Psyllid ID: psy13267


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-
MLPDFHSSKSSGRSSDDEGVEEEEEVEEEEEEEEEEEEEEEEEEEEEEEVEMVKEAEVITKAPLDCMCRPCTSIEESAVIPQEIVNYADEAPISGHFAKPE
ccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHcccccccccccccccccccHHHHHHHHcccccccccccccc
ccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEEEEEEEccccHccccccccccHHcHcHHHHHHHHccccccccccccc
mlpdfhsskssgrssddegveeeeeveeeeeeeeeeeeeeeeeeeEEEEVEMVKEAEVitkapldcmcrpctsieesavipqeivnyadeapisghfakpe
mlpdfhsskssgrssddegveeeeeveeeeeeeeeeeeeeeeeeeeeeevemVKEAEVITKAPLDCMCRPCTSIEESAVIPQEIVNYADEAPISGHFAKPE
MLPDFHsskssgrssDDEGveeeeeveeeeeeeeeeeeeeeeeeeeeeeveMVKEAEVITKAPLDCMCRPCTSIEESAVIPQEIVNYADEAPISGHFAKPE
*********************************************************VITKAPLDCMCRPCTSIEESAVIPQEIVNYAD************
********K*****************************************EMVKEAEVITKAPLDCMCRPCTSIEESAVIPQEIVNYADEAPI********
******************************************************EAEVITKAPLDCMCRPCTSIEESAVIPQEIVNYADEAPISGHFAKPE
*********************************************EEEEVEMVKEAEVITKAPLDCMCRPCTSIEESAVIPQEIVNYADEAPISG******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLPDFHSSKSSGRSSDxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxEVITKAPLDCMCRPCTSIEESAVIPQEIVNYADEAPISGHFAKPE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query101 2.2.26 [Sep-21-2011]
Q9VD83173 Bursicon OS=Drosophila me yes N/A 0.455 0.265 0.652 6e-13
A2VB89153 Bursicon OS=Apis mellifer yes N/A 0.455 0.300 0.645 1e-11
Q4FCM6156 Bursicon OS=Manduca sexta N/A N/A 0.425 0.275 0.674 2e-11
Q66Q82163 Bursicon OS=Anopheles gam yes N/A 0.455 0.282 0.586 9e-11
Q566B1160 Bursicon OS=Bombyx mori G N/A N/A 0.425 0.268 0.627 2e-10
P85316163 Bursicon OS=Aedes aegypti N/A N/A 0.455 0.282 0.565 6e-10
P85315171 Bursicon OS=Culex pipiens N/A N/A 0.455 0.269 0.543 3e-09
>sp|Q9VD83|BURS_DROME Bursicon OS=Drosophila melanogaster GN=burs PE=1 SV=1 Back     alignment and function desciption
 Score = 72.8 bits (177), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 38/46 (82%)

Query: 54  KEAEVITKAPLDCMCRPCTSIEESAVIPQEIVNYADEAPISGHFAK 99
           K  +V+TKAPL+CMCRPCTSIEES +IPQEI  Y+DE P++ HF +
Sbjct: 124 KFKKVLTKAPLECMCRPCTSIEESGIIPQEIAGYSDEGPLNNHFRR 169




Final heterodimeric neurohormone released at the end of the molting cycle, involved in the sclerotization (tanning) of the insect cuticle, melanization and wing spreading. Heterodimer specifically activates the G protein-coupled receptor rk.
Drosophila melanogaster (taxid: 7227)
>sp|A2VB89|BURS_APIME Bursicon OS=Apis mellifera GN=burs PE=2 SV=1 Back     alignment and function description
>sp|Q4FCM6|BURS_MANSE Bursicon OS=Manduca sexta GN=burs PE=2 SV=1 Back     alignment and function description
>sp|Q66Q82|BURS_ANOGA Bursicon OS=Anopheles gambiae GN=burs124 PE=2 SV=1 Back     alignment and function description
>sp|Q566B1|BURS_BOMMO Bursicon OS=Bombyx mori GN=burs PE=2 SV=1 Back     alignment and function description
>sp|P85316|BURS_AEDAE Bursicon OS=Aedes aegypti GN=burs124 PE=3 SV=1 Back     alignment and function description
>sp|P85315|BURS_CULPP Bursicon OS=Culex pipiens pipiens GN=burs124 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query101
166851830162 bursicon precursor [Tribolium castaneum] 0.455 0.283 0.717 3e-12
76160855143 bursicon alpha [Tribolium castaneum] 0.455 0.321 0.717 4e-12
193592093159 PREDICTED: bursicon-like [Acyrthosiphon 0.930 0.591 0.442 8e-12
195036590173 GH18623 [Drosophila grimshawi] gi|193893 0.455 0.265 0.652 2e-11
195108905172 GI24294 [Drosophila mojavensis] gi|19391 0.455 0.267 0.652 2e-11
194904213173 GG17481 [Drosophila erecta] gi|194916200 0.455 0.265 0.652 2e-11
195390552174 GJ23072 [Drosophila virilis] gi|19415201 0.455 0.264 0.652 2e-11
195453728173 GK12896 [Drosophila willistoni] gi|19417 0.455 0.265 0.652 2e-11
195502354173 GE10240 [Drosophila yakuba] gi|194184288 0.455 0.265 0.652 2e-11
24648796173 bursicon [Drosophila melanogaster] gi|19 0.455 0.265 0.652 2e-11
>gi|166851830|ref|NP_001107779.1| bursicon precursor [Tribolium castaneum] gi|74325216|gb|ABA03053.1| bursicon [Tribolium castaneum] gi|270008186|gb|EFA04634.1| bursicon [Tribolium castaneum] Back     alignment and taxonomy information
 Score = 75.9 bits (185), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 33/46 (71%), Positives = 37/46 (80%)

Query: 54  KEAEVITKAPLDCMCRPCTSIEESAVIPQEIVNYADEAPISGHFAK 99
           K  +V TKAPL+CMCRPCT +EESAVIPQEI  YADE P+S HF K
Sbjct: 113 KFIKVTTKAPLECMCRPCTGVEESAVIPQEIAGYADEGPLSNHFLK 158




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|76160855|gb|ABA40402.1| bursicon alpha [Tribolium castaneum] Back     alignment and taxonomy information
>gi|193592093|ref|XP_001946341.1| PREDICTED: bursicon-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|195036590|ref|XP_001989753.1| GH18623 [Drosophila grimshawi] gi|193893949|gb|EDV92815.1| GH18623 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|195108905|ref|XP_001999033.1| GI24294 [Drosophila mojavensis] gi|193915627|gb|EDW14494.1| GI24294 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|194904213|ref|XP_001981023.1| GG17481 [Drosophila erecta] gi|194916200|ref|XP_001982971.1| GG11041 [Drosophila erecta] gi|190647837|gb|EDV45165.1| GG11041 [Drosophila erecta] gi|190652726|gb|EDV49981.1| GG17481 [Drosophila erecta] Back     alignment and taxonomy information
>gi|195390552|ref|XP_002053932.1| GJ23072 [Drosophila virilis] gi|194152018|gb|EDW67452.1| GJ23072 [Drosophila virilis] Back     alignment and taxonomy information
>gi|195453728|ref|XP_002073915.1| GK12896 [Drosophila willistoni] gi|194170000|gb|EDW84901.1| GK12896 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|195502354|ref|XP_002098187.1| GE10240 [Drosophila yakuba] gi|194184288|gb|EDW97899.1| GE10240 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|24648796|ref|NP_650983.1| bursicon [Drosophila melanogaster] gi|195330825|ref|XP_002032103.1| GM26374 [Drosophila sechellia] gi|195572676|ref|XP_002104321.1| GD20896 [Drosophila simulans] gi|51701361|sp|Q9VD83.1|BURS_DROME RecName: Full=Bursicon; AltName: Full=Bursicon subunit alpha; AltName: Full=Cuticle-tanning hormone; Flags: Precursor gi|7300771|gb|AAF55915.1| bursicon [Drosophila melanogaster] gi|50261495|gb|AAT72327.1| cuticle tanning hormone bursicon [Drosophila melanogaster] gi|50261497|gb|AAT72328.1| cuticle tanning hormone bursicon [Drosophila melanogaster] gi|62392019|emb|CAH74223.1| bursicon alpha subunit precursor [Drosophila melanogaster] gi|116806286|emb|CAL26566.1| CG13419 [Drosophila melanogaster] gi|116806288|emb|CAL26567.1| CG13419 [Drosophila melanogaster] gi|116806290|emb|CAL26568.1| CG13419 [Drosophila melanogaster] gi|116806292|emb|CAL26569.1| CG13419 [Drosophila melanogaster] gi|116806294|emb|CAL26570.1| CG13419 [Drosophila melanogaster] gi|116806296|emb|CAL26571.1| CG13419 [Drosophila melanogaster] gi|116806298|emb|CAL26572.1| CG13419 [Drosophila melanogaster] gi|116806300|emb|CAL26573.1| CG13419 [Drosophila melanogaster] gi|116806302|emb|CAL26574.1| CG13419 [Drosophila melanogaster] gi|116806304|emb|CAL26575.1| CG13419 [Drosophila melanogaster] gi|116806306|emb|CAL26576.1| CG13419 [Drosophila melanogaster] gi|116806308|emb|CAL26577.1| CG13419 [Drosophila melanogaster] gi|116806310|emb|CAL26578.1| CG13419 [Drosophila simulans] gi|194121046|gb|EDW43089.1| GM26374 [Drosophila sechellia] gi|194200248|gb|EDX13824.1| GD20896 [Drosophila simulans] gi|223967843|emb|CAR93652.1| CG13419-PA [Drosophila melanogaster] gi|223967845|emb|CAR93653.1| CG13419-PA [Drosophila melanogaster] gi|223967847|emb|CAR93654.1| CG13419-PA [Drosophila melanogaster] gi|223967849|emb|CAR93655.1| CG13419-PA [Drosophila melanogaster] gi|223967851|emb|CAR93656.1| CG13419-PA [Drosophila melanogaster] gi|223967853|emb|CAR93657.1| CG13419-PA [Drosophila melanogaster] gi|223967855|emb|CAR93658.1| CG13419-PA [Drosophila melanogaster] gi|223967857|emb|CAR93659.1| CG13419-PA [Drosophila melanogaster] gi|223967859|emb|CAR93660.1| CG13419-PA [Drosophila melanogaster] gi|223967861|emb|CAR93661.1| CG13419-PA [Drosophila melanogaster] gi|223967863|emb|CAR93662.1| CG13419-PA [Drosophila melanogaster] gi|290491286|gb|ADD31622.1| RT06526p [Drosophila melanogaster] gi|358439612|gb|AEU10774.1| RT12026p1 [Drosophila melanogaster] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query101
FB|FBgn0038901173 burs "bursicon" [Drosophila me 0.455 0.265 0.652 1e-13
UNIPROTKB|A2VB89153 burs "Bursicon" [Apis mellifer 0.455 0.300 0.645 1.9e-12
UNIPROTKB|P85316163 burs124 "Bursicon" [Aedes aegy 0.475 0.294 0.541 7.4e-11
UNIPROTKB|P85315171 burs124 "Bursicon" [Culex pipi 0.455 0.269 0.543 4.1e-10
FB|FBgn0038901 burs "bursicon" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 178 (67.7 bits), Expect = 1.0e-13, P = 1.0e-13
 Identities = 30/46 (65%), Positives = 38/46 (82%)

Query:    54 KEAEVITKAPLDCMCRPCTSIEESAVIPQEIVNYADEAPISGHFAK 99
             K  +V+TKAPL+CMCRPCTSIEES +IPQEI  Y+DE P++ HF +
Sbjct:   124 KFKKVLTKAPLECMCRPCTSIEESGIIPQEIAGYSDEGPLNNHFRR 169




GO:0007476 "imaginal disc-derived wing morphogenesis" evidence=IMP
GO:0048082 "regulation of adult chitin-containing cuticle pigmentation" evidence=IMP
GO:0005576 "extracellular region" evidence=IDA
GO:0005179 "hormone activity" evidence=IMP
GO:0007593 "chitin-based cuticle sclerotization" evidence=IMP
GO:0048067 "cuticle pigmentation" evidence=IMP
GO:0005184 "neuropeptide hormone activity" evidence=IC;NAS
GO:0007564 "regulation of chitin-based cuticle tanning" evidence=NAS
GO:0031395 "bursicon neuropeptide hormone complex" evidence=IDA
GO:0043195 "terminal bouton" evidence=IDA
UNIPROTKB|A2VB89 burs "Bursicon" [Apis mellifera (taxid:7460)] Back     alignment and assigned GO terms
UNIPROTKB|P85316 burs124 "Bursicon" [Aedes aegypti (taxid:7159)] Back     alignment and assigned GO terms
UNIPROTKB|P85315 burs124 "Bursicon" [Culex pipiens pipiens (taxid:38569)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
A2VB89BURS_APIMENo assigned EC number0.64580.45540.3006yesN/A
Q9VD83BURS_DROMENo assigned EC number0.65210.45540.2658yesN/A
Q66Q82BURS_ANOGANo assigned EC number0.58690.45540.2822yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query101
TIGR00927 1096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 2e-08
TIGR00927 1096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 2e-08
TIGR00927 1096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 5e-08
TIGR00927 1096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 1e-07
TIGR00927 1096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 2e-07
TIGR00927 1096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 4e-07
pfam02459 548 pfam02459, Adeno_terminal, Adenoviral DNA terminal 2e-06
pfam02459 548 pfam02459, Adeno_terminal, Adenoviral DNA terminal 2e-06
pfam02459 548 pfam02459, Adeno_terminal, Adenoviral DNA terminal 3e-06
pfam02459 548 pfam02459, Adeno_terminal, Adenoviral DNA terminal 5e-06
pfam02459 548 pfam02459, Adeno_terminal, Adenoviral DNA terminal 6e-06
pfam02459 548 pfam02459, Adeno_terminal, Adenoviral DNA terminal 1e-05
pfam14181155 pfam14181, YqfQ, YqfQ-like protein 6e-05
pfam04712481 pfam04712, Radial_spoke, Radial spokehead-like pro 1e-04
pfam04147 809 pfam04147, Nop14, Nop14-like family 2e-04
pfam08553 794 pfam08553, VID27, VID27 cytoplasmic protein 2e-04
PRK05299258 PRK05299, rpsB, 30S ribosomal protein S2; Provisio 2e-04
PRK05299258 PRK05299, rpsB, 30S ribosomal protein S2; Provisio 2e-04
PTZ00415 2849 PTZ00415, PTZ00415, transmission-blocking target a 2e-04
PTZ00415 2849 PTZ00415, PTZ00415, transmission-blocking target a 3e-04
PTZ00415 2849 PTZ00415, PTZ00415, transmission-blocking target a 3e-04
pfam05758 832 pfam05758, Ycf1, Ycf1 3e-04
TIGR00927 1096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 4e-04
pfam04147 809 pfam04147, Nop14, Nop14-like family 4e-04
pfam08553 794 pfam08553, VID27, VID27 cytoplasmic protein 4e-04
pfam12794339 pfam12794, MscS_TM, Mechanosensitive ion channel i 5e-04
PRK05299258 PRK05299, rpsB, 30S ribosomal protein S2; Provisio 7e-04
PRK05299258 PRK05299, rpsB, 30S ribosomal protein S2; Provisio 7e-04
pfam03896 281 pfam03896, TRAP_alpha, Translocon-associated prote 8e-04
PRK04195482 PRK04195, PRK04195, replication factor C large sub 8e-04
cd11486635 cd11486, SLC5sbd_SGLT1, Na(+)/glucose cotransporte 8e-04
pfam02459 548 pfam02459, Adeno_terminal, Adenoviral DNA terminal 0.001
PTZ00415 2849 PTZ00415, PTZ00415, transmission-blocking target a 0.001
PRK04195482 PRK04195, PRK04195, replication factor C large sub 0.001
PRK04019330 PRK04019, rplP0, acidic ribosomal protein P0; Vali 0.001
pfam05327 554 pfam05327, RRN3, RNA polymerase I specific transcr 0.001
pfam02459 548 pfam02459, Adeno_terminal, Adenoviral DNA terminal 0.002
pfam12794339 pfam12794, MscS_TM, Mechanosensitive ion channel i 0.002
pfam03896 281 pfam03896, TRAP_alpha, Translocon-associated prote 0.002
pfam03344 715 pfam03344, Daxx, Daxx Family 0.002
PRK05658 619 PRK05658, PRK05658, RNA polymerase sigma factor Rp 0.002
pfam11705221 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polym 0.002
PTZ00415 2849 PTZ00415, PTZ00415, transmission-blocking target a 0.003
PTZ00415 2849 PTZ00415, PTZ00415, transmission-blocking target a 0.003
PRK04195482 PRK04195, PRK04195, replication factor C large sub 0.003
pfam03344 715 pfam03344, Daxx, Daxx Family 0.003
pfam03344 715 pfam03344, Daxx, Daxx Family 0.003
pfam04147 809 pfam04147, Nop14, Nop14-like family 0.004
pfam04931784 pfam04931, DNA_pol_phi, DNA polymerase phi 0.004
pfam00183 529 pfam00183, HSP90, Hsp90 protein 0.004
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
 Score = 49.6 bits (118), Expect = 2e-08
 Identities = 30/38 (78%), Positives = 30/38 (78%)

Query: 12  GRSSDDEGVEEEEEVEEEEEEEEEEEEEEEEEEEEEEE 49
           G  SD    EEEEE EEEEEEEEEEEEEEEEEEEE EE
Sbjct: 855 GGGSDGGDSEEEEEEEEEEEEEEEEEEEEEEEEEENEE 892


[Transport and binding proteins, Cations and iron carrying compounds]. Length = 1096

>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein Back     alignment and domain information
>gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein Back     alignment and domain information
>gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein Back     alignment and domain information
>gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein Back     alignment and domain information
>gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein Back     alignment and domain information
>gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein Back     alignment and domain information
>gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein Back     alignment and domain information
>gnl|CDD|218223 pfam04712, Radial_spoke, Radial spokehead-like protein Back     alignment and domain information
>gnl|CDD|217927 pfam04147, Nop14, Nop14-like family Back     alignment and domain information
>gnl|CDD|219900 pfam08553, VID27, VID27 cytoplasmic protein Back     alignment and domain information
>gnl|CDD|235396 PRK05299, rpsB, 30S ribosomal protein S2; Provisional Back     alignment and domain information
>gnl|CDD|235396 PRK05299, rpsB, 30S ribosomal protein S2; Provisional Back     alignment and domain information
>gnl|CDD|185603 PTZ00415, PTZ00415, transmission-blocking target antigen s230; Provisional Back     alignment and domain information
>gnl|CDD|185603 PTZ00415, PTZ00415, transmission-blocking target antigen s230; Provisional Back     alignment and domain information
>gnl|CDD|185603 PTZ00415, PTZ00415, transmission-blocking target antigen s230; Provisional Back     alignment and domain information
>gnl|CDD|218734 pfam05758, Ycf1, Ycf1 Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|217927 pfam04147, Nop14, Nop14-like family Back     alignment and domain information
>gnl|CDD|219900 pfam08553, VID27, VID27 cytoplasmic protein Back     alignment and domain information
>gnl|CDD|221775 pfam12794, MscS_TM, Mechanosensitive ion channel inner membrane domain 1 Back     alignment and domain information
>gnl|CDD|235396 PRK05299, rpsB, 30S ribosomal protein S2; Provisional Back     alignment and domain information
>gnl|CDD|235396 PRK05299, rpsB, 30S ribosomal protein S2; Provisional Back     alignment and domain information
>gnl|CDD|217783 pfam03896, TRAP_alpha, Translocon-associated protein (TRAP), alpha subunit Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|212055 cd11486, SLC5sbd_SGLT1, Na(+)/glucose cotransporter SGLT1;solute binding domain Back     alignment and domain information
>gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein Back     alignment and domain information
>gnl|CDD|185603 PTZ00415, PTZ00415, transmission-blocking target antigen s230; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated Back     alignment and domain information
>gnl|CDD|218556 pfam05327, RRN3, RNA polymerase I specific transcription initiation factor RRN3 Back     alignment and domain information
>gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein Back     alignment and domain information
>gnl|CDD|221775 pfam12794, MscS_TM, Mechanosensitive ion channel inner membrane domain 1 Back     alignment and domain information
>gnl|CDD|217783 pfam03896, TRAP_alpha, Translocon-associated protein (TRAP), alpha subunit Back     alignment and domain information
>gnl|CDD|217503 pfam03344, Daxx, Daxx Family Back     alignment and domain information
>gnl|CDD|235549 PRK05658, PRK05658, RNA polymerase sigma factor RpoD; Validated Back     alignment and domain information
>gnl|CDD|221175 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polymerase III subunit Rpc31 Back     alignment and domain information
>gnl|CDD|185603 PTZ00415, PTZ00415, transmission-blocking target antigen s230; Provisional Back     alignment and domain information
>gnl|CDD|185603 PTZ00415, PTZ00415, transmission-blocking target antigen s230; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|217503 pfam03344, Daxx, Daxx Family Back     alignment and domain information
>gnl|CDD|217503 pfam03344, Daxx, Daxx Family Back     alignment and domain information
>gnl|CDD|217927 pfam04147, Nop14, Nop14-like family Back     alignment and domain information
>gnl|CDD|218333 pfam04931, DNA_pol_phi, DNA polymerase phi Back     alignment and domain information
>gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 101
PF09026101 CENP-B_dimeris: Centromere protein B dimerisation 93.71
PF09026101 CENP-B_dimeris: Centromere protein B dimerisation 92.19
PF04931784 DNA_pol_phi: DNA polymerase phi; InterPro: IPR0070 85.93
>PF09026 CENP-B_dimeris: Centromere protein B dimerisation domain; InterPro: IPR015115 Centromere protein B (CENP-B) interacts with centromeric heterochromatin in chromosomes and binds to a specific subset of alphoid satellite DNA, called the CENP-B box Back     alignment and domain information
Probab=93.71  E-value=0.018  Score=41.44  Aligned_cols=7  Identities=43%  Similarity=0.866  Sum_probs=2.1

Q ss_pred             hhcCCcc
Q psy13267         59 ITKAPLD   65 (101)
Q Consensus        59 ltkAPLe   65 (101)
                      ||-.||+
T Consensus        60 ltSf~id   66 (101)
T PF09026_consen   60 LTSFPID   66 (101)
T ss_dssp             HCTS---
T ss_pred             hhccchh
Confidence            5555554



CENP-B may organise arrays of centromere satellite DNA into a higher order structure, which then directs centromere formation and kinetochore assembly in mammalian chromosomes. The CENP-B dimerisation domain is composed of two alpha-helices, which are folded into an antiparallel configuration. Dimerisation of CENP-B is mediated by this domain, in which monomers dimerise to form a symmetrical, antiparallel, four-helix bundle structure with a large hydrophobic patch in which 23 residues of one monomer form van der Waals contacts with the other monomer. This CENP-B dimer configuration may be suitable for capturing two distant CENP-B boxes during centromeric heterochromatin formation []. ; GO: 0003677 DNA binding, 0003682 chromatin binding, 0006355 regulation of transcription, DNA-dependent, 0000775 chromosome, centromeric region, 0005634 nucleus; PDB: 1UFI_A.

>PF09026 CENP-B_dimeris: Centromere protein B dimerisation domain; InterPro: IPR015115 Centromere protein B (CENP-B) interacts with centromeric heterochromatin in chromosomes and binds to a specific subset of alphoid satellite DNA, called the CENP-B box Back     alignment and domain information
>PF04931 DNA_pol_phi: DNA polymerase phi; InterPro: IPR007015 Proteins of this family are predominantly nucleolar Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by HHsearch ?

No hit with probability above 80.00


Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

No hit with probability above 80.00