Psyllid ID: psy13256

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210------
MINIAGLDSSPITAQMFGNAGLEHMKLYGTKPEHFAKIAYKNHLHSTNNPNSQFQVEYTLEQIMNSPKIFGPLTKLQCCPTSDGAAAAVLASEDFVRRYGFEANAVEIVGLEMATDTSSTFNSDSCIKLIGFDMTKAAADRLYEKTQIKPSDIDVIELHDCFSANELITYEALGLCPVGKAKDFIDSGANTYGGKHVVNPSGGLISKGHPLGATGM
cccccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccccccccccHHHHHHccccccccccccccccccccHHEEEccHHHHHHcccccccEEEEEEEEEccccccccccccccccccHHHHHHHHHHHHHcccccccccEEEEEccccHHHHHHHHHccccccccHHHHHHHccccccccEEEcccccccccccccccccc
ccccccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHccccccHHHHHccccccccccHccccccccccEEEEEEcHHHHHHcccccccEEEEEEEcccccHHHccccccHHEccHHHHHHHHHHHHHHccccHcccEEEEEccHHcHHHHHHHHHccccccccccEEEEccccccccEEEEcccccHHHHccccccHHc
miniagldsspitaQMFGNAGLehmklygtkpeHFAKIAYKNhlhstnnpnsqfQVEYTLEQImnspkifgpltklqccptsdgAAAAVLASEDFVRRYGFEANAVEIVGLEmatdtsstfnsdscIKLIGFDMTKAAADRLYektqikpsdidvielhdcfsanelITYEalglcpvgkakdfidsgantyggkhvvnpsggliskghplgatgm
miniagldsspitAQMFGNAGLEHMKLYGTKPEHFAKIAYKNHLHSTNNPNSQFQVEYTLEQIMNSPKIFGPLTKLQCCPTSDGAAAAVLASEDFVRRYGFEANAVEIVGLEmatdtsstfnSDSCIKLIGFDMTKAAADRLYEKTqikpsdidvIELHDCFSANELITYEALGLCPVGKAKDFIDSGANTYGGkhvvnpsggliskghplgatgm
MINIAGLDSSPITAQMFGNAGLEHMKLYGTKPEHFAKIAYKNHLHSTNNPNSQFQVEYTLEQIMNSPKIFGPLTKLQCCPTSDGAAAAVLASEDFVRRYGFEANAVEIVGLEMATDTSSTFNSDSCIKLIGFDMTKAAADRLYEKTQIKPSDIDVIELHDCFSANELITYEALGLCPVGKAKDFIDSGANTYGGKHVVNPSGGLISKGHPLGATGM
*************AQMFGNAGLEHMKLYGTKPEHFAKIAYKNHLHSTN**NSQFQVEYTLEQIMNSPKIFGPLTKLQCCPTSDGAAAAVLASEDFVRRYGFEANAVEIVGLEMATDTSSTFNSDSCIKLIGFDMTKAAADRLYEKTQIKPSDIDVIELHDCFSANELITYEALGLCPVGKAKDFIDSGANTYGGKHVVN*****************
*****G*DSSPITAQMFGNAGLEHMKLYGTKPEHFAKIAYKNHLHSTNNPNSQFQVEYTLEQIMNSPKIFGPLTKLQCCPTSDGAAAAVLASEDFVRRYGFEANAVEIVGLEMATDTSSTFNSDSCIKLIGFDMTKAAADRLYEKTQIKPSDIDVIELHDCFSANELITYEALGLCPVGKAKDFIDSGANTYGGKHVVNPSGGLISKGHPLGATGM
MINIAGLDSSPITAQMFGNAGLEHMKLYGTKPEHFAKIAYKNHLHSTNNPNSQFQVEYTLEQIMNSPKIFGPLTKLQCCPTSDGAAAAVLASEDFVRRYGFEANAVEIVGLEMATDTSSTFNSDSCIKLIGFDMTKAAADRLYEKTQIKPSDIDVIELHDCFSANELITYEALGLCPVGKAKDFIDSGANTYGGKHVVNPSGGLISKGHPLGATGM
****AGLDSSPITAQMFGNAGLEHMKLYGTKPEHFAKIAYKNHLHSTNNPNSQFQVEYTLEQIMNSPKIFGPLTKLQCCPTSDGAAAAVLASEDFVRRYGFEANAVEIVGLEMATDTSSTFNSDSCIKLIGFDMTKAAADRLYEKTQIKPSDIDVIELHDCFSANELITYEALGLCPVGKAKDFIDSGANTYGGKHVVNPSGGLISKGHPLGA***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MINIAGLDSSPITAQMFGNAGLEHMKLYGTKPEHFAKIAYKNHLHSTNNPNSQFQVEYTLEQIMNSPKIFGPLTKLQCCPTSDGAAAAVLASEDFVRRYGFEANAVEIVGLEMATDTSSTFNSDSCIKLIGFDMTKAAADRLYEKTQIKPSDIDVIELHDCFSANELITYEALGLCPVGKAKDFIDSGANTYGGKHVVNPSGGLISKGHPLGATGM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query216 2.2.26 [Sep-21-2011]
Q07598 547 Non-specific lipid-transf yes N/A 1.0 0.394 0.680 3e-86
O62742 547 Non-specific lipid-transf yes N/A 1.0 0.394 0.671 1e-84
P32020 547 Non-specific lipid-transf yes N/A 1.0 0.394 0.657 5e-82
P11915 547 Non-specific lipid-transf yes N/A 1.0 0.394 0.634 9e-81
P07857 543 Non-specific lipid-transf yes N/A 1.0 0.397 0.666 2e-78
P22307 547 Non-specific lipid-transf no N/A 1.0 0.394 0.648 1e-76
O26884383 Uncharacterized protein M yes N/A 0.875 0.493 0.381 6e-33
Q58944392 Uncharacterized protein M yes N/A 0.916 0.505 0.339 1e-27
Q8VPF1401 Beta-ketoadipyl-CoA thiol N/A N/A 0.648 0.349 0.276 1e-08
Q51956400 Beta-ketoadipyl-CoA thiol yes N/A 0.699 0.377 0.274 5e-08
>sp|Q07598|NLTP_CHICK Non-specific lipid-transfer protein (Fragment) OS=Gallus gallus GN=SCP2 PE=2 SV=1 Back     alignment and function desciption
 Score =  317 bits (813), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 147/216 (68%), Positives = 177/216 (81%)

Query: 1   MINIAGLDSSPITAQMFGNAGLEHMKLYGTKPEHFAKIAYKNHLHSTNNPNSQFQVEYTL 60
           MIN  GL S+PIT QMF NAG EHM+ YGT PE+FAKIA+KNH HSTNNP SQFQ +YTL
Sbjct: 150 MINKYGLASAPITPQMFANAGKEHMEKYGTNPEYFAKIAWKNHSHSTNNPYSQFQKKYTL 209

Query: 61  EQIMNSPKIFGPLTKLQCCPTSDGAAAAVLASEDFVRRYGFEANAVEIVGLEMATDTSST 120
           ++++ S K+F  LT LQCCPTS+GAAAA+LASEDFV+R+  +  AVEI+   MATD  ST
Sbjct: 210 DEVLQSRKVFDFLTVLQCCPTSNGAAAAILASEDFVKRHKLQPQAVEILAQVMATDYPST 269

Query: 121 FNSDSCIKLIGFDMTKAAADRLYEKTQIKPSDIDVIELHDCFSANELITYEALGLCPVGK 180
           F  +SC+K++G+DMTK AA++ ++K  +KP+D+DVIELHDCFS NE ITYEALGLCP GK
Sbjct: 270 FEENSCMKMVGYDMTKKAAEKCFKKAGLKPTDVDVIELHDCFSVNEFITYEALGLCPEGK 329

Query: 181 AKDFIDSGANTYGGKHVVNPSGGLISKGHPLGATGM 216
           A D ID G NTYGGK V+NPSGGLISKGHPLGATG+
Sbjct: 330 ACDLIDRGDNTYGGKWVINPSGGLISKGHPLGATGL 365
Mediates in vitro the transfer of all common phospholipids, cholesterol and gangliosides between membranes. May play a role in regulating steroidogenesis.
Gallus gallus (taxid: 9031)
EC: 2EC: .EC: 3EC: .EC: 1EC: .EC: 1EC: 7EC: 6
>sp|O62742|NLTP_RABIT Non-specific lipid-transfer protein OS=Oryctolagus cuniculus GN=SCP2 PE=1 SV=1 Back     alignment and function description
>sp|P32020|NLTP_MOUSE Non-specific lipid-transfer protein OS=Mus musculus GN=Scp2 PE=1 SV=3 Back     alignment and function description
>sp|P11915|NLTP_RAT Non-specific lipid-transfer protein OS=Rattus norvegicus GN=Scp2 PE=1 SV=3 Back     alignment and function description
>sp|P07857|NLTP_BOVIN Non-specific lipid-transfer protein OS=Bos taurus GN=SCP2 PE=1 SV=2 Back     alignment and function description
>sp|P22307|NLTP_HUMAN Non-specific lipid-transfer protein OS=Homo sapiens GN=SCP2 PE=1 SV=2 Back     alignment and function description
>sp|O26884|Y793_METTH Uncharacterized protein MTH_793 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=MTH_793 PE=4 SV=1 Back     alignment and function description
>sp|Q58944|Y1549_METJA Uncharacterized protein MJ1549 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1549 PE=4 SV=1 Back     alignment and function description
>sp|Q8VPF1|PCAF_PSESB Beta-ketoadipyl-CoA thiolase OS=Pseudomonas sp. (strain B13) GN=pcaF PE=1 SV=1 Back     alignment and function description
>sp|Q51956|PCAF_PSEPU Beta-ketoadipyl-CoA thiolase OS=Pseudomonas putida GN=pcaF PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query216
345478896 549 PREDICTED: non-specific lipid-transfer p 1.0 0.393 0.763 1e-98
332016876 540 Non-specific lipid-transfer protein [Acr 1.0 0.4 0.736 6e-93
282165699 538 Sterol carrier protein X-related thiolas 1.0 0.401 0.726 1e-92
307190324 540 Non-specific lipid-transfer protein [Cam 1.0 0.4 0.722 1e-92
383855280 539 PREDICTED: non-specific lipid-transfer p 1.0 0.400 0.731 2e-92
380018270 548 PREDICTED: non-specific lipid-transfer p 1.0 0.394 0.722 2e-92
340716181 539 PREDICTED: non-specific lipid-transfer p 1.0 0.400 0.731 2e-92
328790232 508 PREDICTED: non-specific lipid-transfer p 1.0 0.425 0.717 2e-91
156382563 537 predicted protein [Nematostella vectensi 1.0 0.402 0.731 6e-91
350396663 539 PREDICTED: non-specific lipid-transfer p 1.0 0.400 0.703 2e-90
>gi|345478896|ref|XP_001607735.2| PREDICTED: non-specific lipid-transfer protein-like [Nasonia vitripennis] Back     alignment and taxonomy information
 Score =  364 bits (934), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 165/216 (76%), Positives = 192/216 (88%)

Query: 1   MINIAGLDSSPITAQMFGNAGLEHMKLYGTKPEHFAKIAYKNHLHSTNNPNSQFQVEYTL 60
           M ++AG++ SPITAQ+FGNAG+EHMK YGTKPEHFAKIAYKNH+HS NNP SQFQ +YTL
Sbjct: 139 MADVAGMNESPITAQLFGNAGIEHMKKYGTKPEHFAKIAYKNHMHSVNNPYSQFQDKYTL 198

Query: 61  EQIMNSPKIFGPLTKLQCCPTSDGAAAAVLASEDFVRRYGFEANAVEIVGLEMATDTSST 120
           EQIMNSPK+FGPLTKLQCCPTSDG+AA +LA+EDFVRR+  E  AVEIVG+EM+TD  ST
Sbjct: 199 EQIMNSPKVFGPLTKLQCCPTSDGSAAVILANEDFVRRHRLENQAVEIVGMEMSTDLPST 258

Query: 121 FNSDSCIKLIGFDMTKAAADRLYEKTQIKPSDIDVIELHDCFSANELITYEALGLCPVGK 180
           F+  SCIKLIG+DMTK A ++L+ KT  KPSD+DV+ELHDCFSANEL+TYEALGLCP GK
Sbjct: 259 FSERSCIKLIGYDMTKDATEKLFTKTAYKPSDVDVVELHDCFSANELVTYEALGLCPPGK 318

Query: 181 AKDFIDSGANTYGGKHVVNPSGGLISKGHPLGATGM 216
           A + IDSG NTYGGK+V+NPSGGLISKGHPLGATG+
Sbjct: 319 AGELIDSGNNTYGGKYVINPSGGLISKGHPLGATGL 354

Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|332016876|gb|EGI57685.1| Non-specific lipid-transfer protein [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|282165699|ref|NP_001107796.2| Sterol carrier protein X-related thiolase [Tribolium castaneum] gi|270015166|gb|EFA11614.1| sterol carrier protein x [Tribolium castaneum] Back     alignment and taxonomy information
>gi|307190324|gb|EFN74399.1| Non-specific lipid-transfer protein [Camponotus floridanus] Back     alignment and taxonomy information
>gi|383855280|ref|XP_003703143.1| PREDICTED: non-specific lipid-transfer protein-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|380018270|ref|XP_003693055.1| PREDICTED: non-specific lipid-transfer protein-like [Apis florea] Back     alignment and taxonomy information
>gi|340716181|ref|XP_003396579.1| PREDICTED: non-specific lipid-transfer protein-like isoform 1 [Bombus terrestris] Back     alignment and taxonomy information
>gi|328790232|ref|XP_392432.3| PREDICTED: non-specific lipid-transfer protein-like isoform 1 [Apis mellifera] Back     alignment and taxonomy information
>gi|156382563|ref|XP_001632622.1| predicted protein [Nematostella vectensis] gi|156219681|gb|EDO40559.1| predicted protein [Nematostella vectensis] Back     alignment and taxonomy information
>gi|350396663|ref|XP_003484623.1| PREDICTED: non-specific lipid-transfer protein-like isoform 1 [Bombus impatiens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query216
ZFIN|ZDB-GENE-040426-1846 538 scp2a "sterol carrier protein 1.0 0.401 0.712 1.2e-81
UNIPROTKB|F1NSS4 546 SCP2 "Non-specific lipid-trans 1.0 0.395 0.680 8.7e-79
UNIPROTKB|Q07598 547 SCP2 "Non-specific lipid-trans 1.0 0.394 0.680 8.7e-79
FB|FBgn0032715407 CG17597 [Drosophila melanogast 1.0 0.530 0.686 2.3e-78
FB|FBgn0015808 544 ScpX "Sterol carrier protein X 1.0 0.397 0.686 7.9e-78
UNIPROTKB|F1S762358 SCP2 "Uncharacterized protein" 0.995 0.600 0.665 6.3e-76
UNIPROTKB|F1MV74 543 SCP2 "Non-specific lipid-trans 1.0 0.397 0.666 1e-75
UNIPROTKB|P07857 543 SCP2 "Non-specific lipid-trans 1.0 0.397 0.666 1e-75
MGI|MGI:98254 547 Scp2 "sterol carrier protein 2 1.0 0.394 0.657 9.3e-75
UNIPROTKB|A6NM69 503 SCP2 "Non-specific lipid-trans 1.0 0.429 0.648 1.9e-74
ZFIN|ZDB-GENE-040426-1846 scp2a "sterol carrier protein 2a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 819 (293.4 bits), Expect = 1.2e-81, P = 1.2e-81
 Identities = 154/216 (71%), Positives = 177/216 (81%)

Query:     1 MINIAGLDSSPITAQMFGNAGLEHMKLYGTKPEHFAKIAYKNHLHSTNNPNSQFQVEYTL 60
             MIN  GL + P   QMFGNAG EHM+ YGTKPEHFAK+A+KNH HSTNNP SQFQ EY+L
Sbjct:   140 MINRYGLAAVPAAPQMFGNAGREHMEKYGTKPEHFAKVAWKNHKHSTNNPYSQFQDEYSL 199

Query:    61 EQIMNSPKIFGPLTKLQCCPTSDGAAAAVLASEDFVRRYGFEANAVEIVGLEMATDTSST 120
             EQ+++S K+F  LT LQCCPTSDGA AAVLASE FVRR G E  AVEIV  EM TD S+T
Sbjct:   200 EQVIDSRKVFEFLTLLQCCPTSDGAGAAVLASESFVRRNGLEKKAVEIVAQEMVTDLSTT 259

Query:   121 FNSDSCIKLIGFDMTKAAADRLYEKTQIKPSDIDVIELHDCFSANELITYEALGLCPVGK 180
             F  +SC+K++G+DMT+ AA+R Y+   +KPSD+DVIELHDCFSANELITYEALGLCP GK
Sbjct:   260 FEENSCMKMVGYDMTRLAAERCYDTAGVKPSDVDVIELHDCFSANELITYEALGLCPEGK 319

Query:   181 AKDFIDSGANTYGGKHVVNPSGGLISKGHPLGATGM 216
             A + ID G NTYGGK V+NPSGGLISKGHPLGATG+
Sbjct:   320 AGELIDRGDNTYGGKWVINPSGGLISKGHPLGATGL 355
GO:0016747 "transferase activity, transferring acyl groups other than amino-acyl groups" evidence=IEA
GO:0003824 "catalytic activity" evidence=IEA
GO:0008152 "metabolic process" evidence=IEA
GO:0032934 "sterol binding" evidence=IEA
UNIPROTKB|F1NSS4 SCP2 "Non-specific lipid-transfer protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q07598 SCP2 "Non-specific lipid-transfer protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
FB|FBgn0032715 CG17597 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0015808 ScpX "Sterol carrier protein X-related thiolase" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1S762 SCP2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1MV74 SCP2 "Non-specific lipid-transfer protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P07857 SCP2 "Non-specific lipid-transfer protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:98254 Scp2 "sterol carrier protein 2, liver" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|A6NM69 SCP2 "Non-specific lipid-transfer protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q07598NLTP_CHICK2, ., 3, ., 1, ., 1, 7, 60.68051.00.3948yesN/A
P11915NLTP_RAT2, ., 3, ., 1, ., 1, 7, 60.63421.00.3948yesN/A
P07857NLTP_BOVIN2, ., 3, ., 1, ., 1, 7, 60.66661.00.3977yesN/A
P32020NLTP_MOUSE2, ., 3, ., 1, ., 1, 7, 60.65741.00.3948yesN/A
O62742NLTP_RABIT2, ., 3, ., 1, ., 1, 7, 60.67121.00.3948yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.3.10.691

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query216
PRK08256391 PRK08256, PRK08256, lipid-transfer protein; Provis 1e-134
cd00829375 cd00829, SCP-x_thiolase, Thiolase domain associate 1e-92
cd00826393 cd00826, nondecarbox_cond_enzymes, nondecarboxylat 5e-78
PRK06064389 PRK06064, PRK06064, acetyl-CoA acetyltransferase; 4e-66
PRK12578385 PRK12578, PRK12578, acetyl-CoA acetyltransferase; 6e-51
COG0183392 COG0183, PaaJ, Acetyl-CoA acetyltransferase [Lipid 1e-49
PRK06365430 PRK06365, PRK06365, acetyl-CoA acetyltransferase; 5e-42
PRK06059399 PRK06059, PRK06059, lipid-transfer protein; Provis 5e-41
PRK07516389 PRK07516, PRK07516, acetyl-CoA acetyltransferase; 8e-40
PRK06157398 PRK06157, PRK06157, acetyl-CoA acetyltransferase; 7e-39
PRK06289403 PRK06289, PRK06289, acetyl-CoA acetyltransferase; 4e-36
PRK06066385 PRK06066, PRK06066, acetyl-CoA acetyltransferase; 4e-32
PTZ00455438 PTZ00455, PTZ00455, 3-ketoacyl-CoA thiolase; Provi 3e-31
PRK08313386 PRK08313, PRK08313, acetyl-CoA acetyltransferase; 2e-26
PRK07855386 PRK07855, PRK07855, lipid-transfer protein; Provis 5e-26
PRK06158384 PRK06158, PRK06158, thiolase; Provisional 3e-25
cd00327254 cd00327, cond_enzymes, Condensing enzymes; Family 1e-24
PRK06065392 PRK06065, PRK06065, acetyl-CoA acetyltransferase; 1e-24
PRK08142388 PRK08142, PRK08142, acetyl-CoA acetyltransferase; 8e-24
cd00751386 cd00751, thiolase, Thiolase are ubiquitous enzymes 5e-18
PRK07937352 PRK07937, PRK07937, lipid-transfer protein; Provis 6e-15
TIGR01930386 TIGR01930, AcCoA-C-Actrans, acetyl-CoA acetyltrans 1e-14
TIGR02430400 TIGR02430, pcaF, 3-oxoadipyl-CoA thiolase 1e-14
PRK09050401 PRK09050, PRK09050, beta-ketoadipyl CoA thiolase; 5e-13
PRK09052399 PRK09052, PRK09052, acetyl-CoA acetyltransferase; 1e-12
PRK13359400 PRK13359, PRK13359, beta-ketoadipyl CoA thiolase; 1e-12
PRK08242402 PRK08242, PRK08242, acetyl-CoA acetyltransferase; 3e-11
PRK07801382 PRK07801, PRK07801, acetyl-CoA acetyltransferase; 1e-10
PRK09051394 PRK09051, PRK09051, beta-ketothiolase; Provisional 1e-09
PRK06445394 PRK06445, PRK06445, acetyl-CoA acetyltransferase; 3e-09
PRK08235393 PRK08235, PRK08235, acetyl-CoA acetyltransferase; 2e-08
pfam02803123 pfam02803, Thiolase_C, Thiolase, C-terminal domain 1e-07
PRK05790393 PRK05790, PRK05790, putative acyltransferase; Prov 1e-07
PRK07851406 PRK07851, PRK07851, acetyl-CoA acetyltransferase; 1e-07
PRK06025417 PRK06025, PRK06025, acetyl-CoA acetyltransferase; 2e-06
PLN02644394 PLN02644, PLN02644, acetyl-CoA C-acetyltransferase 4e-06
TIGR02445385 TIGR02445, fadA, fatty oxidation complex, beta sub 9e-06
PRK07850387 PRK07850, PRK07850, acetyl-CoA acetyltransferase; 1e-05
PRK06205404 PRK06205, PRK06205, acetyl-CoA acetyltransferase; 1e-05
PRK08131401 PRK08131, PRK08131, acetyl-CoA acetyltransferase; 2e-05
PRK09268427 PRK09268, PRK09268, acetyl-CoA acetyltransferase; 4e-05
PLN02287452 PLN02287, PLN02287, 3-ketoacyl-CoA thiolase 6e-05
PRK08257 498 PRK08257, PRK08257, acetyl-CoA acetyltransferase; 7e-05
PRK08170426 PRK08170, PRK08170, acetyl-CoA acetyltransferase; 8e-05
PRK08947387 PRK08947, fadA, 3-ketoacyl-CoA thiolase; Reviewed 1e-04
PRK06954397 PRK06954, PRK06954, acetyl-CoA acetyltransferase; 2e-04
PRK06366388 PRK06366, PRK06366, acetyl-CoA acetyltransferase; 6e-04
PRK05656393 PRK05656, PRK05656, acetyl-CoA acetyltransferase; 0.001
TIGR02446430 TIGR02446, FadI, fatty oxidation complex, beta sub 0.002
PRK08963428 PRK08963, fadI, 3-ketoacyl-CoA thiolase; Reviewed 0.002
PRK06690361 PRK06690, PRK06690, acetyl-CoA acetyltransferase; 0.004
>gnl|CDD|181327 PRK08256, PRK08256, lipid-transfer protein; Provisional Back     alignment and domain information 
 Score =  382 bits (983), Expect = e-134
 Identities = 132/216 (61%), Positives = 165/216 (76%), Gaps = 1/216 (0%)

Query: 1   MINIAGLDSSPITAQMFGNAGLEHMKLYGTKPEHFAKIAYKNHLHSTNNPNSQFQVEYTL 60
           +  + G D +P   +MFG AG EHM+ YGT  E FAKI  K   H+ NNP +QF+ EYTL
Sbjct: 133 LAELQGFDPAPPALRMFGGAGREHMEKYGTTAETFAKIGVKARRHAANNPYAQFRDEYTL 192

Query: 61  EQIMNSPKIFGPLTKLQCCPTSDGAAAAVLASEDFVRRYGFEANAVEIVGLEMATDTSST 120
           E ++ SP I+GPLT+LQCCP + GAAAA++ SE+F R++G +  AVEIV   M TDT ST
Sbjct: 193 EDVLASPMIWGPLTRLQCCPPTCGAAAAIVCSEEFARKHGLDR-AVEIVAQAMTTDTPST 251

Query: 121 FNSDSCIKLIGFDMTKAAADRLYEKTQIKPSDIDVIELHDCFSANELITYEALGLCPVGK 180
           F+  S I L+G+DMT+AAA ++YE+  I P DIDV+ELHDCFSANEL+TYEALGLCP G+
Sbjct: 252 FDGRSMIDLVGYDMTRAAAQQVYEQAGIGPEDIDVVELHDCFSANELLTYEALGLCPEGE 311

Query: 181 AKDFIDSGANTYGGKHVVNPSGGLISKGHPLGATGM 216
           A+ FID G NTYGG+ VVNPSGGL+SKGHPLGATG+
Sbjct: 312 AEKFIDDGDNTYGGRWVVNPSGGLLSKGHPLGATGL 347

Length = 391
>gnl|CDD|238425 cd00829, SCP-x_thiolase, Thiolase domain associated with sterol carrier protein (SCP)-x isoform and related proteins; SCP-2 has multiple roles in intracellular lipid circulation and metabolism Back     alignment and domain information
>gnl|CDD|238422 cd00826, nondecarbox_cond_enzymes, nondecarboxylating condensing enzymes; In general, thiolases catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine Back     alignment and domain information
>gnl|CDD|235688 PRK06064, PRK06064, acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|183606 PRK12578, PRK12578, acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|223261 COG0183, PaaJ, Acetyl-CoA acetyltransferase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|235785 PRK06365, PRK06365, acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|180373 PRK06059, PRK06059, lipid-transfer protein; Provisional Back     alignment and domain information
>gnl|CDD|181013 PRK07516, PRK07516, acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|180433 PRK06157, PRK06157, acetyl-CoA acetyltransferase; Validated Back     alignment and domain information
>gnl|CDD|235771 PRK06289, PRK06289, acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|180380 PRK06066, PRK06066, acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|240424 PTZ00455, PTZ00455, 3-ketoacyl-CoA thiolase; Provisional Back     alignment and domain information
>gnl|CDD|181378 PRK08313, PRK08313, acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|181147 PRK07855, PRK07855, lipid-transfer protein; Provisional Back     alignment and domain information
>gnl|CDD|180434 PRK06158, PRK06158, thiolase; Provisional Back     alignment and domain information
>gnl|CDD|238201 cd00327, cond_enzymes, Condensing enzymes; Family of enzymes that catalyze a (decarboxylating or non-decarboxylating) Claisen-like condensation reaction Back     alignment and domain information
>gnl|CDD|180379 PRK06065, PRK06065, acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|236164 PRK08142, PRK08142, acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|238383 cd00751, thiolase, Thiolase are ubiquitous enzymes that catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine Back     alignment and domain information
>gnl|CDD|181173 PRK07937, PRK07937, lipid-transfer protein; Provisional Back     alignment and domain information
>gnl|CDD|233642 TIGR01930, AcCoA-C-Actrans, acetyl-CoA acetyltransferases Back     alignment and domain information
>gnl|CDD|131483 TIGR02430, pcaF, 3-oxoadipyl-CoA thiolase Back     alignment and domain information
>gnl|CDD|181624 PRK09050, PRK09050, beta-ketoadipyl CoA thiolase; Validated Back     alignment and domain information
>gnl|CDD|181626 PRK09052, PRK09052, acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|183998 PRK13359, PRK13359, beta-ketoadipyl CoA thiolase; Provisional Back     alignment and domain information
>gnl|CDD|236197 PRK08242, PRK08242, acetyl-CoA acetyltransferase; Validated Back     alignment and domain information
>gnl|CDD|181123 PRK07801, PRK07801, acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|181625 PRK09051, PRK09051, beta-ketothiolase; Provisional Back     alignment and domain information
>gnl|CDD|180563 PRK06445, PRK06445, acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|181311 PRK08235, PRK08235, acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|145779 pfam02803, Thiolase_C, Thiolase, C-terminal domain Back     alignment and domain information
>gnl|CDD|180261 PRK05790, PRK05790, putative acyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|181146 PRK07851, PRK07851, acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|235675 PRK06025, PRK06025, acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|215347 PLN02644, PLN02644, acetyl-CoA C-acetyltransferase Back     alignment and domain information
>gnl|CDD|131498 TIGR02445, fadA, fatty oxidation complex, beta subunit FadA Back     alignment and domain information
>gnl|CDD|181145 PRK07850, PRK07850, acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|235741 PRK06205, PRK06205, acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|181242 PRK08131, PRK08131, acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|236440 PRK09268, PRK09268, acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|215161 PLN02287, PLN02287, 3-ketoacyl-CoA thiolase Back     alignment and domain information
>gnl|CDD|236204 PRK08257, PRK08257, acetyl-CoA acetyltransferase; Validated Back     alignment and domain information
>gnl|CDD|181265 PRK08170, PRK08170, acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|181592 PRK08947, fadA, 3-ketoacyl-CoA thiolase; Reviewed Back     alignment and domain information
>gnl|CDD|180775 PRK06954, PRK06954, acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|102340 PRK06366, PRK06366, acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|168156 PRK05656, PRK05656, acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|131499 TIGR02446, FadI, fatty oxidation complex, beta subunit FadI Back     alignment and domain information
>gnl|CDD|181597 PRK08963, fadI, 3-ketoacyl-CoA thiolase; Reviewed Back     alignment and domain information
>gnl|CDD|180659 PRK06690, PRK06690, acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 216
PRK06066385 acetyl-CoA acetyltransferase; Provisional 100.0
PRK08142388 acetyl-CoA acetyltransferase; Provisional 100.0
PRK06065392 acetyl-CoA acetyltransferase; Provisional 100.0
PRK06158384 thiolase; Provisional 100.0
PRK08256391 lipid-transfer protein; Provisional 100.0
PRK07855386 lipid-transfer protein; Provisional 100.0
PRK08313386 acetyl-CoA acetyltransferase; Provisional 100.0
PRK12578385 acetyl-CoA acetyltransferase; Provisional 100.0
PRK06289403 acetyl-CoA acetyltransferase; Provisional 100.0
PRK06365430 acetyl-CoA acetyltransferase; Provisional 100.0
PRK06157398 acetyl-CoA acetyltransferase; Validated 100.0
PRK06064389 acetyl-CoA acetyltransferase; Provisional 100.0
cd00829375 SCP-x_thiolase Thiolase domain associated with ste 100.0
PRK06059399 lipid-transfer protein; Provisional 100.0
PRK07516389 acetyl-CoA acetyltransferase; Provisional 100.0
cd00826393 nondecarbox_cond_enzymes nondecarboxylating conden 100.0
PTZ00455438 3-ketoacyl-CoA thiolase; Provisional 100.0
PRK07937352 lipid-transfer protein; Provisional 100.0
KOG1406|consensus408 100.0
PRK08170426 acetyl-CoA acetyltransferase; Provisional 100.0
PRK06366388 acetyl-CoA acetyltransferase; Provisional 100.0
PRK08257 498 acetyl-CoA acetyltransferase; Validated 100.0
PRK09268427 acetyl-CoA acetyltransferase; Provisional 100.0
TIGR02445385 fadA fatty oxidation complex, beta subunit FadA. T 100.0
PRK08947387 fadA 3-ketoacyl-CoA thiolase; Reviewed 100.0
PRK06445394 acetyl-CoA acetyltransferase; Provisional 100.0
TIGR02446430 FadI fatty oxidation complex, beta subunit FadI. T 100.0
PRK08963428 fadI 3-ketoacyl-CoA thiolase; Reviewed 100.0
TIGR01930386 AcCoA-C-Actrans acetyl-CoA acetyltransferases. Thi 100.0
PRK09051394 beta-ketothiolase; Provisional 100.0
PRK07801382 acetyl-CoA acetyltransferase; Provisional 100.0
PRK08235393 acetyl-CoA acetyltransferase; Provisional 100.0
PRK06205404 acetyl-CoA acetyltransferase; Provisional 100.0
PRK05790393 putative acyltransferase; Provisional 100.0
PRK06504390 acetyl-CoA acetyltransferase; Provisional 100.0
PRK08242402 acetyl-CoA acetyltransferase; Validated 100.0
cd00751386 thiolase Thiolase are ubiquitous enzymes that cata 100.0
TIGR02430400 pcaF beta-ketoadipyl CoA thiolase. Members of this 100.0
PRK09052399 acetyl-CoA acetyltransferase; Provisional 100.0
PRK07661391 acetyl-CoA acetyltransferase; Provisional 100.0
PLN02287452 3-ketoacyl-CoA thiolase 100.0
PRK09050401 beta-ketoadipyl CoA thiolase; Validated 100.0
PRK13359400 beta-ketoadipyl CoA thiolase; Provisional 100.0
PRK07850387 acetyl-CoA acetyltransferase; Provisional 100.0
PRK07851406 acetyl-CoA acetyltransferase; Provisional 100.0
PRK06633392 acetyl-CoA acetyltransferase; Provisional 100.0
PRK06954397 acetyl-CoA acetyltransferase; Provisional 100.0
PRK08131401 acetyl-CoA acetyltransferase; Provisional 100.0
PRK05656393 acetyl-CoA acetyltransferase; Provisional 100.0
PRK06690361 acetyl-CoA acetyltransferase; Provisional 100.0
COG0183392 PaaJ Acetyl-CoA acetyltransferase [Lipid metabolis 100.0
PRK07108392 acetyl-CoA acetyltransferase; Provisional 100.0
PLN02644394 acetyl-CoA C-acetyltransferase 100.0
PRK06025417 acetyl-CoA acetyltransferase; Provisional 100.0
KOG1390|consensus396 99.98
KOG1389|consensus435 99.96
KOG1391|consensus396 99.96
KOG1392|consensus465 99.92
PF02803123 Thiolase_C: Thiolase, C-terminal domain; InterPro: 99.87
PF00108264 Thiolase_N: Thiolase, N-terminal domain; InterPro: 99.51
TIGR03150407 fabF beta-ketoacyl-acyl-carrier-protein synthase I 99.48
PRK07314411 3-oxoacyl-(acyl carrier protein) synthase II; Revi 99.44
PLN02836437 3-oxoacyl-[acyl-carrier-protein] synthase 99.4
PRK14691342 3-oxoacyl-(acyl carrier protein) synthase II; Prov 99.36
PRK06333424 3-oxoacyl-(acyl carrier protein) synthase II; Revi 99.36
PRK07103410 polyketide beta-ketoacyl:acyl carrier protein synt 99.32
cd00327254 cond_enzymes Condensing enzymes; Family of enzymes 99.25
PTZ00050421 3-oxoacyl-acyl carrier protein synthase; Provision 99.25
PRK06501425 3-oxoacyl-(acyl carrier protein) synthase II; Revi 99.23
smart00825424 PKS_KS Beta-ketoacyl synthase. The structure of be 99.23
PRK08722414 3-oxoacyl-(acyl carrier protein) synthase II; Revi 99.15
cd00834406 KAS_I_II Beta-ketoacyl-acyl carrier protein (ACP) 99.14
cd00833421 PKS polyketide synthases (PKSs) polymerize simple 99.12
KOG1394|consensus440 99.11
PRK05952381 3-oxoacyl-(acyl carrier protein) synthase II; Revi 99.11
cd00828407 elong_cond_enzymes "elongating" condensing enzymes 99.1
PRK07910418 3-oxoacyl-(acyl carrier protein) synthase II; Revi 99.09
COG0304412 FabB 3-oxoacyl-(acyl-carrier-protein) synthase [Li 99.08
PLN02787540 3-oxoacyl-[acyl-carrier-protein] synthase II 99.04
PRK09116405 3-oxoacyl-(acyl carrier protein) synthase II; Revi 98.91
PRK09185392 3-oxoacyl-(acyl carrier protein) synthase I; Revie 98.83
cd00832399 CLF Chain-length factor (CLF) is a factor required 98.83
PRK06519398 3-oxoacyl-(acyl carrier protein) synthase II; Revi 98.73
cd00825332 decarbox_cond_enzymes decarboxylating condensing e 98.72
PRK08439406 3-oxoacyl-(acyl carrier protein) synthase II; Revi 98.68
PRK07967406 3-oxoacyl-(acyl carrier protein) synthase I; Revie 98.5
COG0183392 PaaJ Acetyl-CoA acetyltransferase [Lipid metabolis 98.5
PRK06147348 3-oxoacyl-(acyl carrier protein) synthase; Validat 98.23
TIGR02813 2582 omega_3_PfaA polyketide-type polyunsaturated fatty 98.17
PF02801119 Ketoacyl-synt_C: Beta-ketoacyl synthase, C-termina 97.74
PRK09258338 3-oxoacyl-(acyl carrier protein) synthase III; Rev 96.27
PRK07204329 3-oxoacyl-(acyl carrier protein) synthase III; Rev 95.8
TIGR00748345 HMG_CoA_syn_Arc hydroxymethylglutaryl-CoA synthase 95.76
TIGR00747318 fabH 3-oxoacyl-(acyl-carrier-protein) synthase III 95.72
PRK07515372 3-oxoacyl-(acyl carrier protein) synthase III; Rev 95.68
cd00830320 KAS_III Ketoacyl-acyl carrier protein synthase III 95.61
PRK09352319 3-oxoacyl-(acyl carrier protein) synthase III; Rev 95.6
COG3321 1061 Polyketide synthase modules and related proteins [ 95.6
PRK12879325 3-oxoacyl-(acyl carrier protein) synthase III; Rev 95.42
PRK05963326 3-oxoacyl-(acyl carrier protein) synthase II; Revi 94.99
PRK06840339 hypothetical protein; Validated 94.79
COG3425377 PksG 3-hydroxy-3-methylglutaryl CoA synthase [Lipi 94.74
PRK04262347 hypothetical protein; Provisional 94.24
COG0332323 FabH 3-oxoacyl-[acyl-carrier-protein] 94.05
PLN03173391 chalcone synthase; Provisional 93.67
cd00831361 CHS_like Chalcone and stilbene synthases; plant-sp 92.76
cd00827324 init_cond_enzymes "initiating" condensing enzymes 92.59
COG3424356 BcsA Predicted naringenin-chalcone synthase [Secon 91.77
PLN03169391 chalcone synthase family protein; Provisional 91.57
PLN03172393 chalcone synthase family protein; Provisional 91.51
TIGR01835379 HMG-CoA-S_prok 3-hydroxy-3-methylglutaryl CoA synt 90.27
PF0854190 ACP_syn_III_C: 3-Oxoacyl-[acyl-carrier-protein (AC 89.87
PLN03170401 chalcone synthase; Provisional 89.75
COG0332 323 FabH 3-oxoacyl-[acyl-carrier-protein] 88.69
PLN03171399 chalcone synthase-like protein; Provisional 86.48
PRK06816378 3-oxoacyl-(acyl carrier protein) synthase III; Rev 86.44
PRK08313 386 acetyl-CoA acetyltransferase; Provisional 86.26
PLN02326379 3-oxoacyl-[acyl-carrier-protein] synthase III 85.82
PLN02577 459 hydroxymethylglutaryl-CoA synthase 84.52
PRK06158 384 thiolase; Provisional 84.34
PLN02377 502 3-ketoacyl-CoA synthase 84.1
CHL00203326 fabH 3-oxoacyl-acyl-carrier-protein synthase 3; Pr 84.03
PLN03168 389 chalcone synthase; Provisional 84.01
PRK07855 386 lipid-transfer protein; Provisional 83.56
TIGR00748 345 HMG_CoA_syn_Arc hydroxymethylglutaryl-CoA synthase 83.41
PLN02854521 3-ketoacyl-CoA synthase 82.45
PLN02192 511 3-ketoacyl-CoA synthase 81.7
PRK06065 392 acetyl-CoA acetyltransferase; Provisional 81.63
PLN03172 393 chalcone synthase family protein; Provisional 80.5
PLN03171 399 chalcone synthase-like protein; Provisional 80.33
PLN03169 391 chalcone synthase family protein; Provisional 80.14
PLN02932 478 3-ketoacyl-CoA synthase 80.13
>PRK06066 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=2.3e-57  Score=400.86  Aligned_cols=207  Identities=30%  Similarity=0.439  Sum_probs=186.4

Q ss_pred             ccCCCCCCchHH-HHHHHHHHHHHHhCCCHHHHHHHHHHHHHHHhcCCCCcCCccCChhhhhCCCcccccccccCCCCCC
Q psy13256          4 IAGLDSSPITAQ-MFGNAGLEHMKLYGTKPEHFAKIAYKNHLHSTNNPNSQFQVEYTLEQIMNSPKIFGPLTKLQCCPTS   82 (216)
Q Consensus         4 ~~~~~~~~~~~~-~~al~a~~~~~~~G~s~e~la~~a~~~~~~A~~np~a~~r~~~t~e~~~~~~~i~~pl~~~~~~~~~   82 (216)
                      +||.|+++..+. +|+|.++|||++||+++|++++|++++|+||++||+|++|+++|+|||++||+|++|||++|||+++
T Consensus       132 ~~~~p~g~~~p~~~~al~a~rym~~yG~t~E~lA~Vavk~r~nA~~NP~A~~r~~~t~edvl~S~~ia~Pl~~~d~~~~~  211 (385)
T PRK06066        132 IYVRPIGPPNPHFIAGLDAVKFMSRKGITREDLALVVEKNKKAGLSNPRASYASNISLEDVLSSEYVVYPLTELDIAPFV  211 (385)
T ss_pred             ceecccCCCcHHHHHHHHHHHHHHHHCcCHHHHHHHHHHHHHHHhcCChhhcCCCCCHHHHhcCCcccCCchhhccCCCC
Confidence            577888877655 7899999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CceeEEEEcCHHHHHHcCCCCCeEEEEEEEEecCCCCccCccchhhhcccchHHHHHHHHHHHcCCC--CCCcCEEEecC
Q psy13256         83 DGAAAAVLASEDFVRRYGFEANAVEIVGLEMATDTSSTFNSDSCIKLIGFDMTKAAADRLYEKTQIK--PSDIDVIELHD  160 (216)
Q Consensus        83 DGAaAvvl~s~~~A~~~g~~~~~v~i~g~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~al~~aGl~--~~DId~~e~~d  160 (216)
                      |||+|+||+|+++|++++  .++|+|+|++...+.... .. .  ++..++.++.|++++|+++||+  ++|||++|+||
T Consensus       212 DGAaAvvl~s~~~a~~l~--~~pv~I~g~g~~~~~~~~-~~-~--~~~~~~~~~~Aa~~a~~~AGi~~p~~DiD~~ei~D  285 (385)
T PRK06066        212 DGAIVVVLASEEVAKKLT--DDPVWIKGIGWSTESSNL-ET-A--ELGKANYMRIAADMAYKMAGIESPRKEVDAAEVDD  285 (385)
T ss_pred             CceEEEEEeCHHHHHhcC--CCCEEEEEEEEecCCccc-cc-c--cccccHHHHHHHHHHHHHcCCCCCHHHCcEEEEec
Confidence            999999999999999876  456799999987643221 11 1  1233444568999999999998  79999999999


Q ss_pred             ccHHHHHHHHHHcCCCCCCcchhhhhcCCccCCCccccccCcchhcccCccCCCCC
Q psy13256        161 CFSANELITYEALGLCPVGKAKDFIDSGANTYGGKHVVNPSGGLISKGHPLGATGM  216 (216)
Q Consensus       161 ~fs~~~~~~~e~lGl~~~G~~~~~~~~g~~~~~g~~pvN~~GG~l~~Ghp~gatG~  216 (216)
                      +|++++++++|+||||++||+++|+++|.++++|++|||++||+|++|||+|+||+
T Consensus       286 ~Ft~~~l~~~e~lG~~~~Ge~~~~v~~G~~~~~G~~PvN~~GG~la~Ghp~gatG~  341 (385)
T PRK06066        286 RYSYKELQHIEALRLSEEPEKDSLLREGNFDPQGELPVNPSGGHLAKGVPLEASGL  341 (385)
T ss_pred             CChHHHHHHHHHcCCCCCCchHHHHHCCCCCCCCCccccCCCchhcCCCccchhHH
Confidence            99999999999999999999999999999999999999999999999999999985

>PRK08142 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06065 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06158 thiolase; Provisional Back     alignment and domain information
>PRK08256 lipid-transfer protein; Provisional Back     alignment and domain information
>PRK07855 lipid-transfer protein; Provisional Back     alignment and domain information
>PRK08313 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK12578 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06289 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06365 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06157 acetyl-CoA acetyltransferase; Validated Back     alignment and domain information
>PRK06064 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>cd00829 SCP-x_thiolase Thiolase domain associated with sterol carrier protein (SCP)-x isoform and related proteins; SCP-2 has multiple roles in intracellular lipid circulation and metabolism Back     alignment and domain information
>PRK06059 lipid-transfer protein; Provisional Back     alignment and domain information
>PRK07516 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>cd00826 nondecarbox_cond_enzymes nondecarboxylating condensing enzymes; In general, thiolases catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine Back     alignment and domain information
>PTZ00455 3-ketoacyl-CoA thiolase; Provisional Back     alignment and domain information
>PRK07937 lipid-transfer protein; Provisional Back     alignment and domain information
>KOG1406|consensus Back     alignment and domain information
>PRK08170 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06366 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK08257 acetyl-CoA acetyltransferase; Validated Back     alignment and domain information
>PRK09268 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>TIGR02445 fadA fatty oxidation complex, beta subunit FadA Back     alignment and domain information
>PRK08947 fadA 3-ketoacyl-CoA thiolase; Reviewed Back     alignment and domain information
>PRK06445 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>TIGR02446 FadI fatty oxidation complex, beta subunit FadI Back     alignment and domain information
>PRK08963 fadI 3-ketoacyl-CoA thiolase; Reviewed Back     alignment and domain information
>TIGR01930 AcCoA-C-Actrans acetyl-CoA acetyltransferases Back     alignment and domain information
>PRK09051 beta-ketothiolase; Provisional Back     alignment and domain information
>PRK07801 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK08235 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06205 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK05790 putative acyltransferase; Provisional Back     alignment and domain information
>PRK06504 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK08242 acetyl-CoA acetyltransferase; Validated Back     alignment and domain information
>cd00751 thiolase Thiolase are ubiquitous enzymes that catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine Back     alignment and domain information
>TIGR02430 pcaF beta-ketoadipyl CoA thiolase Back     alignment and domain information
>PRK09052 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK07661 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PLN02287 3-ketoacyl-CoA thiolase Back     alignment and domain information
>PRK09050 beta-ketoadipyl CoA thiolase; Validated Back     alignment and domain information
>PRK13359 beta-ketoadipyl CoA thiolase; Provisional Back     alignment and domain information
>PRK07850 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK07851 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06633 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06954 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK08131 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK05656 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06690 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>COG0183 PaaJ Acetyl-CoA acetyltransferase [Lipid metabolism] Back     alignment and domain information
>PRK07108 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PLN02644 acetyl-CoA C-acetyltransferase Back     alignment and domain information
>PRK06025 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>KOG1390|consensus Back     alignment and domain information
>KOG1389|consensus Back     alignment and domain information
>KOG1391|consensus Back     alignment and domain information
>KOG1392|consensus Back     alignment and domain information
>PF02803 Thiolase_C: Thiolase, C-terminal domain; InterPro: IPR020617 Two different types of thiolase [, , ] are found both in eukaryotes and in prokaryotes: acetoacetyl-CoA thiolase (2 Back     alignment and domain information
>PF00108 Thiolase_N: Thiolase, N-terminal domain; InterPro: IPR020616 Two different types of thiolase [, , ] are found both in eukaryotes and in prokaryotes: acetoacetyl-CoA thiolase (2 Back     alignment and domain information
>TIGR03150 fabF beta-ketoacyl-acyl-carrier-protein synthase II Back     alignment and domain information
>PRK07314 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PLN02836 3-oxoacyl-[acyl-carrier-protein] synthase Back     alignment and domain information
>PRK14691 3-oxoacyl-(acyl carrier protein) synthase II; Provisional Back     alignment and domain information
>PRK06333 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PRK07103 polyketide beta-ketoacyl:acyl carrier protein synthase; Validated Back     alignment and domain information
>cd00327 cond_enzymes Condensing enzymes; Family of enzymes that catalyze a (decarboxylating or non-decarboxylating) Claisen-like condensation reaction Back     alignment and domain information
>PTZ00050 3-oxoacyl-acyl carrier protein synthase; Provisional Back     alignment and domain information
>PRK06501 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>smart00825 PKS_KS Beta-ketoacyl synthase Back     alignment and domain information
>PRK08722 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>cd00834 KAS_I_II Beta-ketoacyl-acyl carrier protein (ACP) synthase (KAS), type I and II Back     alignment and domain information
>cd00833 PKS polyketide synthases (PKSs) polymerize simple fatty acids into a large variety of different products, called polyketides, by successive decarboxylating Claisen condensations Back     alignment and domain information
>KOG1394|consensus Back     alignment and domain information
>PRK05952 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>cd00828 elong_cond_enzymes "elongating" condensing enzymes are a subclass of decarboxylating condensing enzymes, including beta-ketoacyl [ACP] synthase, type I and II and polyketide synthases Back     alignment and domain information
>PRK07910 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>COG0304 FabB 3-oxoacyl-(acyl-carrier-protein) synthase [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02787 3-oxoacyl-[acyl-carrier-protein] synthase II Back     alignment and domain information
>PRK09116 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PRK09185 3-oxoacyl-(acyl carrier protein) synthase I; Reviewed Back     alignment and domain information
>cd00832 CLF Chain-length factor (CLF) is a factor required for polyketide chain initiation of aromatic antibiotic-producing polyketide synthases (PKSs) of filamentous bacteria Back     alignment and domain information
>PRK06519 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>cd00825 decarbox_cond_enzymes decarboxylating condensing enzymes; Family of enzymes that catalyze the formation of a new carbon-carbon bond by a decarboxylating Claisen-like condensation reaction Back     alignment and domain information
>PRK08439 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PRK07967 3-oxoacyl-(acyl carrier protein) synthase I; Reviewed Back     alignment and domain information
>COG0183 PaaJ Acetyl-CoA acetyltransferase [Lipid metabolism] Back     alignment and domain information
>PRK06147 3-oxoacyl-(acyl carrier protein) synthase; Validated Back     alignment and domain information
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>PF02801 Ketoacyl-synt_C: Beta-ketoacyl synthase, C-terminal domain; InterPro: IPR014031 Beta-ketoacyl-ACP synthase 2 Back     alignment and domain information
>PRK09258 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>PRK07204 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>TIGR00748 HMG_CoA_syn_Arc hydroxymethylglutaryl-CoA synthase, putative Back     alignment and domain information
>TIGR00747 fabH 3-oxoacyl-(acyl-carrier-protein) synthase III Back     alignment and domain information
>PRK07515 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>cd00830 KAS_III Ketoacyl-acyl carrier protein synthase III (KASIII) initiates the elongation in type II fatty acid synthase systems Back     alignment and domain information
>PRK09352 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>COG3321 Polyketide synthase modules and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK12879 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>PRK05963 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PRK06840 hypothetical protein; Validated Back     alignment and domain information
>COG3425 PksG 3-hydroxy-3-methylglutaryl CoA synthase [Lipid metabolism] Back     alignment and domain information
>PRK04262 hypothetical protein; Provisional Back     alignment and domain information
>COG0332 FabH 3-oxoacyl-[acyl-carrier-protein] Back     alignment and domain information
>PLN03173 chalcone synthase; Provisional Back     alignment and domain information
>cd00831 CHS_like Chalcone and stilbene synthases; plant-specific polyketide synthases (PKS) and related enzymes, also called type III PKSs Back     alignment and domain information
>cd00827 init_cond_enzymes "initiating" condensing enzymes are a subclass of decarboxylating condensing enzymes, including beta-ketoacyl [ACP] synthase, type III and polyketide synthases, type III, which include chalcone synthase and related enzymes Back     alignment and domain information
>COG3424 BcsA Predicted naringenin-chalcone synthase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN03169 chalcone synthase family protein; Provisional Back     alignment and domain information
>PLN03172 chalcone synthase family protein; Provisional Back     alignment and domain information
>TIGR01835 HMG-CoA-S_prok 3-hydroxy-3-methylglutaryl CoA synthase, prokaryotic clade Back     alignment and domain information
>PF08541 ACP_syn_III_C: 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal ; InterPro: IPR013747 This domain is found on 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III 2 Back     alignment and domain information
>PLN03170 chalcone synthase; Provisional Back     alignment and domain information
>COG0332 FabH 3-oxoacyl-[acyl-carrier-protein] Back     alignment and domain information
>PLN03171 chalcone synthase-like protein; Provisional Back     alignment and domain information
>PRK06816 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>PRK08313 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PLN02326 3-oxoacyl-[acyl-carrier-protein] synthase III Back     alignment and domain information
>PLN02577 hydroxymethylglutaryl-CoA synthase Back     alignment and domain information
>PRK06158 thiolase; Provisional Back     alignment and domain information
>PLN02377 3-ketoacyl-CoA synthase Back     alignment and domain information
>CHL00203 fabH 3-oxoacyl-acyl-carrier-protein synthase 3; Provisional Back     alignment and domain information
>PLN03168 chalcone synthase; Provisional Back     alignment and domain information
>PRK07855 lipid-transfer protein; Provisional Back     alignment and domain information
>TIGR00748 HMG_CoA_syn_Arc hydroxymethylglutaryl-CoA synthase, putative Back     alignment and domain information
>PLN02854 3-ketoacyl-CoA synthase Back     alignment and domain information
>PLN02192 3-ketoacyl-CoA synthase Back     alignment and domain information
>PRK06065 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PLN03172 chalcone synthase family protein; Provisional Back     alignment and domain information
>PLN03171 chalcone synthase-like protein; Provisional Back     alignment and domain information
>PLN03169 chalcone synthase family protein; Provisional Back     alignment and domain information
>PLN02932 3-ketoacyl-CoA synthase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query216
1ulq_A401 Crystal Structure Of Tt0182 From Thermus Thermophil 2e-06
2wku_A392 Biosynthetic Thiolase From Z. Ramigera. The N316h M 1e-05
3goa_A387 Crystal Structure Of The Salmonella Typhimurium Fad 8e-05
1m4s_A392 Biosynthetic Thiolase, Cys89 Acetylated, Unliganded 8e-05
1qfl_A389 Biosynthetic Thiolase From Zoogloea Ramigera In Com 8e-05
1m1o_A392 Crystal Structure Of Biosynthetic Thiolase, C89a Mu 8e-05
1m1t_A392 Biosynthetic Thiolase, Q64a Mutant Length = 392 9e-05
2wl6_A392 Biosynthetic Thiolase From Z. Ramigera. The N316h-H 1e-04
2vu2_A392 Biosynthetic Thiolase From Z. Ramigera. Complex Wit 1e-04
1dlu_A389 Unliganded Biosynthetic Thiolase From Zoogloea Rami 1e-04
1afw_A393 The 1.8 Angstrom Crystal Structure Of The Dimeric P 1e-04
1pxt_A390 The 2.8 Angstroms Structure Of Peroxisomal 3-Ketoac 2e-04
2wkv_A392 Biosynthetic Thiolase From Z. Ramigera. Complex Of 2e-04
2wl5_A392 Biosynthetic Thiolase From Z. Ramigera. Complex Of 6e-04
2wl5_C392 Biosynthetic Thiolase From Z. Ramigera. Complex Of 6e-04
>pdb|1ULQ|A Chain A, Crystal Structure Of Tt0182 From Thermus Thermophilus Hb8 Length = 401 Back     alignment and structure 
Iteration: 1

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 43/164 (26%), Positives = 72/164 (43%), Gaps = 38/164 (23%)
Query: 59  TLEQIMNSPKIF---GPLTKLQCCPTSDGAAAAVLASEDFVRRYGFE----ANAVEIVGL 111
           +LE++     +F   G +T     P +DGAAA +L S+D+ + +G        A+ + G+
Sbjct: 230 SLEKLAALRPVFREGGTVTAGNSSPLNDGAAAVLLVSDDYAKAHGLRPLARVRAIAVAGV 289
Query: 112 EMATDTSSTFNSDSCIKLIGFDMTKAAADRLYEKTQIKPSDIDVIELHDCFSANELITYE 171
                           +++G     A    L E+  +  SD+ +IEL++ F+A  L    
Sbjct: 290 PP--------------RIMGIGPVPATRKAL-ERAGLSFSDLGLIELNEAFAAQALAVLR 334
Query: 172 ALGLCPVGKAKDFIDSGANTYGGKHVVNPSGGLISKGHPLGATG 215
              L      +D              +NP+GG I+ GHPLGA+G
Sbjct: 335 EWSLS----MED------------QRLNPNGGAIALGHPLGASG 362
>pdb|2WKU|A Chain A, Biosynthetic Thiolase From Z. Ramigera. The N316h Mutant. Length = 392 Back     alignment and structure
>pdb|3GOA|A Chain A, Crystal Structure Of The Salmonella Typhimurium Fada 3- Ketoacyl-Coa Thiolase Length = 387 Back     alignment and structure
>pdb|1M4S|A Chain A, Biosynthetic Thiolase, Cys89 Acetylated, Unliganded Form Length = 392 Back     alignment and structure
>pdb|1QFL|A Chain A, Biosynthetic Thiolase From Zoogloea Ramigera In Complex With A Reaction Intermediate. Length = 389 Back     alignment and structure
>pdb|1M1O|A Chain A, Crystal Structure Of Biosynthetic Thiolase, C89a Mutant, Complexed With Acetoacetyl-Coa Length = 392 Back     alignment and structure
>pdb|1M1T|A Chain A, Biosynthetic Thiolase, Q64a Mutant Length = 392 Back     alignment and structure
>pdb|2WL6|A Chain A, Biosynthetic Thiolase From Z. Ramigera. The N316h-H348n Mutant. Length = 392 Back     alignment and structure
>pdb|2VU2|A Chain A, Biosynthetic Thiolase From Z. Ramigera. Complex With S- Pantetheine-11-pivalate. Length = 392 Back     alignment and structure
>pdb|1DLU|A Chain A, Unliganded Biosynthetic Thiolase From Zoogloea Ramigera Length = 389 Back     alignment and structure
>pdb|1AFW|A Chain A, The 1.8 Angstrom Crystal Structure Of The Dimeric Peroxisomal Thiolase Of Saccharomyces Cerevisiae Length = 393 Back     alignment and structure
>pdb|1PXT|A Chain A, The 2.8 Angstroms Structure Of Peroxisomal 3-Ketoacyl-Coa Thiolase Of Saccharomyces Cerevisiae: A Five Layered A-B-A- B-A Structure, Constructed From Two Core Domains Of Identical Topology Length = 390 Back     alignment and structure
>pdb|2WKV|A Chain A, Biosynthetic Thiolase From Z. Ramigera. Complex Of The N316d Mutant With Coenzyme A. Length = 392 Back     alignment and structure
>pdb|2WL5|A Chain A, Biosynthetic Thiolase From Z. Ramigera. Complex Of The H348n Mutant With Coenzyme A. Length = 392 Back     alignment and structure
>pdb|2WL5|C Chain C, Biosynthetic Thiolase From Z. Ramigera. Complex Of The H348n Mutant With Coenzyme A. Length = 392 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query216
3goa_A387 3-ketoacyl-COA thiolase; metabolism, fatty acid, p 3e-14
1wdk_C390 3-ketoacyl-COA thiolase; alpha2BETA2 heterotetrame 1e-13
3svk_A407 Acetyl-COA acetyltransferase; ssgcid, NIH, niaid, 6e-13
1ulq_A401 Putative acetyl-COA acetyltransferase; structural 8e-11
4e1l_A395 Acetoacetyl-COA thiolase 2; 3-layer(ABA) sandwich, 2e-10
1afw_A393 3-ketoacetyl-COA thiolase; fatty acid metabolism; 3e-10
2wu9_A442 3-ketoacyl-COA thiolase 2, peroxisomal; cysteine o 3e-10
2vu1_A392 Acetyl-COA acetyltransferase; acyltransferase, PHB 4e-10
4dd5_A396 Acetyl-COA acetyltransferase; structural genomics, 4e-10
2iik_A418 3-ketoacyl-COA thiolase, peroxisomal; fatty acid m 4e-10
2ib8_A395 Acetyl-COA acetyltransferase; thiolase fold, potas 5e-10
1wl4_A397 Acetyl-coenzyme A acetyltransferase 2; thiolase fo 9e-10
3ss6_A394 Acetyl-COA acetyltransferase; structural genomics, 1e-09
>3goa_A 3-ketoacyl-COA thiolase; metabolism, fatty acid, phospholipid, IDP01071, acyltransferase, cytoplasm, fatty acid metabolism; 1.70A {Salmonella typhimurium} Length = 387 Back     alignment and structure
 Score = 69.4 bits (171), Expect = 3e-14
 Identities = 40/137 (29%), Positives = 57/137 (41%), Gaps = 26/137 (18%)

Query: 79  CPTSDGAAAAVLASEDFVRRYGFEANAVEIVGLEMATDTSSTFNSDSCIKLIGFDMTKAA 138
              SDGAAA ++ SE   R  G +  A  I  + +          D  I   G      A
Sbjct: 239 SALSDGAAAMLVMSESRARELGLKPRAR-IRSMAVV-------GCDPSIMGYG---PVPA 287

Query: 139 ADRLYEKTQIKPSDIDVIELHDCFSANELITYEALGLCPVGKAKDFIDSGANTYGGKHVV 198
           +    +K  +  SDIDV E+++ F+A  L   + LGL      K               +
Sbjct: 288 SKLALKKAGLSASDIDVFEMNEAFAAQILPCIKDLGLMEQIDEK---------------I 332

Query: 199 NPSGGLISKGHPLGATG 215
           N +GG I+ GHPLG +G
Sbjct: 333 NLNGGAIALGHPLGCSG 349
>1wdk_C 3-ketoacyl-COA thiolase; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: c.95.1.1 c.95.1.1 PDB: 1wdl_C* 1wdm_C* 2d3t_C* Length = 390 Back     alignment and structure
>3svk_A Acetyl-COA acetyltransferase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.20A {Mycobacterium avium} Length = 407 Back     alignment and structure
>1ulq_A Putative acetyl-COA acetyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 3.00A {Thermus thermophilus} SCOP: c.95.1.1 c.95.1.1 Length = 401 Back     alignment and structure
>4e1l_A Acetoacetyl-COA thiolase 2; 3-layer(ABA) sandwich, transferase; 2.00A {Clostridium difficile} Length = 395 Back     alignment and structure
>1afw_A 3-ketoacetyl-COA thiolase; fatty acid metabolism; 1.80A {Saccharomyces cerevisiae} SCOP: c.95.1.1 c.95.1.1 PDB: 1pxt_A Length = 393 Back     alignment and structure
>2wu9_A 3-ketoacyl-COA thiolase 2, peroxisomal; cysteine oxidation, fatty acid metabolism, oxylipin biosynthesis, plant lipid metabolism; 1.50A {Arabidopsis thaliana} PDB: 2c7y_A 2c7z_A 2wua_A Length = 442 Back     alignment and structure
>2vu1_A Acetyl-COA acetyltransferase; acyltransferase, PHB biosynthesis, thiolase FOL; HET: CSO OPI; 1.51A {Zoogloea ramigera} PDB: 1nl7_A* 1ou6_A* 2vu0_A* 1m4s_A* 2vu2_A* 2wkv_A* 2wku_A* 1m1t_A 1m3k_A 1m1o_A 1m3z_A* 2vtz_A* 2wl5_A* 2wkt_A* 2wl4_A* 1m4t_A* 2wl6_A 1qfl_A* 1dlv_A* 1dlu_A* ... Length = 392 Back     alignment and structure
>4dd5_A Acetyl-COA acetyltransferase; structural genomics, center for structural genomics of infec diseases, csgid, thiolase; 1.25A {Clostridium difficile} Length = 396 Back     alignment and structure
>2iik_A 3-ketoacyl-COA thiolase, peroxisomal; fatty acid metabolism, structural genomics, structural genom consortium, SGC, transferase; 2.55A {Homo sapiens} Length = 418 Back     alignment and structure
>2ib8_A Acetyl-COA acetyltransferase; thiolase fold, potassium ION, chloride, beta-alpha-beta-ALPH alpha-beta-BETA topology; HET: MES; 1.85A {Homo sapiens} PDB: 2ib7_A* 2ib9_A* 2ibu_A* 2ibw_A* 2iby_A* 2f2s_A* Length = 395 Back     alignment and structure
>1wl4_A Acetyl-coenzyme A acetyltransferase 2; thiolase fold; HET: COA; 1.55A {Homo sapiens} PDB: 1wl5_A Length = 397 Back     alignment and structure
>3ss6_A Acetyl-COA acetyltransferase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha beta; HET: CSO; 1.70A {Bacillus anthracis} Length = 394 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query216
1ulq_A401 Putative acetyl-COA acetyltransferase; structural 100.0
1afw_A393 3-ketoacetyl-COA thiolase; fatty acid metabolism; 100.0
2wu9_A442 3-ketoacyl-COA thiolase 2, peroxisomal; cysteine o 100.0
2vu1_A392 Acetyl-COA acetyltransferase; acyltransferase, PHB 100.0
3goa_A387 3-ketoacyl-COA thiolase; metabolism, fatty acid, p 100.0
1wl4_A397 Acetyl-coenzyme A acetyltransferase 2; thiolase fo 100.0
2iik_A418 3-ketoacyl-COA thiolase, peroxisomal; fatty acid m 100.0
1wdk_C390 3-ketoacyl-COA thiolase; alpha2BETA2 heterotetrame 100.0
3svk_A407 Acetyl-COA acetyltransferase; ssgcid, NIH, niaid, 100.0
4egv_A 520 Acetyl-COA acetyltransferase; NEW SUB-family, thio 100.0
4dd5_A396 Acetyl-COA acetyltransferase; structural genomics, 100.0
3ss6_A394 Acetyl-COA acetyltransferase; structural genomics, 100.0
4e1l_A395 Acetoacetyl-COA thiolase 2; 3-layer(ABA) sandwich, 100.0
2ib8_A395 Acetyl-COA acetyltransferase; thiolase fold, potas 100.0
3kzu_A428 3-oxoacyl-(acyl-carrier-protein) synthase II; seat 99.56
1j3n_A408 3-oxoacyl-(acyl-carrier protein) synthase II; cond 99.5
3o04_A413 LMO2201 protein, beta-keto-acyl carrier protein sy 99.49
3ho9_A427 3-oxoacyl-[acyl-carrier-protein] synthase 2; FABF, 99.48
1ox0_A430 Beta ketoacyl-acyl carrier protein synthase; trans 99.48
4ddo_A451 3-oxoacyl-[acyl-carrier-protein] synthase 2; ssgci 99.48
2wge_A416 3-oxoacyl-[acyl-carrier-protein] synthase 1; beta 99.48
2gp6_A434 3-oxoacyl-[acyl-carrier-protein] synthase 2; thiol 99.44
1tqy_A424 Beta-ketoacyl synthase/acyl transferase; alpha-bet 99.43
2ix4_A431 3-oxoacyl-[acyl-carrier-protein] synthase; beta-ke 99.42
2iwz_A438 3-oxoacyl-[acyl-carrier-protein] synthase; mitocho 99.42
1e5m_A416 KAS II, beta ketoacyl acyl carrier protein synthas 99.42
2gqd_A437 3-oxoacyl-[acyl-carrier-protein] synthase 2; dupli 99.41
1tqy_B415 Actinorhodin polyketide putative beta-ketoacyl SY; 99.41
4ewg_A412 Beta-ketoacyl synthase; ssgcid, structural genomic 99.39
2qo3_A 915 Eryaii erythromycin polyketide synthase modules 3; 99.35
2hg4_A 917 DEBS, 6-deoxyerythronolide B synthase; ketosynthas 99.31
3mqd_A428 Beta-ketoacyl synthase; ssgcid, ALS collaborative 99.17
2vba_A406 3-oxoacyl-[acyl-carrier-protein] synthase 1; cytop 99.13
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 98.97
2uv9_A 1878 Fatty acid synthase alpha subunits; fungal, dehydr 98.92
3zen_D 3089 Fatty acid synthase; transferase, mycolic acid bio 98.86
2pff_A 1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl 98.81
3hhd_A 965 Fatty acid synthase; transferase, multienzyme, meg 98.69
2ebd_A309 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, 98.59
1u6e_A335 3-oxoacyl-[acyl-carrier-protein] synthase III; tra 98.33
1zow_A313 3-oxoacyl-[acyl-carrier-protein] synthase III; FAB 98.31
1ub7_A322 3-oxoacyl-[acyl-carrier protein] synthase; fatty a 98.03
3tsy_A979 Fusion protein 4-coumarate--COA ligase 1, resvera 97.61
2x3e_A331 3-oxoacyl-[acyl-carrier-protein] synthase 3; HED, 97.61
2h84_A374 Steely1; thiolase-fold, type III polyketide syntha 97.53
1u0m_A382 Putative polyketide synthase; type III polyketide 97.5
1hnj_A317 Beta-ketoacyl-acyl carrier protein synthase III; F 97.44
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 97.37
1ted_A393 PKS18; thiolase fold, substrate binding tunnel, tr 97.29
4dfe_A333 3-oxoacyl-[acyl-carrier-protein] synthase 3; ssgci 97.1
3s21_A345 3-oxoacyl-[ACP] synthase III; non-decarboxylative 96.89
1mzj_A339 Beta-ketoacylsynthase III; beta-ketosynthase, arom 96.64
3il3_A323 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, 96.42
3gwa_A365 3-oxoacyl-(acyl-carrier-protein) synthase III; str 95.82
1xpm_A 396 3-hydroxy-3-methylglutaryl COA synthase; HMG-COA s 95.7
2d3m_A406 Pentaketide chromone synthase; chalcone synthase, 95.28
3led_A392 3-oxoacyl-acyl carrier protein synthase III; struc 95.17
3s3l_A357 CERJ; acyltransferase, FABH homologue, KS III homo 94.4
3lma_A347 Stage V sporulation protein AD (spovad); NESG, str 94.3
3euo_A379 Type III pentaketide synthase; alpha helix, acyltr 94.2
3e1h_A465 PKSIIINC, putative uncharacterized protein; resorc 94.05
3oit_A387 OS07G0271500 protein; type III polyketide synthase 92.03
2f82_A 450 HMG-COA synthase; HMGS1, transferase; 2.10A {Brass 91.45
3ov2_A393 Curcumin synthase; type III polyketide synthase, t 91.42
3h78_A359 PQS biosynthetic enzyme; PQSD, anthranilic acid, a 91.01
1ee0_A402 2-pyrone synthase; polyketide synthase, thiolase f 90.61
4efi_A354 3-oxoacyl-(acyl-carrier protein) synthase; structu 89.87
3sqz_A 425 Putative hydroxymethylglutaryl-COA synthase; thiol 88.49
2p0u_A413 Stilbenecarboxylate synthase 2; polyketide synthas 88.08
1xes_A413 Dihydropinosylvin synthase; native structure, tran 87.77
3a5r_A387 Benzalacetone synthase; chalcone synthase, type II 87.53
4ewp_A350 3-oxoacyl-[acyl-carrier-protein] synthase 3; trans 87.15
3awk_A402 Chalcone synthase-like polyketide synthase; type I 86.68
1i88_A389 CHS2, chalcone synthase 2; polyketide synthase, tr 86.09
3il6_A321 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, 82.74
2wya_A 460 Hydroxymethylglutaryl-COA synthase, mitochondrial; 82.56
3euo_A 379 Type III pentaketide synthase; alpha helix, acyltr 81.07
3v7i_A413 Putative polyketide synthase; type III polyketide 80.26
>1ulq_A Putative acetyl-COA acetyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 3.00A {Thermus thermophilus} SCOP: c.95.1.1 c.95.1.1 Back     alignment and structure
Probab=100.00  E-value=1.4e-40  Score=294.97  Aligned_cols=173  Identities=27%  Similarity=0.449  Sum_probs=154.5

Q ss_pred             HHHHHHHHHHHhCCCHHHHHHHHHHHHHHHhcCCCC-cCC------------------------ccCChhhhhCCCcccc
Q psy13256         17 FGNAGLEHMKLYGTKPEHFAKIAYKNHLHSTNNPNS-QFQ------------------------VEYTLEQIMNSPKIFG   71 (216)
Q Consensus        17 ~al~a~~~~~~~G~s~e~la~~a~~~~~~A~~np~a-~~r------------------------~~~t~e~~~~~~~i~~   71 (216)
                      |++.+++||++||+|||++++|++++|++|.+||.+ +|+                        +++|+|+|.++||+++
T Consensus       163 ~~~~a~~~~~~~g~sre~~~~~a~~s~~~A~~~~~ag~~~~ei~P~~~~~~~~~~~~~~d~~~r~~~t~e~~~~~rpif~  242 (401)
T 1ulq_A          163 MGETAENLAEMYGIRREEQDRFALLSHQKAVRAWEEGRFQDEVVPVPVKRGKEEILVEQDEGPRRDTSLEKLAALRPVFR  242 (401)
T ss_dssp             HHHHHHHHHHHHTCCHHHHHHHHHHHHHHHHHHHHTTTTTTTBCCEEEEETTEEEEECSCSCCCTTCCHHHHHHSCBSSS
T ss_pred             HHHHHHHHHHHhCCCHHHHHHHHHHHHHHHHhhhhcCCcccceeceeecCCCCceeeccccccCCCCCHHHHhhCCCccC
Confidence            799999999999999999999999999999999776 444                        3589999999999996


Q ss_pred             ---cccccCCCCCCCceeEEEEcCHHHHHHcCCCCCeEEEEEEEEecCCCCccCccchhhhcccchHHHHHHHHHHHcCC
Q psy13256         72 ---PLTKLQCCPTSDGAAAAVLASEDFVRRYGFEANAVEIVGLEMATDTSSTFNSDSCIKLIGFDMTKAAADRLYEKTQI  148 (216)
Q Consensus        72 ---pl~~~~~~~~~DGAaAvvl~s~~~A~~~g~~~~~v~i~g~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~al~~aGl  148 (216)
                         |+|++|||+++|||+||||+|+++|+++|.++. ++|+|++...+.|..+.          .+...+++++|+++|+
T Consensus       243 ~~G~vt~~~~~~~~dGAaavvL~s~~~A~~~g~~~~-a~i~g~~~~~~~p~~~~----------~~~~~a~~~al~~Agl  311 (401)
T 1ulq_A          243 EGGTVTAGNSSPLNDGAAAVLLVSDDYAKAHGLRPL-ARVRAIAVAGVPPRIMG----------IGPVPATRKALERAGL  311 (401)
T ss_dssp             TTCSCBGGGBCCCEEEEEEEEEEEHHHHHHTTCCCS-EEEEEEEEEECCGGGGG----------GTHHHHHHHHHHHTTC
T ss_pred             CCCCeechhcCCccchheEEEEecHHHHHHcCCCce-EEEEEEEEecCCccccc----------hhHHHHHHHHHHHcCC
Confidence               899999999999999999999999999998765 59999999886543221          1247899999999999


Q ss_pred             CCCCcCEEEecCccHHHHHHHHHHcCCCCCCcchhhhhcCCccCCCccccccCcchhcccCccCCCCC
Q psy13256        149 KPSDIDVIELHDCFSANELITYEALGLCPVGKAKDFIDSGANTYGGKHVVNPSGGLISKGHPLGATGM  216 (216)
Q Consensus       149 ~~~DId~~e~~d~fs~~~~~~~e~lGl~~~G~~~~~~~~g~~~~~g~~pvN~~GG~l~~Ghp~gatG~  216 (216)
                      +++|||++|+||+|+++++.++|+||||+++                .|+|++||.+++|||+||||+
T Consensus       312 ~~~dId~ie~heafa~~~l~~~~~lg~~~~~----------------~~vn~~Gg~~a~GHp~gAsG~  363 (401)
T 1ulq_A          312 SFSDLGLIELNEAFAAQALAVLREWSLSMED----------------QRLNPNGGAIALGHPLGASGA  363 (401)
T ss_dssp             CGGGCSEEEECCSBHHHHHHHHHHHTCCTTC----------------TTBSTTCCHHHHCCCHHHHHH
T ss_pred             CHHHcCEEEEecchHHHHHHHHHHcCCCCCC----------------CccCCCCcccccCCCcchHHH
Confidence            9999999999999999999999999999763                289999999999999999874
>1afw_A 3-ketoacetyl-COA thiolase; fatty acid metabolism; 1.80A {Saccharomyces cerevisiae} SCOP: c.95.1.1 c.95.1.1 PDB: 1pxt_A Back     alignment and structure
>2wu9_A 3-ketoacyl-COA thiolase 2, peroxisomal; cysteine oxidation, fatty acid metabolism, oxylipin biosynthesis, plant lipid metabolism; 1.50A {Arabidopsis thaliana} PDB: 2c7y_A 2c7z_A 2wua_A Back     alignment and structure
>2vu1_A Acetyl-COA acetyltransferase; acyltransferase, PHB biosynthesis, thiolase FOL; HET: CSO OPI; 1.51A {Zoogloea ramigera} PDB: 1nl7_A* 1ou6_A* 2vu0_A* 1m4s_A* 2vu2_A* 2wkv_A* 2wku_A* 1m1t_A 1m3k_A 1m1o_A 1m3z_A* 2vtz_A* 2wl5_A* 2wkt_A* 2wl4_A* 1m4t_A* 2wl6_A 1qfl_A* 1dlv_A* 1dlu_A* ... Back     alignment and structure
>3goa_A 3-ketoacyl-COA thiolase; metabolism, fatty acid, phospholipid, IDP01071, acyltransferase, cytoplasm, fatty acid metabolism; 1.70A {Salmonella typhimurium} Back     alignment and structure
>1wl4_A Acetyl-coenzyme A acetyltransferase 2; thiolase fold; HET: COA; 1.55A {Homo sapiens} PDB: 1wl5_A Back     alignment and structure
>2iik_A 3-ketoacyl-COA thiolase, peroxisomal; fatty acid metabolism, structural genomics, structural genom consortium, SGC, transferase; 2.55A {Homo sapiens} Back     alignment and structure
>1wdk_C 3-ketoacyl-COA thiolase; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: c.95.1.1 c.95.1.1 PDB: 1wdl_C* 1wdm_C* 2d3t_C* Back     alignment and structure
>3svk_A Acetyl-COA acetyltransferase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.20A {Mycobacterium avium} Back     alignment and structure
>4egv_A Acetyl-COA acetyltransferase; NEW SUB-family, thiolase fold; 2.71A {Mycobacterium smegmatis} Back     alignment and structure
>4dd5_A Acetyl-COA acetyltransferase; structural genomics, center for structural genomics of infec diseases, csgid, thiolase; 1.25A {Clostridium difficile} Back     alignment and structure
>3ss6_A Acetyl-COA acetyltransferase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha beta; HET: CSO; 1.70A {Bacillus anthracis} Back     alignment and structure
>4e1l_A Acetoacetyl-COA thiolase 2; 3-layer(ABA) sandwich, transferase; 2.00A {Clostridium difficile} Back     alignment and structure
>2ib8_A Acetyl-COA acetyltransferase; thiolase fold, potassium ION, chloride, beta-alpha-beta-ALPH alpha-beta-BETA topology; HET: MES; 1.85A {Homo sapiens} PDB: 2ib7_A* 2ib9_A* 2ibu_A* 2ibw_A* 2iby_A* 2f2s_A* Back     alignment and structure
>3kzu_A 3-oxoacyl-(acyl-carrier-protein) synthase II; seattle structural genomics center for infectious disease, ssgcid, acyltransferase; 1.75A {Brucella melitensis} PDB: 3e60_A Back     alignment and structure
>1j3n_A 3-oxoacyl-(acyl-carrier protein) synthase II; condensing enzymes, fatty acid elongation, acyl-carrier protein (ACP); HET: CIT; 2.00A {Thermus thermophilus} SCOP: c.95.1.1 c.95.1.1 Back     alignment and structure
>3o04_A LMO2201 protein, beta-keto-acyl carrier protein synthase II; csgid, structural genomics; 1.85A {Listeria monocytogenes} Back     alignment and structure
>3ho9_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; FABF, platensimycin, platencin A1, KAS2, acyltransferase, fatty acid biosynthesis; HET: N3A; 1.90A {Escherichia coli} PDB: 3hnz_A* 3ho2_A* 3i8p_A* 3g11_A* 2gfx_A* 3g0y_A* 2gfv_A* 2gfw_A 2gfy_A* 1kas_A 1b3n_A Back     alignment and structure
>1ox0_A Beta ketoacyl-acyl carrier protein synthase; transferase; 1.30A {Streptococcus pneumoniae} SCOP: c.95.1.1 c.95.1.1 PDB: 1oxh_A 2alm_A 2rjt_A Back     alignment and structure
>4ddo_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; ssgcid, struct genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia vietnamiensis} PDB: 4f32_A* Back     alignment and structure
>2wge_A 3-oxoacyl-[acyl-carrier-protein] synthase 1; beta ketoacyl synthase I thiolactomycin, cytoplasm, transferase, acyltransferase; HET: TLM; 1.80A {Mycobacterium tuberculosis} PDB: 2wgd_A* 2wgg_A* 2wgf_A* Back     alignment and structure
>2gp6_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; thiolase fold, structural genomics, PSI, protein structure initiative; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>1tqy_A Beta-ketoacyl synthase/acyl transferase; alpha-beta-alpha-beta-alpha, heterodimer, transferase; 2.00A {Streptomyces coelicolor} SCOP: c.95.1.1 c.95.1.1 Back     alignment and structure
>2ix4_A 3-oxoacyl-[acyl-carrier-protein] synthase; beta-ketoacyl-(acyl carrier protein) synthase, lipid metabol condensing enzyme; 1.95A {Arabidopsis thaliana} SCOP: c.95.1.1 c.95.1.1 PDB: 1w0i_A Back     alignment and structure
>2iwz_A 3-oxoacyl-[acyl-carrier-protein] synthase; mitochondria, mitochondrion, lipid synthesis, fatty acid SYN fatty acid biosynthesis; 1.65A {Homo sapiens} PDB: 2iwy_A 2c9h_A Back     alignment and structure
>1e5m_A KAS II, beta ketoacyl acyl carrier protein synthase II; condensing enzyme, biosynthetic role, carbon-carbon bond formation; 1.54A {Synechocystis SP} SCOP: c.95.1.1 c.95.1.1 Back     alignment and structure
>2gqd_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; duplicated babababb fold, transferase; 2.30A {Staphylococcus aureus} Back     alignment and structure
>1tqy_B Actinorhodin polyketide putative beta-ketoacyl SY; alpha-beta-alpha-beta-alpha, heterodimer, transferase; 2.00A {Streptomyces coelicolor} SCOP: c.95.1.1 c.95.1.1 Back     alignment and structure
>4ewg_A Beta-ketoacyl synthase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, transferase; 2.25A {Burkholderia phymatum} Back     alignment and structure
>2qo3_A Eryaii erythromycin polyketide synthase modules 3; ketosynthase, acyltransferase, phosphopantetheine, transfera; 2.59A {Saccharopolyspora erythraea} Back     alignment and structure
>2hg4_A DEBS, 6-deoxyerythronolide B synthase; ketosynthase, acyltransferase, module 5, transferase; 2.73A {Saccharopolyspora erythraea} Back     alignment and structure
>3mqd_A Beta-ketoacyl synthase; ssgcid, ALS collaborative crystallography, beta-ketoacyl SYN brucella melitensis, fragments of LIFE; HET: 3MQ; 1.25A {Brucella melitensis biovar abortus} PDB: 3lrf_A* 3u0e_A* 3u0f_A* Back     alignment and structure
>2vba_A 3-oxoacyl-[acyl-carrier-protein] synthase 1; cytoplasm, antibiotic, transferase, amino-thiazole, acyltransferase, lipid synthesis; HET: P4T; 1.36A {Escherichia coli} SCOP: c.95.1.1 c.95.1.1 PDB: 1fj4_A* 1g5x_A 2aq7_A* 1fj8_A* 2aqb_A 2bui_A 2buh_A 2vb7_A* 2vb8_A 2vb9_A* 1h4f_A 1dd8_A 2cdh_A 2bz4_A 2byz_A 2bz3_A* 2byy_A* 1f91_A* 2cf2_A 2byw_A ... Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Back     alignment and structure
>3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* Back     alignment and structure
>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3hhd_A Fatty acid synthase; transferase, multienzyme, megasynthase, fatty acid synthesis, acetylation, cytoplasm, fatty acid biosynthesis, hydrolase; 2.15A {Homo sapiens} PDB: 2jfk_A* 2jfd_A Back     alignment and structure
>2ebd_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, aquifex VF5, lipid metabolism, structural genomics; 2.10A {Aquifex aeolicus} Back     alignment and structure
>1u6e_A 3-oxoacyl-[acyl-carrier-protein] synthase III; transferase; 1.85A {Mycobacterium tuberculosis} SCOP: c.95.1.2 c.95.1.2 PDB: 1u6s_A* 1m1m_A 1hzp_A* 2qnx_A* 2qnz_A* 2qo1_A* 2qx1_A* 2qo0_A* 2qny_A* 2ahb_A 2aj9_A Back     alignment and structure
>1zow_A 3-oxoacyl-[acyl-carrier-protein] synthase III; FABH, fatty acid biosynthesis, transferase; 2.00A {Staphylococcus aureus subsp} PDB: 3il7_A Back     alignment and structure
>1ub7_A 3-oxoacyl-[acyl-carrier protein] synthase; fatty acid synthesis, beta-ketoacyl-ACP synthase III, FABH; 2.30A {Thermus thermophilus} SCOP: c.95.1.2 c.95.1.2 Back     alignment and structure
>3tsy_A Fusion protein 4-coumarate--COA ligase 1, resvera synthase; transferase; 3.10A {Arabidospis thaliana} Back     alignment and structure
>2x3e_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; HED, transferase, acyltransferase, lipid synthesis, multifun enzyme; 1.81A {Pseudomonas aeruginosa} Back     alignment and structure
>2h84_A Steely1; thiolase-fold, type III polyketide synthase, PKS, chalcone-S synthase superfamily, type I PKS; HET: P6G; 2.90A {Dictyostelium discoideum} Back     alignment and structure
>1u0m_A Putative polyketide synthase; type III polyketide synthase, PKS, bacterial, thiolase fold, beta-alpha-beta-alpha fold, catalytic triad; HET: 15P; 2.22A {Streptomyces coelicolor} SCOP: c.95.1.2 c.95.1.2 Back     alignment and structure
>1hnj_A Beta-ketoacyl-acyl carrier protein synthase III; FABH, transferase; HET: MLC; 1.46A {Escherichia coli} SCOP: c.95.1.2 c.95.1.2 PDB: 1hn9_A* 1hnh_A* 1hnd_A* 1hnk_A 1mzs_A* 2eft_A* 2gyo_A* 3il9_A 1ebl_A* Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>1ted_A PKS18; thiolase fold, substrate binding tunnel, transferase; HET: MYR; 2.25A {Mycobacterium tuberculosis} SCOP: c.95.1.2 PDB: 1tee_A Back     alignment and structure
>4dfe_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; ssgcid, seattle structural genomics center for infectious DI transferase; 2.35A {Burkholderia xenovorans} Back     alignment and structure
>3s21_A 3-oxoacyl-[ACP] synthase III; non-decarboxylative claisen condensation reaction, transfera; HET: CER; 1.70A {Xanthomonas campestris PV} PDB: 3s23_A* 3row_A 3s1z_A 3s20_A* 3fk5_A Back     alignment and structure
>1mzj_A Beta-ketoacylsynthase III; beta-ketosynthase, aromatic polyketide, biosynthetic engineering, catalytic triad, transferase; HET: COA; 2.10A {Streptomyces SP} SCOP: c.95.1.2 c.95.1.2 Back     alignment and structure
>3il3_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, fatty acid biosynthesis, antibiotic, acyltransferase, cytoplasm, lipid synthesis; 2.70A {Haemophilus influenzae} Back     alignment and structure
>3gwa_A 3-oxoacyl-(acyl-carrier-protein) synthase III; structural genomics, synthetase; 1.60A {Burkholderia pseudomallei} PDB: 3gwe_A Back     alignment and structure
>1xpm_A 3-hydroxy-3-methylglutaryl COA synthase; HMG-COA synthase, HMGS, coenzyme A, thiolase fold, condensing enzyme; HET: HMG CAA; 1.60A {Staphylococcus aureus subsp} SCOP: c.95.1.2 c.95.1.2 PDB: 1xpl_A* 1xpk_A* 1tvz_A 1txt_A* Back     alignment and structure
>2d3m_A Pentaketide chromone synthase; chalcone synthase, polyketide synthase, transferase; HET: COA; 1.60A {Aloe arborescens} PDB: 2d51_A 2d52_A* Back     alignment and structure
>3led_A 3-oxoacyl-acyl carrier protein synthase III; structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.45A {Rhodopseudomonas palustris} Back     alignment and structure
>3s3l_A CERJ; acyltransferase, FABH homologue, KS III homologue, dimethyl transfer, transferase; 2.00A {Streptomyces tendae} PDB: 3t5y_A* 3t6s_A* 3t8e_A 3t5y_B* Back     alignment and structure
>3lma_A Stage V sporulation protein AD (spovad); NESG, structural genomics, PSI-2, protein structure initiative; 1.99A {Bacillus licheniformis} PDB: 3lm6_A Back     alignment and structure
>3euo_A Type III pentaketide synthase; alpha helix, acyltransferase, transferase; 1.75A {Neurospora crassa} PDB: 3eut_A* 3euq_A* Back     alignment and structure
>3e1h_A PKSIIINC, putative uncharacterized protein; resorcinolic lipid synthase, type III PKS, acyltransferase, transferase; 2.58A {Neurospora crassa} Back     alignment and structure
>3oit_A OS07G0271500 protein; type III polyketide synthases, transferase; 2.00A {Oryza sativa} PDB: 3ale_A Back     alignment and structure
>2f82_A HMG-COA synthase; HMGS1, transferase; 2.10A {Brassica juncea} PDB: 2f9a_A* 2fa0_A* 2fa3_A* Back     alignment and structure
>3ov2_A Curcumin synthase; type III polyketide synthase, transferase; 2.32A {Curcuma longa} PDB: 3ov3_A Back     alignment and structure
>3h78_A PQS biosynthetic enzyme; PQSD, anthranilic acid, anthraniloyl-COA, transferase; HET: BE2; 1.70A {Pseudomonas aeruginosa PAO1} PDB: 3h76_A 3h77_A* Back     alignment and structure
>1ee0_A 2-pyrone synthase; polyketide synthase, thiolase fold, transferase; HET: CAA; 2.05A {Gerbera hybrid cultivar} SCOP: c.95.1.2 c.95.1.2 PDB: 1qlv_A Back     alignment and structure
>4efi_A 3-oxoacyl-(acyl-carrier protein) synthase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.35A {Burkholderia xenovorans} Back     alignment and structure
>3sqz_A Putative hydroxymethylglutaryl-COA synthase; thiolase fold, HMG_COA synthase, transferase; HET: COA; 1.20A {Streptococcus mutans} PDB: 3leh_A Back     alignment and structure
>2p0u_A Stilbenecarboxylate synthase 2; polyketide synthase, PKS type transferase; 1.90A {Marchantia polymorpha} Back     alignment and structure
>1xes_A Dihydropinosylvin synthase; native structure, transferase; HET: 3IO; 1.70A {Pinus sylvestris} PDB: 1xet_A* 1u0u_A Back     alignment and structure
>3a5r_A Benzalacetone synthase; chalcone synthase, type III polyketide synthase, transferase, acyltransferase; HET: HC4; 1.60A {Rheum palmatum} PDB: 3a5q_A* 3a5s_A Back     alignment and structure
>4ewp_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; transferase; 2.20A {Micrococcus luteus nctc 2665} Back     alignment and structure
>3awk_A Chalcone synthase-like polyketide synthase; type III polyketide synthase, transferase; 2.00A {Huperzia serrata} PDB: 3awj_A Back     alignment and structure
>1i88_A CHS2, chalcone synthase 2; polyketide synthase, transferase; 1.45A {Medicago sativa} SCOP: c.95.1.2 c.95.1.2 PDB: 1i89_A 1i86_A 1i8b_A 1bi5_A 1cml_A* 1d6f_A* 1chw_A* 1cgz_A* 1cgk_A* 1bq6_A* 1jwx_A 1d6i_A 1d6h_A* 1u0v_A 1u0w_A* 1z1e_A* 1z1f_A* Back     alignment and structure
>3il6_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, fatty acid biosynthesis, antibiotic, acyltransferase, cytoplasm, lipid synthesis; HET: B83; 2.50A {Enterococcus faecalis} PDB: 3il5_A* 3il4_A* Back     alignment and structure
>2wya_A Hydroxymethylglutaryl-COA synthase, mitochondrial; steroid biosynthesis, cholesterol biosynthesis, mitochondrion, phosphoprotein; HET: HMG; 1.70A {Homo sapiens} Back     alignment and structure
>3euo_A Type III pentaketide synthase; alpha helix, acyltransferase, transferase; 1.75A {Neurospora crassa} PDB: 3eut_A* 3euq_A* Back     alignment and structure
>3v7i_A Putative polyketide synthase; type III polyketide synthase, acyltransferase, transferase,; 2.90A {Streptomyces coelicolor} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 216
d1m3ka2124 c.95.1.1 (A:269-392) Biosynthetic thiolase {Zooglo 3e-06
d1ulqa1273 c.95.1.1 (A:3-275) Beta-ketoadipyl CoA thiolase {T 2e-05
d1m3ka1268 c.95.1.1 (A:1-268) Biosynthetic thiolase {Zoogloea 4e-05
d1afwa2124 c.95.1.1 (A:294-417) Thiolase {Baker's yeast (Sacc 0.001
d1wdkc1262 c.95.1.1 (C:2-263) Fatty oxidation complex beta su 0.003
d1ulqa2125 c.95.1.1 (A:276-400) Beta-ketoadipyl CoA thiolase 0.004
d1afwa1269 c.95.1.1 (A:25-293) Thiolase {Baker's yeast (Sacch 0.004
>d1m3ka2 c.95.1.1 (A:269-392) Biosynthetic thiolase {Zoogloea ramigera [TaxId: 350]} Length = 124 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Thiolase-like
superfamily: Thiolase-like
family: Thiolase-related
domain: Biosynthetic thiolase
species: Zoogloea ramigera [TaxId: 350]

 Score = 42.6 bits (100), Expect = 3e-06
 Identities = 21/78 (26%), Positives = 36/78 (46%), Gaps = 18/78 (23%)

Query: 138 AADRLYEKTQIKPSDIDVIELHDCFSANELITYEALGLCPVGKAKDFIDSGANTYGGKHV 197
           A+ +  E+   K  D+D++E ++ F+A      + LG                      +
Sbjct: 27  ASRKALERAGWKIGDLDLVEANEAFAAQACAVNKDLGW------------------DPSI 68

Query: 198 VNPSGGLISKGHPLGATG 215
           VN +GG I+ GHP+GA+G
Sbjct: 69  VNVNGGAIAIGHPIGASG 86
>d1ulqa1 c.95.1.1 (A:3-275) Beta-ketoadipyl CoA thiolase {Thermus thermophilus [TaxId: 274]} Length = 273 Back     information, alignment and structure
>d1m3ka1 c.95.1.1 (A:1-268) Biosynthetic thiolase {Zoogloea ramigera [TaxId: 350]} Length = 268 Back     information, alignment and structure
>d1afwa2 c.95.1.1 (A:294-417) Thiolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 124 Back     information, alignment and structure
>d1wdkc1 c.95.1.1 (C:2-263) Fatty oxidation complex beta subunit (3-ketoacyl-CoA thiolase) {Pseudomonas fragi [TaxId: 296]} Length = 262 Back     information, alignment and structure
>d1ulqa2 c.95.1.1 (A:276-400) Beta-ketoadipyl CoA thiolase {Thermus thermophilus [TaxId: 274]} Length = 125 Back     information, alignment and structure
>d1afwa1 c.95.1.1 (A:25-293) Thiolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 269 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query216
d1afwa2124 Thiolase {Baker's yeast (Saccharomyces cerevisiae) 99.87
d1m3ka2124 Biosynthetic thiolase {Zoogloea ramigera [TaxId: 3 99.85
d1ulqa2125 Beta-ketoadipyl CoA thiolase {Thermus thermophilus 99.83
d1wdkc2128 Fatty oxidation complex beta subunit (3-ketoacyl-C 99.81
d1ulqa1273 Beta-ketoadipyl CoA thiolase {Thermus thermophilus 99.64
d1m3ka1268 Biosynthetic thiolase {Zoogloea ramigera [TaxId: 3 99.61
d1wdkc1262 Fatty oxidation complex beta subunit (3-ketoacyl-C 99.61
d1afwa1269 Thiolase {Baker's yeast (Saccharomyces cerevisiae) 99.55
d1tqyb2194 Actinorhodin polyketide putative beta-ketoacyl syn 98.93
d1tqya2205 Actinorhodin polyketide putative beta-ketoacyl syn 98.89
d1ox0a2158 Beta-ketoacyl-ACP synthase II {Streptococcus pneum 98.06
d1e5ma2161 Beta-ketoacyl-ACP synthase II {Synechocystis sp. [ 98.01
d2ix4a2161 Beta-ketoacyl-ACP synthase II {Thale cress (Arabid 97.72
d2gfva2161 Beta-ketoacyl-ACP synthase II {Escherichia coli [T 97.72
d1j3na2159 Beta-ketoacyl-ACP synthase II {Thermus thermophilu 97.71
d2vbaa2151 Beta-ketoacyl-ACP synthase I {Escherichia coli [Ta 96.16
d1teda_372 Polyketide synthase PKS18 {Mycobacterium tuberculo 95.75
d1u6ea2148 Ketoacyl-ACP synthase III (FabH) {Mycobacterium tu 95.59
d1ub7a2149 Ketoacyl-ACP synthase III (FabH) {Thermus thermoph 95.33
d1mzja2153 Priming beta-ketosynthase from the r1128 polyketid 93.82
d1hnja2143 Ketoacyl-ACP synthase III (FabH) {Escherichia coli 93.43
d1u0ma2148 Putative polyketide synthase SCO1206 {Streptomyces 91.76
d1ub7a1172 Ketoacyl-ACP synthase III (FabH) {Thermus thermoph 86.47
d1u0ma1200 Putative polyketide synthase SCO1206 {Streptomyces 82.29
>d1afwa2 c.95.1.1 (A:294-417) Thiolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Thiolase-like
superfamily: Thiolase-like
family: Thiolase-related
domain: Thiolase
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=99.87  E-value=5.4e-23  Score=150.89  Aligned_cols=88  Identities=28%  Similarity=0.488  Sum_probs=79.0

Q ss_pred             cCCCCCeEEEEEEEEecCCCCccCccchhhhcccchHHHHHHHHHHHcCCCCCCcCEEEecCccHHHHHHHHHHcCCCCC
Q psy13256         99 YGFEANAVEIVGLEMATDTSSTFNSDSCIKLIGFDMTKAAADRLYEKTQIKPSDIDVIELHDCFSANELITYEALGLCPV  178 (216)
Q Consensus        99 ~g~~~~~v~i~g~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~al~~aGl~~~DId~~e~~d~fs~~~~~~~e~lGl~~~  178 (216)
                      +|++|.+ +|++++....+|..+...          ...|++++|+++|++++|||+||+||+|+.+.+.++++|++.++
T Consensus         1 Lgl~plA-ri~~~a~~g~~P~~m~~g----------Pv~Ai~klL~r~gl~~~Did~~EinEAFA~q~l~~~~~l~id~~   69 (124)
T d1afwa2           1 LNLPVLG-RYIDFQTVGVPPEIMGVG----------PAYAIPKVLEATGLQVQDIDIFEINEAFAAQALYCIHKLGIDLN   69 (124)
T ss_dssp             TTCCCCE-EEEEEEEEECCGGGGGGH----------HHHHHHHHHHHHTCCGGGCSEEEECCSBHHHHHHHHHHHTCCGG
T ss_pred             CCCcEEE-EEEEEEEEecCHHHhhhC----------hHHHHHHHHHHcCCCcccCcEEEeccchhHHHHHHHHHcCCChh
Confidence            4788888 899999988776554422          37899999999999999999999999999999999999999876


Q ss_pred             CcchhhhhcCCccCCCccccccCcchhcccCccCCCC
Q psy13256        179 GKAKDFIDSGANTYGGKHVVNPSGGLISKGHPLGATG  215 (216)
Q Consensus       179 G~~~~~~~~g~~~~~g~~pvN~~GG~l~~Ghp~gatG  215 (216)
                                        ++|++||++++|||+||||
T Consensus        70 ------------------kvN~~GGaiAlGHP~GaSG   88 (124)
T d1afwa2          70 ------------------KVNPRGGAIALGHPLGCTG   88 (124)
T ss_dssp             ------------------GBSTTCCHHHHCBCTTTHH
T ss_pred             ------------------hccccCccceecCCcCCch
Confidence                              7999999999999999998
>d1m3ka2 c.95.1.1 (A:269-392) Biosynthetic thiolase {Zoogloea ramigera [TaxId: 350]} Back     information, alignment and structure
>d1ulqa2 c.95.1.1 (A:276-400) Beta-ketoadipyl CoA thiolase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wdkc2 c.95.1.1 (C:264-391) Fatty oxidation complex beta subunit (3-ketoacyl-CoA thiolase) {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1ulqa1 c.95.1.1 (A:3-275) Beta-ketoadipyl CoA thiolase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1m3ka1 c.95.1.1 (A:1-268) Biosynthetic thiolase {Zoogloea ramigera [TaxId: 350]} Back     information, alignment and structure
>d1wdkc1 c.95.1.1 (C:2-263) Fatty oxidation complex beta subunit (3-ketoacyl-CoA thiolase) {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1afwa1 c.95.1.1 (A:25-293) Thiolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tqyb2 c.95.1.1 (B:210-403) Actinorhodin polyketide putative beta-ketoacyl synthase 2, KasB {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1tqya2 c.95.1.1 (A:219-423) Actinorhodin polyketide putative beta-ketoacyl synthase 1, KasA {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1ox0a2 c.95.1.1 (A:252-409) Beta-ketoacyl-ACP synthase II {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1e5ma2 c.95.1.1 (A:256-416) Beta-ketoacyl-ACP synthase II {Synechocystis sp. [TaxId: 1143]} Back     information, alignment and structure
>d2ix4a2 c.95.1.1 (A:301-461) Beta-ketoacyl-ACP synthase II {Thale cress (Arabidopsis thaliana), mitochondrial isoform [TaxId: 3702]} Back     information, alignment and structure
>d2gfva2 c.95.1.1 (A:252-412) Beta-ketoacyl-ACP synthase II {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j3na2 c.95.1.1 (A:250-408) Beta-ketoacyl-ACP synthase II {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2vbaa2 c.95.1.1 (A:254-404) Beta-ketoacyl-ACP synthase I {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1teda_ c.95.1.2 (A:) Polyketide synthase PKS18 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1u6ea2 c.95.1.2 (A:175-317) Ketoacyl-ACP synthase III (FabH) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ub7a2 c.95.1.2 (A:174-322) Ketoacyl-ACP synthase III (FabH) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mzja2 c.95.1.2 (A:184-336) Priming beta-ketosynthase from the r1128 polyketide biosynthetic pathway {Streptomyces sp. r1128 [TaxId: 140437]} Back     information, alignment and structure
>d1hnja2 c.95.1.2 (A:175-317) Ketoacyl-ACP synthase III (FabH) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u0ma2 c.95.1.2 (A:202-349) Putative polyketide synthase SCO1206 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1ub7a1 c.95.1.2 (A:2-173) Ketoacyl-ACP synthase III (FabH) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1u0ma1 c.95.1.2 (A:2-201) Putative polyketide synthase SCO1206 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure