~d~~wnp~~~~Qa~~R~~R~GQ~~~V~v~r  225 (346)
T d1z3ix1         177 SSKAGGCGLNLIGANRLVMFDPDWNPANDEQAMARVWRDGQKKTCYIYR  225 (346)
T ss_dssp             EGGGSCTTCCCTTEEEEEECSCCSSHHHHHHHHTTSSSTTCCSCEEEEE
T ss_pred             cchhhhhccccccceEEEEecCCCccchHhHhhhcccccCCCCceEEEE
Confidence            9999999999999999999999999999999999999999999999996
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2eyqa2 c.37.1.19 (A:349-465) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1byka_ c.93.1.1 (A:) Trehalose repressor, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1em8a_ c.128.1.1 (A:) DNA polymerase III chi subunit {Escherichia coli [TaxId: 562]} Back     information, alignment and structure