Psyllid ID: psy13410


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490---
MKFDQGPTSVVQPTSVVQLLTRWTLDLELNWVCTQDTLSTWLNWVCTQDTLSTWALTPQLNWVCTQDTLSTWAQAFFFCGAIVGGLVFGWVADRFGRVPALVLTNLVGFIFGVITAFTKSFWQFALCRFFVGLSFDNCFTMMYILGMPIYKTRNLDFDDVLPHLGEFGRYQKVLFFSMILFAFAEAFVYFSQIFITVIPEHYWCRVPELSHLDYADKEESHEEADTIAESYIKRNHTGDRGLHNSPRSSTHGSLNRESLKSRSLTRRNMDFVNRGFGENLGEFGRYQKVLFFSMILFAFAEAFVYFSQIFITVIPEHYWCRVPELSHLDFEQRKLISIPQIGAAFDSCRMYAVNYTHLLGSGITKADPSWPIVECQHGWDYDHSDIPYTTIATELNWVCTQDTLSTWAQAFFFCGAIVGGLVFGWVADRFGRVPALVLTNLVGFIFGVVTAFTKSFWQFALCRFFVGLSFDNCFTMMYILETNRKPFPGCFQC
cccccccccccccccEEEccccccccccccccccccccccccccEEcccccccccccccccEEccccccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccHHHHHHHHHEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEcHHHHHHHcccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHcccccccccccccEEEcccccccccccccccccccccccccccEEEcccccccccEEEEccEEccccccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccHHHHHHHHHEEEEccccEEEEEc
cccccccccEEccccHEEEEcccccccccccccccccccccccEEEEcccccccEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHccccccHHHHccccccccEEEEHHHHHHHHcccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEccccccccccHHHHHccccccccccccccEEEEcccHHcccccccccccccccccccccEEEEcccccccEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHEEEEEEEcccEEEEEEc
mkfdqgptsvvqptSVVQLLTRWTLDLELNWVCTQDTLSTWLNWVCtqdtlstwaltpqlnwvctQDTLSTWAQAFFFCGAIVGGLVFGWVadrfgrvpALVLTNLVGFIFGVITAFTKSFWQFALCRFFVGLSFDNCFTMMYILGmpiyktrnldfddvlphlgefgrYQKVLFFSMILFAFAEAFVYFSQIFITVipehywcrvpelshldyadkeeshEEADTIAESYIKrnhtgdrglhnsprssthgslnreslksrsltRRNMDFvnrgfgenlgefGRYQKVLFFSMILFAFAEAFVYFSQIFITVipehywcrvpelshldFEQRKLISIPQIGAAFDSCRMYAVNYTHllgsgitkadpswpivecqhgwdydhsdipyttIATELNWVCTQDTLSTWAQAFFFCGAIVGGLVFGWVadrfgrvpALVLTNLVGFIFGVVTAFTKSFWQFALCRFFVGLSFDNCFTMMYILetnrkpfpgcfqc
mkfdqgptsvvqptsvVQLLTRWTLDLELNWVCTQDTLSTWLNWVCTQDTLSTWALTPQLNWVCTQDTLSTWAQAFFFCGAIVGGLVFGWVADRFGRVPALVLTNLVGFIFGVITAFTKSFWQFALCRFFVGLSFDNCFTMMYILGMPIYKTRNLDFDDVLPHLGEFGRYQKVLFFSMILFAFAEAFVYFSQIFITVIPEHYWCRVPELSHLDYADKEESHEEADTIAESYIKrnhtgdrglhnsprssthgslnreslksrsltrrnmDFVNRGFGENLGEFGRYQKVLFFSMILFAFAEAFVYFSQIFITVIPEHYWCRVPELSHLDFEQRKLISIPQIGAAFDSCRMYAVNYTHLLGSGITKADPSWPIVECQHGWDYDHSDIPYTTIATELNWVCTQDTLSTWAQAFFFCGAIVGGLVFGWVADRFGRVPALVLTNLVGFIFGVVTAFTKSFWQFALCRFFVGLSFDNCFTMMYILETnrkpfpgcfqc
MKFDQGPTSVVQPTSVVQLLTRWTLDLELNWVCTQDTLSTWLNWVCTQDTLSTWALTPQLNWVCTQDTLSTWAQAFFFCGAIVGGLVFGWVADRFGRVPALVLTNLVGFIFGVITAFTKSFWQFALCRFFVGLSFDNCFTMMYILGMPIYKTRNLDFDDVLPHLGEFGRYQKVLFFSMILFAFAEAFVYFSQIFITVIPEHYWCRVPELSHLDYADKEESHEEADTIAESYIKRNHTGDRGLHNSPRSSTHGSLNRESLKSRSLTRRNMDFVNRGFGENLGEFGRYQKVLFFSMILFAFAEAFVYFSQIFITVIPEHYWCRVPELSHLDFEQRKLISIPQIGAAFDSCRMYAVNYTHLLGSGITKADPSWPIVECQHGWDYDHSDIPYTTIATELNWVCTQDTLSTWAQAFFFCGAIVGGLVFGWVADRFGRVPALVLTNLVGFIFGVVTAFTKSFWQFALCRFFVGLSFDNCFTMMYILETNRKPFPGCFQC
************PTSVVQLLTRWTLDLELNWVCTQDTLSTWLNWVCTQDTLSTWALTPQLNWVCTQDTLSTWAQAFFFCGAIVGGLVFGWVADRFGRVPALVLTNLVGFIFGVITAFTKSFWQFALCRFFVGLSFDNCFTMMYILGMPIYKTRNLDFDDVLPHLGEFGRYQKVLFFSMILFAFAEAFVYFSQIFITVIPEHYWCRVPELSHLDY*******************************************************DFVNRGFGENLGEFGRYQKVLFFSMILFAFAEAFVYFSQIFITVIPEHYWCRVPELSHLDFEQRKLISIPQIGAAFDSCRMYAVNYTHLLGSGITKADPSWPIVECQHGWDYDHSDIPYTTIATELNWVCTQDTLSTWAQAFFFCGAIVGGLVFGWVADRFGRVPALVLTNLVGFIFGVVTAFTKSFWQFALCRFFVGLSFDNCFTMMYILETNRKPFPG****
MKFDQ**TS*VQPTSVVQLLTRWTLDLELNWVCTQDTLSTWLNWVCTQDTLSTWALTPQLNWVCTQDTLSTWAQAFFFCGAIVGGLVFGWVADRFGRVPALVLTNLVGFIFGVITAFTKSFWQFALCRFFVGLSFDNCFTMMYILGMPIYKTRNLDFDDVLPHLGEFGRYQKVLFFSMILFAFAEAFVYFSQIFITVIPEHYWCRVPELSHLDYADKEESHEEADTIAESYIKRNHTGDRGLHNSPRSSTHGSLNRESLKSRSLTRRNMDFVNRGFGENLGEFGRYQKVLFFSMILFAFAEAFVYFSQIFITVIPEHYWCRVPELSHLDFEQRKLISIPQIGAAFDSCRMYAVNYTHLLGSGITKADPSWPIVECQHGWDYDHSDIPYTTIATELNWVCTQDTLSTWAQAFFFCGAIVGGLVFGWVADRFGRVPALVLTNLVGFIFGVVTAFTKSFWQFALCRFFVGLSFDNCFTMMYILETNRKPFPGCFQC
************PTSVVQLLTRWTLDLELNWVCTQDTLSTWLNWVCTQDTLSTWALTPQLNWVCTQDTLSTWAQAFFFCGAIVGGLVFGWVADRFGRVPALVLTNLVGFIFGVITAFTKSFWQFALCRFFVGLSFDNCFTMMYILGMPIYKTRNLDFDDVLPHLGEFGRYQKVLFFSMILFAFAEAFVYFSQIFITVIPEHYWCRVPELSHLDYAD********DTIAESYIKRNHTGDR*********************RSLTRRNMDFVNRGFGENLGEFGRYQKVLFFSMILFAFAEAFVYFSQIFITVIPEHYWCRVPELSHLDFEQRKLISIPQIGAAFDSCRMYAVNYTHLLGSGITKADPSWPIVECQHGWDYDHSDIPYTTIATELNWVCTQDTLSTWAQAFFFCGAIVGGLVFGWVADRFGRVPALVLTNLVGFIFGVVTAFTKSFWQFALCRFFVGLSFDNCFTMMYILETNRKPFPGCFQC
******PTSVVQPTSVVQLLTRWTLD**********TLSTWLNWVCTQDTLSTWALTPQLNWVCTQDTLSTWAQAFFFCGAIVGGLVFGWVADRFGRVPALVLTNLVGFIFGVITAFTKSFWQFALCRFFVGLSFDNCFTMMYILGMPIYKTRNLDFDDVLPHLGEFGRYQKVLFFSMILFAFAEAFVYFSQIFITVIPEHYWCRVPELSHLDYADKEESHEEADTIAESYIKRNHTGDRGLHNSPRSSTHGSLNRESLKSRSLTRRNMDFVNRGFGENLGEFGRYQKVLFFSMILFAFAEAFVYFSQIFITVIPEHYWCRVPELSHLDFEQRKLISIPQIGAAFDSCRMYAVNYTHLLGSG*****PSWPIVECQHGWDYDHSDIPYTTIATELNWVCTQDTLSTWAQAFFFCGAIVGGLVFGWVADRFGRVPALVLTNLVGFIFGVVTAFTKSFWQFALCRFFVGLSFDNCFTMMYILETNRKPFPGCFQC
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKFDQGPTSVVQPTSVVQLLTRWTLDLELNWVCTQDTLSTWLNWVCTQDTLSTWALTPQLNWVCTQDTLSTWAQAFFFCGAIVGGLVFGWVADRFGRVPALVLTNLVGFIFGVITAFTKSFWQFALCRFFVGLSFDNCFTMMYILGMPIYKTRNLDFDDVLPHLGEFGRYQKVLFFSMILFAFAEAFVYFSQIFITVIPEHYWCRVPELSHLDYADKEESHEEADTIAESYIKRNHTGDRGLHNSPRSSTHGSLNRESLKSRSLTRRNMDFVNRGFGENLGEFGRYQKVLFFSMILFAFAEAFVYFSQIFITVIPEHYWCRVPELSHLDFEQRKLISIPQIGAAFDSCRMYAVNYTHLLGSGITKADPSWPIVECQHGWDYDHSDIPYTTIATELNWVCTQDTLSTWAQAFFFCGAIVGGLVFGWVADRFGRVPALVLTNLVGFIFGVVTAFTKSFWQFALCRFFVGLSFDNCFTMMYILETNRKPFPGCFQC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query493 2.2.26 [Sep-21-2011]
O57379 562 Solute carrier family 22 N/A N/A 0.393 0.345 0.314 1e-18
Q66J52 552 Solute carrier family 22 N/A N/A 0.417 0.373 0.295 2e-18
Q9U539 585 Organic cation transporte yes N/A 0.430 0.362 0.315 3e-18
Q1RPP5 547 Solute carrier family 22 yes N/A 0.395 0.356 0.312 7e-18
Q9WTN6 564 Solute carrier family 22 yes N/A 0.397 0.347 0.298 1e-17
O08966 556 Solute carrier family 22 no N/A 0.403 0.357 0.296 2e-17
O77504 554 Solute carrier family 22 yes N/A 0.403 0.359 0.306 2e-17
O75751 556 Solute carrier family 22 yes N/A 0.411 0.365 0.286 2e-17
Q864Z3 549 Solute carrier family 22 no N/A 0.381 0.342 0.312 3e-17
O70577 553 Solute carrier family 22 no N/A 0.421 0.376 0.286 3e-17
>sp|O57379|S22A6_PSEAM Solute carrier family 22 member 6 OS=Pseudopleuronectes americanus GN=SLC22A6 PE=1 SV=1 Back     alignment and function desciption
 Score = 95.1 bits (235), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 65/207 (31%), Positives = 98/207 (47%), Gaps = 13/207 (6%)

Query: 278 ENLGEFGRYQKVLFFSMILFAFAEAFVYFSQIFITVIPEHYWCRVPELSH--LDFEQRKL 335
           E +G  GR+Q +    + +     A     Q F+  +P HY      LS   L  E+  L
Sbjct: 8   EQVGSTGRFQVLHVTLLCIPVLMMASHNLLQNFVATVPSHYCNAHANLSQARLSLEESLL 67

Query: 336 ISIPQIGAAF-DSCRMYAVNYTHLLGSGITK-----ADPS----WPIVECQHGWDYDHSD 385
           I++P  GA     C+ YA    HLLG   T      AD +      + EC  GW Y+ S 
Sbjct: 68  ITVPLDGAGKPQRCQRYAAPQWHLLGKNGTSGSGDLADATESMDAALQECSDGWSYN-ST 126

Query: 386 IPYTTIATELNWVCTQDTLSTWAQAFFFCGAIVGGLVFGWVADRFGRVPALVLTNLVGFI 445
           +  +TI +E + VC   +     Q  +  G +VG L+FG ++DR+GR   L+++NL+  +
Sbjct: 127 VRSSTIISEWHLVCDMHSFKQMGQTIYMGGVLVGALLFGGLSDRYGRRILLLISNLLMAV 186

Query: 446 FGVVTAFTKSFWQFALCRFFVGLSFDN 472
            G   AF+ SF  F + RF  GL+   
Sbjct: 187 SGTCAAFSSSFSLFCVFRFGCGLALSG 213




Involved in the renal elimination of endogenous and exogenous organic anions. Functions as organic anion exchanger when the uptake of one molecule of organic anion is coupled with an efflux of one molecule of endogenous dicarboxylic acid (glutarate, ketoglutarate, etc). Mediates the sodium-independent uptake of p-aminohippurate (PAH), 2,3-dimercapto-1-propanesulfonic acid (DMPS), cidofovir, adefovir, 9-(2-phosphonylmethoxyethyl) guanine (PMEG), 9-(2-phosphonylmethoxyethyl) diaminopurine (PMEDAP), ochratoxin (OTA), acyclovir (ACV), 3'-azido-3-'deoxythymidine (AZT), cimetidine (CMD), 2,4-dichloro-phenoxyacetate (2,4-D), hippurate (HA), indoleacetate (IA), indoxyl sulfate (IS), 3-carboxy-4-methyl-5-propyl-2-furanpropionate (CMPF) and edaravone sulfate (By similarity). Mediates the sodium-independent uptake of p-aminohippurate (PAH). PAH uptake is inhibited by p-chloromercuribenzenesulphonate (PCMBS), diethyl pyrocarbonate (DEPC), indomethacin, sulindac, diclofenac, carprofen, okadaic acid, benzothiazolylcysteine (BTC), S-chlorotrifluoroethylcysteine (CTFC), cysteine S-conjugates S-dichlorovinylcysteine (DCVC), furosemide, steviol, phorbol 12-myristate 13-acetate (PMA), calcium ionophore A23187, benzylpenicillin, bumetamide, losartan, probenecid, phenol red, urate, glutarate and alpha-ketoglutarate (By similarity). PAH uptake is inhibited by glutarate.
Pseudopleuronectes americanus (taxid: 8265)
>sp|Q66J52|S226B_XENLA Solute carrier family 22 member 6-B OS=Xenopus laevis GN=slc22a6-b PE=2 SV=1 Back     alignment and function description
>sp|Q9U539|OCT1_CAEEL Organic cation transporter 1 OS=Caenorhabditis elegans GN=oct-1 PE=1 SV=3 Back     alignment and function description
>sp|Q1RPP5|S22A7_PIG Solute carrier family 22 member 7 OS=Sus scrofa GN=SLC22A7 PE=2 SV=1 Back     alignment and function description
>sp|Q9WTN6|S22AL_MOUSE Solute carrier family 22 member 21 OS=Mus musculus GN=Slc22a21 PE=2 SV=1 Back     alignment and function description
>sp|O08966|S22A1_MOUSE Solute carrier family 22 member 1 OS=Mus musculus GN=Slc22a1 PE=2 SV=2 Back     alignment and function description
>sp|O77504|S22A1_RABIT Solute carrier family 22 member 1 OS=Oryctolagus cuniculus GN=SLC22A1 PE=1 SV=1 Back     alignment and function description
>sp|O75751|S22A3_HUMAN Solute carrier family 22 member 3 OS=Homo sapiens GN=SLC22A3 PE=1 SV=1 Back     alignment and function description
>sp|Q864Z3|S22A6_BOVIN Solute carrier family 22 member 6 OS=Bos taurus GN=SLC22A6 PE=2 SV=2 Back     alignment and function description
>sp|O70577|S22A2_MOUSE Solute carrier family 22 member 2 OS=Mus musculus GN=Slc22a2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query493
195135086 658 GI16685 [Drosophila mojavensis] gi|19391 0.494 0.370 0.545 8e-75
221330907 662 CG42269 [Drosophila melanogaster] gi|220 0.399 0.297 0.621 4e-72
159884099227 IP12758p [Drosophila melanogaster] 0.391 0.850 0.625 2e-70
307167925 1122 Ectonucleotide pyrophosphatase/phosphodi 0.574 0.252 0.487 3e-70
322785493590 hypothetical protein SINV_07113 [Solenop 0.529 0.442 0.496 2e-69
332031071 724 Organic cation transporter protein [Acro 0.501 0.341 0.516 2e-69
383856871 631 PREDICTED: organic cation transporter pr 0.476 0.372 0.519 5e-69
307208894 670 Organic cation transporter protein [Harp 0.535 0.394 0.487 3e-68
350420244 644 PREDICTED: organic cation transporter pr 0.507 0.388 0.503 7e-68
357624537 770 hypothetical protein KGM_08556 [Danaus p 0.407 0.261 0.578 2e-67
>gi|195135086|ref|XP_002011966.1| GI16685 [Drosophila mojavensis] gi|193918230|gb|EDW17097.1| GI16685 [Drosophila mojavensis] Back     alignment and taxonomy information
 Score =  287 bits (735), Expect = 8e-75,   Method: Compositional matrix adjust.
 Identities = 138/253 (54%), Positives = 176/253 (69%), Gaps = 9/253 (3%)

Query: 228 AESYIKRNHTGDRGLHNSPRSSTHGSLNRESLKSRSLTRRNMDFVNRGFGENLGEFGRYQ 287
           AE+  +R   G++ L         G  N+E    R+L    MDF +      +GEFGRYQ
Sbjct: 33  AENQPRRRSGGNKDLQ----LDLSGKKNKEQ---RALAAPVMDFDD--LLPLIGEFGRYQ 83

Query: 288 KVLFFSMILFAFAEAFVYFSQIFITVIPEHYWCRVPELSHLDFEQRKLISIPQIGAAFDS 347
           K+LF  MI F+F  AFVYFSQIF+T+IPE +WC VPEL  LD E R  +SIP +   +++
Sbjct: 84  KILFLCMIPFSFFVAFVYFSQIFMTLIPEQHWCHVPELDALDVEARLALSIPMVNGEYNN 143

Query: 348 CRMYAVNYTHLLGSGITKADPSWPIVECQHGWDYDHSDIPYTTIATELNWVCTQDTLSTW 407
           C MY VNYT L+  G   ADP+WP V+C++GW Y+ ++IPY+T+ATE NWVC    L T+
Sbjct: 144 CYMYDVNYTELMAQGKIMADPNWPRVKCRNGWSYNFTEIPYSTVATEQNWVCDDAALPTY 203

Query: 408 AQAFFFCGAIVGGLVFGWVADRFGRVPALVLTNLVGFIFGVVTAFTKSFWQFALCRFFVG 467
           AQ+ FF GAIVGGL+FGW+ADRFGR+PAL+  NL+G + GV TAF K+FWQFA  RFFVG
Sbjct: 204 AQSIFFLGAIVGGLLFGWIADRFGRIPALICCNLMGLLSGVATAFAKNFWQFATMRFFVG 263

Query: 468 LSFDNCFTMMYIL 480
            +FDNCFTMMYIL
Sbjct: 264 FAFDNCFTMMYIL 276




Source: Drosophila mojavensis

Species: Drosophila mojavensis

Genus: Drosophila

Family: Drosophilidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|221330907|ref|NP_648019.2| CG42269 [Drosophila melanogaster] gi|220902482|gb|AAF50706.2| CG42269 [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|159884099|gb|ABX00728.1| IP12758p [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|307167925|gb|EFN61301.1| Ectonucleotide pyrophosphatase/phosphodiesterase family member 4 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|322785493|gb|EFZ12162.1| hypothetical protein SINV_07113 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|332031071|gb|EGI70657.1| Organic cation transporter protein [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|383856871|ref|XP_003703930.1| PREDICTED: organic cation transporter protein-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|307208894|gb|EFN86109.1| Organic cation transporter protein [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|350420244|ref|XP_003492447.1| PREDICTED: organic cation transporter protein-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|357624537|gb|EHJ75270.1| hypothetical protein KGM_08556 [Danaus plexippus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query493
FB|FBgn0259164 662 CG42269 [Drosophila melanogast 0.407 0.303 0.621 9.9e-71
FB|FBgn0035647 706 CG10486 [Drosophila melanogast 0.466 0.325 0.390 2.6e-40
FB|FBgn0035645 540 CG5592 [Drosophila melanogaste 0.401 0.366 0.415 2.6e-38
FB|FBgn0032879 674 CG9317 [Drosophila melanogaste 0.403 0.295 0.366 5.8e-28
FB|FBgn0038720 585 CG6231 [Drosophila melanogaste 0.363 0.305 0.373 1.4e-24
ZFIN|ZDB-GENE-040426-1311 546 slc22a7b "solute carrier famil 0.399 0.360 0.336 5.6e-24
UNIPROTKB|E1BX06 542 SLC22A7 "Uncharacterized prote 0.377 0.343 0.350 2.5e-21
FB|FBgn0033778 604 CG3790 [Drosophila melanogaste 0.296 0.241 0.317 7e-21
FB|FBgn0038719 545 CG16727 [Drosophila melanogast 0.373 0.337 0.333 3.5e-20
FB|FBgn0038715 541 CG7333 [Drosophila melanogaste 0.377 0.343 0.315 4.4e-20
FB|FBgn0259164 CG42269 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 716 (257.1 bits), Expect = 9.9e-71, P = 9.9e-71
 Identities = 125/201 (62%), Positives = 154/201 (76%)

Query:   280 LGEFGRYQKVLFFSMILFAFAEAFVYFSQIFITVIPEHYWCRVPELSHLDFEQRKLISIP 339
             +GEFGRYQK+LF  MI F+F  AFVYFSQIF+T+IPE +WC VPEL  LD E R  +SIP
Sbjct:    79 IGEFGRYQKLLFICMIPFSFFVAFVYFSQIFLTLIPEQHWCHVPELDGLDVEARLALSIP 138

Query:   340 QIGAAFDSCRMYAVNYTHLLGSGITKADPSWPIVECQHGWDYDHSDIPYTTIATELNWVC 399
                  +++C MY VNYT +L  G   ADP WP V+C+HGW Y+ ++IPY T+ATE NWVC
Sbjct:   139 MTNGEYNNCYMYDVNYTDILAQGKVMADPKWPQVKCRHGWSYNFTEIPYATVATEQNWVC 198

Query:   400 TQDTLSTWAQAFFFCGAIVGGLVFGWVADRFGRVPALVLTNLVGFIFGVVTAFTKSFWQF 459
                 L T+AQ+ FF GAIVGGL+FGWVADRFGR+PAL+ TN++G + GV TAF  +FW+F
Sbjct:   199 DDAALPTYAQSIFFLGAIVGGLLFGWVADRFGRIPALIGTNMMGLLAGVGTAFVSNFWEF 258

Query:   460 ALCRFFVGLSFDNCFTMMYIL 480
             A+ RFFVG +FDNCFTMMYIL
Sbjct:   259 AIMRFFVGFAFDNCFTMMYIL 279


GO:0008513 "secondary active organic cation transmembrane transporter activity" evidence=ISS
GO:0055085 "transmembrane transport" evidence=IEA
GO:0016021 "integral to membrane" evidence=IEA
FB|FBgn0035647 CG10486 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0035645 CG5592 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0032879 CG9317 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0038720 CG6231 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1311 slc22a7b "solute carrier family 22 (organic anion transporter), member 7b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1BX06 SLC22A7 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
FB|FBgn0033778 CG3790 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0038719 CG16727 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0038715 CG7333 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query493
TIGR00898 505 TIGR00898, 2A0119, cation transport protein 6e-24
TIGR00898505 TIGR00898, 2A0119, cation transport protein 9e-12
TIGR00895398 TIGR00895, 2A0115, benzoate transport 3e-10
TIGR00895 398 TIGR00895, 2A0115, benzoate transport 3e-10
pfam00083 449 pfam00083, Sugar_tr, Sugar (and other) transporter 3e-09
cd06174352 cd06174, MFS, The Major Facilitator Superfamily (M 3e-09
pfam00083449 pfam00083, Sugar_tr, Sugar (and other) transporter 4e-09
cd06174 352 cd06174, MFS, The Major Facilitator Superfamily (M 4e-09
pfam07690 346 pfam07690, MFS_1, Major Facilitator Superfamily 4e-07
pfam07690346 pfam07690, MFS_1, Major Facilitator Superfamily 5e-07
TIGR00879 481 TIGR00879, SP, MFS transporter, sugar porter (SP) 1e-05
TIGR00880141 TIGR00880, 2_A_01_02, Multidrug resistance protein 2e-05
TIGR00880141 TIGR00880, 2_A_01_02, Multidrug resistance protein 4e-05
PRK11551406 PRK11551, PRK11551, putative 3-hydroxyphenylpropio 8e-05
TIGR00879481 TIGR00879, SP, MFS transporter, sugar porter (SP) 1e-04
PRK11551 406 PRK11551, PRK11551, putative 3-hydroxyphenylpropio 1e-04
TIGR01299 742 TIGR01299, synapt_SV2, synaptic vesicle protein SV 1e-04
TIGR01299 742 TIGR01299, synapt_SV2, synaptic vesicle protein SV 1e-04
TIGR00895398 TIGR00895, 2A0115, benzoate transport 2e-04
cd06174352 cd06174, MFS, The Major Facilitator Superfamily (M 3e-04
cd06174352 cd06174, MFS, The Major Facilitator Superfamily (M 0.002
TIGR00895398 TIGR00895, 2A0115, benzoate transport 0.003
pfam13347425 pfam13347, MFS_2, MFS/sugar transport protein 0.003
pfam13347425 pfam13347, MFS_2, MFS/sugar transport protein 0.003
TIGR00710385 TIGR00710, efflux_Bcr_CflA, drug resistance transp 0.004
>gnl|CDD|233176 TIGR00898, 2A0119, cation transport protein Back     alignment and domain information
 Score =  104 bits (261), Expect = 6e-24
 Identities = 68/210 (32%), Positives = 99/210 (47%), Gaps = 12/210 (5%)

Query: 281 GEFGRYQKVLFFSMILFAFAEAFVYFSQIFITVIPEHYWCRVP---ELSHLDFEQRKLIS 337
           GEFG +Q+  F  + L     AF +   +F+   PEH  CR+P    LS        L  
Sbjct: 1   GEFGPFQRRTFLLLALPIALLAFHFVLIVFLGATPEH-HCRLPDAANLSSRCELNLTLPR 59

Query: 338 IPQIGAAFDSCRMYAV---NYTHLLGSGITKA-DPSWPIVE-CQHGWDYDHSDIPYTTIA 392
           +P      +SC  + V       LLG    K  D      E C  GW+Y + D   +TI 
Sbjct: 60  LPD--GRPESCLRFMVDQWANPSLLGCEPLKLSDLGLAATEPCLDGWEYSY-DTFSSTIV 116

Query: 393 TELNWVCTQDTLSTWAQAFFFCGAIVGGLVFGWVADRFGRVPALVLTNLVGFIFGVVTAF 452
           TE + VC         Q+ FF G ++G  VFG+++DRFGR   L+L+ LV  + GV+TAF
Sbjct: 117 TEWDLVCEDAWKVDLTQSCFFVGVLLGSFVFGYLSDRFGRKKVLLLSTLVTAVSGVLTAF 176

Query: 453 TKSFWQFALCRFFVGLSFDNCFTMMYILET 482
           + ++  F + R  VG+     +    +L T
Sbjct: 177 SPNYTVFLVFRLLVGMGIGGIWVQAVVLNT 206


[Transport and binding proteins, Cations and iron carrying compounds]. Length = 505

>gnl|CDD|233176 TIGR00898, 2A0119, cation transport protein Back     alignment and domain information
>gnl|CDD|233175 TIGR00895, 2A0115, benzoate transport Back     alignment and domain information
>gnl|CDD|233175 TIGR00895, 2A0115, benzoate transport Back     alignment and domain information
>gnl|CDD|215702 pfam00083, Sugar_tr, Sugar (and other) transporter Back     alignment and domain information
>gnl|CDD|119392 cd06174, MFS, The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>gnl|CDD|215702 pfam00083, Sugar_tr, Sugar (and other) transporter Back     alignment and domain information
>gnl|CDD|119392 cd06174, MFS, The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>gnl|CDD|219516 pfam07690, MFS_1, Major Facilitator Superfamily Back     alignment and domain information
>gnl|CDD|219516 pfam07690, MFS_1, Major Facilitator Superfamily Back     alignment and domain information
>gnl|CDD|233165 TIGR00879, SP, MFS transporter, sugar porter (SP) family Back     alignment and domain information
>gnl|CDD|233166 TIGR00880, 2_A_01_02, Multidrug resistance protein Back     alignment and domain information
>gnl|CDD|233166 TIGR00880, 2_A_01_02, Multidrug resistance protein Back     alignment and domain information
>gnl|CDD|236927 PRK11551, PRK11551, putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>gnl|CDD|233165 TIGR00879, SP, MFS transporter, sugar porter (SP) family Back     alignment and domain information
>gnl|CDD|236927 PRK11551, PRK11551, putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>gnl|CDD|130366 TIGR01299, synapt_SV2, synaptic vesicle protein SV2 Back     alignment and domain information
>gnl|CDD|130366 TIGR01299, synapt_SV2, synaptic vesicle protein SV2 Back     alignment and domain information
>gnl|CDD|233175 TIGR00895, 2A0115, benzoate transport Back     alignment and domain information
>gnl|CDD|119392 cd06174, MFS, The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>gnl|CDD|119392 cd06174, MFS, The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>gnl|CDD|233175 TIGR00895, 2A0115, benzoate transport Back     alignment and domain information
>gnl|CDD|222060 pfam13347, MFS_2, MFS/sugar transport protein Back     alignment and domain information
>gnl|CDD|222060 pfam13347, MFS_2, MFS/sugar transport protein Back     alignment and domain information
>gnl|CDD|233099 TIGR00710, efflux_Bcr_CflA, drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 493
TIGR00898505 2A0119 cation transport protein. 99.97
TIGR01299742 synapt_SV2 synaptic vesicle protein SV2. This mode 99.97
KOG0253|consensus528 99.97
KOG0255|consensus521 99.96
KOG0569|consensus485 99.96
TIGR00887502 2A0109 phosphate:H+ symporter. This model represen 99.94
KOG0254|consensus513 99.94
PRK10642 490 proline/glycine betaine transporter; Provisional 99.93
KOG0252|consensus538 99.93
TIGR00891405 2A0112 putative sialic acid transporter. 99.92
PRK10406432 alpha-ketoglutarate transporter; Provisional 99.92
COG2271448 UhpC Sugar phosphate permease [Carbohydrate transp 99.91
PRK10077479 xylE D-xylose transporter XylE; Provisional 99.91
PF00083451 Sugar_tr: Sugar (and other) transporter; InterPro: 99.91
TIGR02332412 HpaX 4-hydroxyphenylacetate permease. This protein 99.9
PRK09952438 shikimate transporter; Provisional 99.9
COG2814394 AraJ Arabinose efflux permease [Carbohydrate trans 99.9
PRK11551406 putative 3-hydroxyphenylpropionic transporter MhpT 99.88
PRK12307426 putative sialic acid transporter; Provisional 99.88
PRK09556467 uhpT sugar phosphate antiporter; Reviewed 99.88
TIGR00903368 2A0129 major facilitator 4 family protein. This fa 99.88
TIGR00879481 SP MFS transporter, sugar porter (SP) family. This 99.88
PRK03545390 putative arabinose transporter; Provisional 99.87
TIGR00895398 2A0115 benzoate transport. 99.87
TIGR00890377 2A0111 Oxalate/Formate Antiporter. 99.86
PRK14995495 methyl viologen resistance protein SmvA; Provision 99.86
PRK15075434 citrate-proton symporter; Provisional 99.86
PRK03699394 putative transporter; Provisional 99.86
PRK15034462 nitrate/nitrite transport protein NarU; Provisiona 99.86
TIGR00893399 2A0114 d-galactonate transporter. 99.86
PRK09705393 cynX putative cyanate transporter; Provisional 99.85
TIGR00710385 efflux_Bcr_CflA drug resistance transporter, Bcr/C 99.84
TIGR00900365 2A0121 H+ Antiporter protein. 99.84
PRK11663434 regulatory protein UhpC; Provisional 99.84
TIGR00881379 2A0104 phosphoglycerate transporter family protein 99.84
TIGR00711485 efflux_EmrB drug resistance transporter, EmrB/QacA 99.83
PLN00028476 nitrate transmembrane transporter; Provisional 99.83
PRK10213394 nepI ribonucleoside transporter; Reviewed 99.83
TIGR00883394 2A0106 metabolite-proton symporter. This model rep 99.83
PRK10091382 MFS transport protein AraJ; Provisional 99.83
PRK10133438 L-fucose transporter; Provisional 99.83
PRK03893496 putative sialic acid transporter; Provisional 99.83
PRK11195393 lysophospholipid transporter LplT; Provisional 99.83
TIGR00899375 2A0120 sugar efflux transporter. This family of pr 99.82
TIGR00894465 2A0114euk Na(+)-dependent inorganic phosphate cotr 99.82
PF07690352 MFS_1: Major Facilitator Superfamily; InterPro: IP 99.82
PRK09874408 drug efflux system protein MdtG; Provisional 99.82
TIGR00886366 2A0108 nitrite extrusion protein (nitrite facilita 99.82
COG2223417 NarK Nitrate/nitrite transporter [Inorganic ion tr 99.82
PRK12382392 putative transporter; Provisional 99.82
PRK05122399 major facilitator superfamily transporter; Provisi 99.82
PRK15402406 multidrug efflux system translocase MdfA; Provisio 99.81
PRK10473392 multidrug efflux system protein MdtL; Provisional 99.81
PRK11102377 bicyclomycin/multidrug efflux system; Provisional 99.8
PRK11273452 glpT sn-glycerol-3-phosphate transporter; Provisio 99.8
PRK11043401 putative transporter; Provisional 99.8
TIGR00712438 glpT glycerol-3-phosphate transporter. This model 99.79
PRK15403413 multidrug efflux system protein MdtM; Provisional 99.79
TIGR00896355 CynX cyanate transporter. This family of proteins 99.79
PRK03633381 putative MFS family transporter protein; Provision 99.78
PRK10504471 putative transporter; Provisional 99.77
PRK10489417 enterobactin exporter EntS; Provisional 99.76
cd06174352 MFS The Major Facilitator Superfamily (MFS) is a l 99.76
PRK11652394 emrD multidrug resistance protein D; Provisional 99.76
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 99.75
TIGR00885410 fucP L-fucose:H+ symporter permease. This family d 99.75
TIGR00897402 2A0118 polyol permease family. This family of prot 99.75
TIGR00901356 2A0125 AmpG-related permease. 99.74
TIGR00892455 2A0113 monocarboxylate transporter 1. 99.74
PRK11646400 multidrug resistance protein MdtH; Provisional 99.72
KOG2532|consensus466 99.72
PRK15011393 sugar efflux transporter B; Provisional 99.72
KOG2533|consensus495 99.71
KOG1330|consensus493 99.71
PRK10054395 putative transporter; Provisional 99.7
PRK11010491 ampG muropeptide transporter; Validated 99.69
TIGR00898 505 2A0119 cation transport protein. 99.69
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 99.69
TIGR00806511 rfc RFC reduced folate carrier. Proteins of the RF 99.69
TIGR00805633 oat sodium-independent organic anion transporter. 99.68
PTZ00207591 hypothetical protein; Provisional 99.68
TIGR00882396 2A0105 oligosaccharide:H+ symporter. 99.67
TIGR00889418 2A0110 nucleoside transporter. This family of prot 99.66
TIGR00902382 2A0127 phenyl proprionate permease family protein. 99.65
PRK11128382 putative 3-phenylpropionic acid transporter; Provi 99.65
PRK09528420 lacY galactoside permease; Reviewed 99.65
KOG2615|consensus451 99.65
KOG3764|consensus464 99.64
TIGR00792437 gph sugar (Glycoside-Pentoside-Hexuronide) transpo 99.63
PRK10207489 dipeptide/tripeptide permease B; Provisional 99.61
KOG2504|consensus509 99.59
PRK11902402 ampG muropeptide transporter; Reviewed 99.58
TIGR00924475 yjdL_sub1_fam amino acid/peptide transporter (Pept 99.56
PF06609599 TRI12: Fungal trichothecene efflux pump (TRI12); I 99.54
PRK09584500 tppB putative tripeptide transporter permease; Rev 99.52
TIGR01301477 GPH_sucrose GPH family sucrose/H+ symporter. This 99.5
PF05977 524 MFS_3: Transmembrane secretion effector; InterPro: 99.48
COG2807395 CynX Cyanate permease [Inorganic ion transport and 99.42
COG0738422 FucP Fucose permease [Carbohydrate transport and m 99.41
PRK09669444 putative symporter YagG; Provisional 99.38
PF13347428 MFS_2: MFS/sugar transport protein 99.37
PRK10642490 proline/glycine betaine transporter; Provisional 99.35
PRK10429473 melibiose:sodium symporter; Provisional 99.31
KOG0255|consensus 521 99.28
PF11700477 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR0 99.26
PRK15462493 dipeptide/tripeptide permease D; Provisional 99.23
PRK09848448 glucuronide transporter; Provisional 99.21
PF03825400 Nuc_H_symport: Nucleoside H+ symporter 99.2
TIGR02718390 sider_RhtX_FptX siderophore transporter, RhtX/FptX 99.17
PF01306412 LacY_symp: LacY proton/sugar symporter; InterPro: 99.15
TIGR00788468 fbt folate/biopterin transporter. The only functio 99.15
TIGR00880141 2_A_01_02 Multidrug resistance protein. 99.06
PRK11462460 putative transporter; Provisional 99.03
COG2270438 Permeases of the major facilitator superfamily [Ge 99.02
TIGR01299742 synapt_SV2 synaptic vesicle protein SV2. This mode 98.98
KOG4686|consensus459 98.93
COG2211 467 MelB Na+/melibiose symporter and related transport 98.88
TIGR01272310 gluP glucose/galactose transporter. Disruption of 98.8
PF03137539 OATP: Organic Anion Transporter Polypeptide (OATP) 98.8
PF03209403 PUCC: PUCC protein; InterPro: IPR004896 This prote 98.77
PF05631354 DUF791: Protein of unknown function (DUF791); Inte 98.75
COG3104498 PTR2 Dipeptide/tripeptide permease [Amino acid tra 98.62
PRK15011393 sugar efflux transporter B; Provisional 98.62
PRK12307 426 putative sialic acid transporter; Provisional 98.55
TIGR00891 405 2A0112 putative sialic acid transporter. 98.55
KOG2325|consensus488 98.53
TIGR00890377 2A0111 Oxalate/Formate Antiporter. 98.49
TIGR00899375 2A0120 sugar efflux transporter. This family of pr 98.48
TIGR02332 412 HpaX 4-hydroxyphenylacetate permease. This protein 98.48
TIGR00892455 2A0113 monocarboxylate transporter 1. 98.48
KOG2563|consensus480 98.47
TIGR00889418 2A0110 nucleoside transporter. This family of prot 98.46
KOG3626|consensus 735 98.45
PRK09528420 lacY galactoside permease; Reviewed 98.44
PF01770412 Folate_carrier: Reduced folate carrier; InterPro: 98.44
TIGR00887 502 2A0109 phosphate:H+ symporter. This model represen 98.44
cd06174352 MFS The Major Facilitator Superfamily (MFS) is a l 98.44
PRK05122399 major facilitator superfamily transporter; Provisi 98.43
PRK10406 432 alpha-ketoglutarate transporter; Provisional 98.43
KOG0254|consensus 513 98.41
KOG2816|consensus463 98.35
PRK12382392 putative transporter; Provisional 98.35
PRK03699 394 putative transporter; Provisional 98.33
PRK09874408 drug efflux system protein MdtG; Provisional 98.33
TIGR00895 398 2A0115 benzoate transport. 98.32
PRK03893496 putative sialic acid transporter; Provisional 98.29
PRK11551406 putative 3-hydroxyphenylpropionic transporter MhpT 98.29
PRK09556 467 uhpT sugar phosphate antiporter; Reviewed 98.29
PRK10077 479 xylE D-xylose transporter XylE; Provisional 98.28
PRK09705 393 cynX putative cyanate transporter; Provisional 98.26
TIGR00881 379 2A0104 phosphoglycerate transporter family protein 98.26
PRK10213 394 nepI ribonucleoside transporter; Reviewed 98.26
TIGR00710 385 efflux_Bcr_CflA drug resistance transporter, Bcr/C 98.25
PRK11663 434 regulatory protein UhpC; Provisional 98.24
PLN00028 476 nitrate transmembrane transporter; Provisional 98.23
PF11700477 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR0 98.23
PRK03545 390 putative arabinose transporter; Provisional 98.23
PRK09952 438 shikimate transporter; Provisional 98.22
KOG3098|consensus461 98.2
TIGR00893 399 2A0114 d-galactonate transporter. 98.2
PF06609 599 TRI12: Fungal trichothecene efflux pump (TRI12); I 98.2
PRK10489417 enterobactin exporter EntS; Provisional 98.19
PRK10133 438 L-fucose transporter; Provisional 98.19
COG2270438 Permeases of the major facilitator superfamily [Ge 98.18
KOG0569|consensus 485 98.18
PF00083 451 Sugar_tr: Sugar (and other) transporter; InterPro: 98.17
PRK15402 406 multidrug efflux system translocase MdfA; Provisio 98.17
KOG2615|consensus 451 98.16
PF07690 352 MFS_1: Major Facilitator Superfamily; InterPro: IP 98.15
KOG0252|consensus 538 98.15
TIGR00879 481 SP MFS transporter, sugar porter (SP) family. This 98.15
TIGR00900365 2A0121 H+ Antiporter protein. 98.13
TIGR00883394 2A0106 metabolite-proton symporter. This model rep 98.13
TIGR00711 485 efflux_EmrB drug resistance transporter, EmrB/QacA 98.13
KOG1330|consensus 493 98.12
PRK15403 413 multidrug efflux system protein MdtM; Provisional 98.12
TIGR00792437 gph sugar (Glycoside-Pentoside-Hexuronide) transpo 98.12
PRK15075 434 citrate-proton symporter; Provisional 98.11
TIGR00902382 2A0127 phenyl proprionate permease family protein. 98.11
PRK10091 382 MFS transport protein AraJ; Provisional 98.11
PRK10054 395 putative transporter; Provisional 98.11
TIGR00886 366 2A0108 nitrite extrusion protein (nitrite facilita 98.09
TIGR00880141 2_A_01_02 Multidrug resistance protein. 98.09
PRK10473 392 multidrug efflux system protein MdtL; Provisional 98.07
PRK10429473 melibiose:sodium symporter; Provisional 98.06
PRK10504 471 putative transporter; Provisional 98.06
TIGR00903 368 2A0129 major facilitator 4 family protein. This fa 98.06
PRK15034 462 nitrate/nitrite transport protein NarU; Provisiona 98.05
KOG0253|consensus 528 98.04
PRK11102 377 bicyclomycin/multidrug efflux system; Provisional 98.02
PRK03633381 putative MFS family transporter protein; Provision 98.0
PRK11652 394 emrD multidrug resistance protein D; Provisional 97.98
PRK11043 401 putative transporter; Provisional 97.97
PRK11646 400 multidrug resistance protein MdtH; Provisional 97.95
PRK09848448 glucuronide transporter; Provisional 97.95
PRK11195 393 lysophospholipid transporter LplT; Provisional 97.94
PF06813250 Nodulin-like: Nodulin-like; InterPro: IPR010658 Th 97.94
COG0477338 ProP Permeases of the major facilitator superfamil 97.94
TIGR00901356 2A0125 AmpG-related permease. 97.93
PRK10207 489 dipeptide/tripeptide permease B; Provisional 97.92
KOG4332|consensus454 97.92
TIGR00924 475 yjdL_sub1_fam amino acid/peptide transporter (Pept 97.91
PRK14995 495 methyl viologen resistance protein SmvA; Provision 97.91
PF05977524 MFS_3: Transmembrane secretion effector; InterPro: 97.91
PRK15462 493 dipeptide/tripeptide permease D; Provisional 97.9
COG2814 394 AraJ Arabinose efflux permease [Carbohydrate trans 97.86
PRK11273 452 glpT sn-glycerol-3-phosphate transporter; Provisio 97.85
TIGR00885 410 fucP L-fucose:H+ symporter permease. This family d 97.84
COG2271 448 UhpC Sugar phosphate permease [Carbohydrate transp 97.83
TIGR00896355 CynX cyanate transporter. This family of proteins 97.82
TIGR00894 465 2A0114euk Na(+)-dependent inorganic phosphate cotr 97.81
TIGR00882396 2A0105 oligosaccharide:H+ symporter. 97.81
TIGR00897402 2A0118 polyol permease family. This family of prot 97.81
KOG3764|consensus 464 97.8
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 97.8
PF13347428 MFS_2: MFS/sugar transport protein 97.79
PRK11128382 putative 3-phenylpropionic acid transporter; Provi 97.78
TIGR00806 511 rfc RFC reduced folate carrier. Proteins of the RF 97.78
TIGR00712 438 glpT glycerol-3-phosphate transporter. This model 97.73
PTZ00207 591 hypothetical protein; Provisional 97.71
PRK09669444 putative symporter YagG; Provisional 97.68
TIGR01272310 gluP glucose/galactose transporter. Disruption of 97.64
PRK09584 500 tppB putative tripeptide transporter permease; Rev 97.63
TIGR00805 633 oat sodium-independent organic anion transporter. 97.63
COG2223417 NarK Nitrate/nitrite transporter [Inorganic ion tr 97.57
PF02487402 CLN3: CLN3 protein; InterPro: IPR003492 Batten's d 97.53
PRK11010491 ampG muropeptide transporter; Validated 97.5
PF0677985 DUF1228: Protein of unknown function (DUF1228); In 97.47
COG2211467 MelB Na+/melibiose symporter and related transport 97.45
PF05978156 UNC-93: Ion channel regulatory protein UNC-93; Int 97.43
PRK11902402 ampG muropeptide transporter; Reviewed 97.43
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 97.41
TIGR02718390 sider_RhtX_FptX siderophore transporter, RhtX/FptX 97.31
TIGR00926 654 2A1704 Peptide:H+ symporter (also transports b-lac 97.28
COG3104 498 PTR2 Dipeptide/tripeptide permease [Amino acid tra 97.25
PRK11462460 putative transporter; Provisional 97.25
KOG2504|consensus509 97.24
KOG2532|consensus 466 97.23
TIGR00939437 2a57 Equilibrative Nucleoside Transporter (ENT). 97.19
COG0738 422 FucP Fucose permease [Carbohydrate transport and m 97.07
PF01306412 LacY_symp: LacY proton/sugar symporter; InterPro: 97.07
KOG0637|consensus498 96.99
TIGR01301 477 GPH_sucrose GPH family sucrose/H+ symporter. This 96.95
TIGR00788468 fbt folate/biopterin transporter. The only functio 96.89
COG2807395 CynX Cyanate permease [Inorganic ion transport and 96.84
PF1283277 MFS_1_like: MFS_1 like family 96.58
PF03092433 BT1: BT1 family; InterPro: IPR004324 Members of th 96.49
PF05631 354 DUF791: Protein of unknown function (DUF791); Inte 96.45
KOG4686|consensus459 96.37
PF03825400 Nuc_H_symport: Nucleoside H+ symporter 96.3
KOG2533|consensus 495 96.24
KOG3762|consensus618 96.22
PF06813 250 Nodulin-like: Nodulin-like; InterPro: IPR010658 Th 95.92
PF06963432 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 Thi 95.81
COG0477 338 ProP Permeases of the major facilitator superfamil 95.76
TIGR00769472 AAA ADP/ATP carrier protein family. These proteins 95.74
PF05978156 UNC-93: Ion channel regulatory protein UNC-93; Int 95.29
PF1283277 MFS_1_like: MFS_1 like family 94.99
KOG2325|consensus 488 94.86
KOG1479|consensus406 94.7
PF03209403 PUCC: PUCC protein; InterPro: IPR004896 This prote 94.19
PF0677985 DUF1228: Protein of unknown function (DUF1228); In 93.93
KOG3810|consensus433 93.73
KOG2816|consensus463 92.29
PF00854372 PTR2: POT family; InterPro: IPR000109 This entry r 90.95
PRK03612521 spermidine synthase; Provisional 90.63
KOG3762|consensus 618 90.54
TIGR00926 654 2A1704 Peptide:H+ symporter (also transports b-lac 89.76
KOG2563|consensus 480 86.19
PF01733309 Nucleoside_tran: Nucleoside transporter; InterPro: 84.5
KOG3880|consensus409 80.19
>TIGR00898 2A0119 cation transport protein Back     alignment and domain information
Probab=99.97  E-value=1.1e-29  Score=266.35  Aligned_cols=336  Identities=20%  Similarity=0.304  Sum_probs=232.7

Q ss_pred             hcccccccccCcc-ceeeecccccccccccchhhHHHHHHHHHHHhhhhhhhhhhcccCChhHHHHHHHHHHHHHHHHHh
Q psy13410         39 STWLNWVCTQDTL-STWALTPQLNWVCTQDTLSTWAQAFFFCGAIVGGLVFGWVADRFGRVPALVLTNLVGFIFGVITAF  117 (493)
Q Consensus        39 ~~~~~w~~~~~~~-~~~~i~~~~~~~~~~~~~~~~~~s~~~lg~~ig~~i~g~l~Dr~GRr~~l~~~~~~~~i~~~~~a~  117 (493)
                      .|..+|.++...+ ++  +.+|||++|++..+.+++.+++++|..+|++++|+++||+|||++++++.++.+++++++++
T Consensus        99 ~~~~~~~~~~~~~~~~--i~~e~~l~c~~~~~~~~~~s~~~~g~~~g~~~~g~l~Dr~Grr~~~~~~~~~~~i~~~~~~~  176 (505)
T TIGR00898        99 PCLDGWEYSYDTFSST--IVTEWDLVCEDAWKVDLTQSCFFVGVLLGSFVFGYLSDRFGRKKVLLLSTLVTAVSGVLTAF  176 (505)
T ss_pred             CCCCCcEecCCccccc--EEEEecceechHHHHHHHHHHHHHHHHHHHHhHHHhhhhccchHHHHHHHHHHHHHHHHHHH
Confidence            4445677775433 44  99999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccHHHHHHHHHHHhhcccchhhhhhhhccccccccCccccccccccccccchhHHHHH-HHHHHHHHHHHH--HHHHHH
Q psy13410        118 TKSFWQFALCRFFVGLSFDNCFTMMYILGMPIYKTRNLDFDDVLPHLGEFGRYQKVLFF-SMILFAFAEAFV--YFSQIF  194 (493)
Q Consensus       118 a~s~~~l~~~R~l~Gi~~g~~~~~~~~~i~e~~~~~~R~~~~~~~~~g~~g~~~~~~~~-~~~l~~~~~~~~--w~~~~~  194 (493)
                      ++|++.++++|++.|++.|+..+...+++.|++|+++|+....         ....... +..++..+....  ||+.++
T Consensus       177 ~~~~~~~~~~r~l~G~~~~~~~~~~~~~~~e~~~~~~r~~~~~---------~~~~~~~~g~~~~~~~~~~~~~wr~~~~  247 (505)
T TIGR00898       177 SPNYTVFLVFRLLVGMGIGGIWVQAVVLNTEFLPKKQRAIVGT---------LIQVFFSLGLVLLPLVAYFIPDWRWLQL  247 (505)
T ss_pred             cccHHHHHHHHHHHHhhccchHHHHHHHhheecChhhhHHHHH---------HHHHHHHHHHHHHHHHHHHhhHHHHHHH
Confidence            9999999999999999999999999999999999998843322         2222222 222222222221  888887


Q ss_pred             HHHHhhhh----heeccCCCchhhhhhccCHHHHHHHHHHHhcccCCCCCCCCCCCCCccCCCCCccccccccccccccc
Q psy13410        195 ITVIPEHY----WCRVPELSHLDYADKEESHEEADTIAESYIKRNHTGDRGLHNSPRSSTHGSLNRESLKSRSLTRRNMD  270 (493)
Q Consensus       195 ~~~i~~~~----~~~~pesp~~~~l~~~~~~~~a~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  270 (493)
                      +..++.++    .+++||+|+  |+..+++.+++.+.+++..+.|+.....+....      .. ++   +.....++..
T Consensus       248 ~~~i~~~~~~~~~~~~~esp~--~l~~~~~~~~a~~~l~~~~~~~~~~~~~~~~~~------~~-~~---~~~~~~~~~~  315 (505)
T TIGR00898       248 AVSLPTFLFFLLSWFVPESPR--WLISQGRIEEALKILQRIAKINGKKLPAEVLSL------SL-EK---DLSSSKKQYS  315 (505)
T ss_pred             HHHHHHHHHHHHHHhcCCChH--HHHHCCCHHHHHHHHHHHHHHcCCCCCHHHHhh------hh-hh---hhhhccCCCc
Confidence            76655442    567999998  888899999999988888766643211100000      00 00   0000011223


Q ss_pred             cchhhhhhhcCCCchHHHHHHHHHHHHHHHHHHHHHHHhhhccCCCcceecCCCCCCCChhhhhcccccCCCCCCCceee
Q psy13410        271 FVNRGFGENLGEFGRYQKVLFFSMILFAFAEAFVYFSQIFITVIPEHYWCRVPELSHLDFEQRKLISIPQIGAAFDSCRM  350 (493)
Q Consensus       271 ~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~c~~  350 (493)
                      +++  +++     .+..+...+.....++...+.+++  ...+.+.                                  
T Consensus       316 ~~~--l~~-----~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~----------------------------------  352 (505)
T TIGR00898       316 FLD--LFR-----TPNLRKTTLCLMMLWFTTAFSYYG--LVLDLGN----------------------------------  352 (505)
T ss_pred             HHH--HhC-----ChHHHHHHHHHHHHHHHHHHHHHH--Hhccccc----------------------------------
Confidence            444  544     233333333334444444444444  2222222                                  


Q ss_pred             eeecccccccCCCCCCCCCCCeeeccCceeeccCCCccchhhhhcccccccchhhhHHHHHHHHHHHHHHHhHHhhhhhc
Q psy13410        351 YAVNYTHLLGSGITKADPSWPIVECQHGWDYDHSDIPYTTIATELNWVCTQDTLSTWAQAFFFCGAIVGGLVFGWVADRF  430 (493)
Q Consensus       351 ~~~~~~~l~~~~~~~~~~~~~~~~~~~g~~y~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~i~~~ig~~~~g~l~Dr~  430 (493)
                                                         ...               ...+...+.++..+++.++.++++||+
T Consensus       353 -----------------------------------~~~---------------~~~~~~~~~~~~~i~~~~~~~~l~dr~  382 (505)
T TIGR00898       353 -----------------------------------LGG---------------NIYLDLFISGLVELPAKLITLLLIDRL  382 (505)
T ss_pred             -----------------------------------cCC---------------ChHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence                                               000               112333455778889999999999999


Q ss_pred             CCchHHHHHHHHHHHHHHHHHhhhhH--HHHHHHHHHHhccccchhhhHhhhhhcccCCCCc
Q psy13410        431 GRVPALVLTNLVGFIFGVVTAFTKSF--WQFALCRFFVGLSFDNCFTMMYILETNRKPFPGC  490 (493)
Q Consensus       431 Grr~~l~~~~~~~~i~~~~~~~~~~~--~~~~~~~~l~g~~~~~~~~~~~~~~~e~~p~~~~  490 (493)
                      |||+.+.++.++.+++.++..+.++.  ...++..++.+++.++.++..+.+.+|.+|++-|
T Consensus       383 grr~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~p~~~r  444 (505)
T TIGR00898       383 GRRYTMAASLLLAGVALLLLLFVPVDLYFLRTALAVLGKFGITSAFQMVYLYTAELYPTVVR  444 (505)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHcCCCchHHHHHHHHHHHHHHHHHHHHHHHHhcccccHHHH
Confidence            99999999998888888777765533  4444556667777778889999999999997543



>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
>KOG0253|consensus Back     alignment and domain information
>KOG0255|consensus Back     alignment and domain information
>KOG0569|consensus Back     alignment and domain information
>TIGR00887 2A0109 phosphate:H+ symporter Back     alignment and domain information
>KOG0254|consensus Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>KOG0252|consensus Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>PF00083 Sugar_tr: Sugar (and other) transporter; InterPro: IPR005828 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters Back     alignment and domain information
>TIGR02332 HpaX 4-hydroxyphenylacetate permease Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>TIGR00903 2A0129 major facilitator 4 family protein Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>TIGR00895 2A0115 benzoate transport Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>PRK14995 methyl viologen resistance protein SmvA; Provisional Back     alignment and domain information
>PRK15075 citrate-proton symporter; Provisional Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>PRK15034 nitrate/nitrite transport protein NarU; Provisional Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>PRK09705 cynX putative cyanate transporter; Provisional Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein Back     alignment and domain information
>TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>PLN00028 nitrate transmembrane transporter; Provisional Back     alignment and domain information
>PRK10213 nepI ribonucleoside transporter; Reviewed Back     alignment and domain information
>TIGR00883 2A0106 metabolite-proton symporter Back     alignment and domain information
>PRK10091 MFS transport protein AraJ; Provisional Back     alignment and domain information
>PRK10133 L-fucose transporter; Provisional Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>PRK11195 lysophospholipid transporter LplT; Provisional Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
>PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>TIGR00886 2A0108 nitrite extrusion protein (nitrite facilitator) Back     alignment and domain information
>COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>PRK15402 multidrug efflux system translocase MdfA; Provisional Back     alignment and domain information
>PRK10473 multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>PRK11102 bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>PRK11043 putative transporter; Provisional Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter Back     alignment and domain information
>PRK15403 multidrug efflux system protein MdtM; Provisional Back     alignment and domain information
>TIGR00896 CynX cyanate transporter Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>PRK11652 emrD multidrug resistance protein D; Provisional Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>TIGR00885 fucP L-fucose:H+ symporter permease Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>TIGR00901 2A0125 AmpG-related permease Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>KOG2532|consensus Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>KOG2533|consensus Back     alignment and domain information
>KOG1330|consensus Back     alignment and domain information
>PRK10054 putative transporter; Provisional Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>TIGR00898 2A0119 cation transport protein Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>TIGR00806 rfc RFC reduced folate carrier Back     alignment and domain information
>TIGR00805 oat sodium-independent organic anion transporter Back     alignment and domain information
>PTZ00207 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00882 2A0105 oligosaccharide:H+ symporter Back     alignment and domain information
>TIGR00889 2A0110 nucleoside transporter Back     alignment and domain information
>TIGR00902 2A0127 phenyl proprionate permease family protein Back     alignment and domain information
>PRK11128 putative 3-phenylpropionic acid transporter; Provisional Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>KOG2615|consensus Back     alignment and domain information
>KOG3764|consensus Back     alignment and domain information
>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter Back     alignment and domain information
>PRK10207 dipeptide/tripeptide permease B; Provisional Back     alignment and domain information
>KOG2504|consensus Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial Back     alignment and domain information
>PF06609 TRI12: Fungal trichothecene efflux pump (TRI12); InterPro: IPR010573 This family consists of several fungal specific trichothecene efflux pump proteins Back     alignment and domain information
>PRK09584 tppB putative tripeptide transporter permease; Reviewed Back     alignment and domain information
>TIGR01301 GPH_sucrose GPH family sucrose/H+ symporter Back     alignment and domain information
>PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily Back     alignment and domain information
>COG2807 CynX Cyanate permease [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG0738 FucP Fucose permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK09669 putative symporter YagG; Provisional Back     alignment and domain information
>PF13347 MFS_2: MFS/sugar transport protein Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>PRK10429 melibiose:sodium symporter; Provisional Back     alignment and domain information
>KOG0255|consensus Back     alignment and domain information
>PF11700 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR024671 Autophagy is a major survival mechanism in which eukaryotes recycle cellular nutrients during stress conditions Back     alignment and domain information
>PRK15462 dipeptide/tripeptide permease D; Provisional Back     alignment and domain information
>PRK09848 glucuronide transporter; Provisional Back     alignment and domain information
>PF03825 Nuc_H_symport: Nucleoside H+ symporter Back     alignment and domain information
>TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family Back     alignment and domain information
>PF01306 LacY_symp: LacY proton/sugar symporter; InterPro: IPR022814 In bacteria there are a number of families of transport proteins, including symporters and antiporters, that mediate the intake of a variety of sugars with the concomitant uptake of hydrogen ions (proton symporters) [] Back     alignment and domain information
>TIGR00788 fbt folate/biopterin transporter Back     alignment and domain information
>TIGR00880 2_A_01_02 Multidrug resistance protein Back     alignment and domain information
>PRK11462 putative transporter; Provisional Back     alignment and domain information
>COG2270 Permeases of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
>KOG4686|consensus Back     alignment and domain information
>COG2211 MelB Na+/melibiose symporter and related transporters [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01272 gluP glucose/galactose transporter Back     alignment and domain information
>PF03137 OATP: Organic Anion Transporter Polypeptide (OATP) family; InterPro: IPR004156 This family consists of several eukaryotic Organic-Anion-Transporting Polypeptides (OATPs) Back     alignment and domain information
>PF03209 PUCC: PUCC protein; InterPro: IPR004896 This protein is required for high-level transcription of the PUC operon Back     alignment and domain information
>PF05631 DUF791: Protein of unknown function (DUF791); InterPro: IPR008509 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>COG3104 PTR2 Dipeptide/tripeptide permease [Amino acid transport and metabolism] Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>KOG2325|consensus Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>TIGR02332 HpaX 4-hydroxyphenylacetate permease Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>KOG2563|consensus Back     alignment and domain information
>TIGR00889 2A0110 nucleoside transporter Back     alignment and domain information
>KOG3626|consensus Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>PF01770 Folate_carrier: Reduced folate carrier; InterPro: IPR002666 The reduced folate carrier (a transmembrane glycoprotein) transports reduced folate into mammalian cells via the carrier mediated mechanism (as opposed to the receptor mediated mechanism) it also transports cytotoxic folate analogues used in chemotherapy [], such as methotrexate (MTX) Back     alignment and domain information
>TIGR00887 2A0109 phosphate:H+ symporter Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>KOG0254|consensus Back     alignment and domain information
>KOG2816|consensus Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>TIGR00895 2A0115 benzoate transport Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>PRK09705 cynX putative cyanate transporter; Provisional Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein Back     alignment and domain information
>PRK10213 nepI ribonucleoside transporter; Reviewed Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>PLN00028 nitrate transmembrane transporter; Provisional Back     alignment and domain information
>PF11700 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR024671 Autophagy is a major survival mechanism in which eukaryotes recycle cellular nutrients during stress conditions Back     alignment and domain information
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>KOG3098|consensus Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>PF06609 TRI12: Fungal trichothecene efflux pump (TRI12); InterPro: IPR010573 This family consists of several fungal specific trichothecene efflux pump proteins Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>PRK10133 L-fucose transporter; Provisional Back     alignment and domain information
>COG2270 Permeases of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>KOG0569|consensus Back     alignment and domain information
>PF00083 Sugar_tr: Sugar (and other) transporter; InterPro: IPR005828 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters Back     alignment and domain information
>PRK15402 multidrug efflux system translocase MdfA; Provisional Back     alignment and domain information
>KOG2615|consensus Back     alignment and domain information
>PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms Back     alignment and domain information
>KOG0252|consensus Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein Back     alignment and domain information
>TIGR00883 2A0106 metabolite-proton symporter Back     alignment and domain information
>TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>KOG1330|consensus Back     alignment and domain information
>PRK15403 multidrug efflux system protein MdtM; Provisional Back     alignment and domain information
>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter Back     alignment and domain information
>PRK15075 citrate-proton symporter; Provisional Back     alignment and domain information
>TIGR00902 2A0127 phenyl proprionate permease family protein Back     alignment and domain information
>PRK10091 MFS transport protein AraJ; Provisional Back     alignment and domain information
>PRK10054 putative transporter; Provisional Back     alignment and domain information
>TIGR00886 2A0108 nitrite extrusion protein (nitrite facilitator) Back     alignment and domain information
>TIGR00880 2_A_01_02 Multidrug resistance protein Back     alignment and domain information
>PRK10473 multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>PRK10429 melibiose:sodium symporter; Provisional Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>TIGR00903 2A0129 major facilitator 4 family protein Back     alignment and domain information
>PRK15034 nitrate/nitrite transport protein NarU; Provisional Back     alignment and domain information
>KOG0253|consensus Back     alignment and domain information
>PRK11102 bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>PRK11652 emrD multidrug resistance protein D; Provisional Back     alignment and domain information
>PRK11043 putative transporter; Provisional Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>PRK09848 glucuronide transporter; Provisional Back     alignment and domain information
>PRK11195 lysophospholipid transporter LplT; Provisional Back     alignment and domain information
>PF06813 Nodulin-like: Nodulin-like; InterPro: IPR010658 This entry represents a conserved region within plant nodulin-like proteins and a number of uncharacterised proteins Back     alignment and domain information
>COG0477 ProP Permeases of the major facilitator superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / Inorganic ion transport and metabolism / General function prediction only] Back     alignment and domain information
>TIGR00901 2A0125 AmpG-related permease Back     alignment and domain information
>PRK10207 dipeptide/tripeptide permease B; Provisional Back     alignment and domain information
>KOG4332|consensus Back     alignment and domain information
>TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial Back     alignment and domain information
>PRK14995 methyl viologen resistance protein SmvA; Provisional Back     alignment and domain information
>PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily Back     alignment and domain information
>PRK15462 dipeptide/tripeptide permease D; Provisional Back     alignment and domain information
>COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>TIGR00885 fucP L-fucose:H+ symporter permease Back     alignment and domain information
>COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00896 CynX cyanate transporter Back     alignment and domain information
>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
>TIGR00882 2A0105 oligosaccharide:H+ symporter Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>KOG3764|consensus Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>PF13347 MFS_2: MFS/sugar transport protein Back     alignment and domain information
>PRK11128 putative 3-phenylpropionic acid transporter; Provisional Back     alignment and domain information
>TIGR00806 rfc RFC reduced folate carrier Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter Back     alignment and domain information
>PTZ00207 hypothetical protein; Provisional Back     alignment and domain information
>PRK09669 putative symporter YagG; Provisional Back     alignment and domain information
>TIGR01272 gluP glucose/galactose transporter Back     alignment and domain information
>PRK09584 tppB putative tripeptide transporter permease; Reviewed Back     alignment and domain information
>TIGR00805 oat sodium-independent organic anion transporter Back     alignment and domain information
>COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF02487 CLN3: CLN3 protein; InterPro: IPR003492 Batten's disease, the juvenile variant of neuronal ceroid lipofuscionosis (NCL), is a recessively inherited disorder affecting children of 5-10 years of age Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>PF06779 DUF1228: Protein of unknown function (DUF1228); InterPro: IPR010645 This entry represents the N terminus of several putative bacterial membrane proteins, which may be sugar transporters Back     alignment and domain information
>COG2211 MelB Na+/melibiose symporter and related transporters [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF05978 UNC-93: Ion channel regulatory protein UNC-93; InterPro: IPR010291 The proteins in this family are represented by UNC-93 from Caenorhabditis elegans Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family Back     alignment and domain information
>TIGR00926 2A1704 Peptide:H+ symporter (also transports b-lactam antibiotics, the antitumor agent, bestatin, and various protease inhibitors) Back     alignment and domain information
>COG3104 PTR2 Dipeptide/tripeptide permease [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11462 putative transporter; Provisional Back     alignment and domain information
>KOG2504|consensus Back     alignment and domain information
>KOG2532|consensus Back     alignment and domain information
>TIGR00939 2a57 Equilibrative Nucleoside Transporter (ENT) Back     alignment and domain information
>COG0738 FucP Fucose permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF01306 LacY_symp: LacY proton/sugar symporter; InterPro: IPR022814 In bacteria there are a number of families of transport proteins, including symporters and antiporters, that mediate the intake of a variety of sugars with the concomitant uptake of hydrogen ions (proton symporters) [] Back     alignment and domain information
>KOG0637|consensus Back     alignment and domain information
>TIGR01301 GPH_sucrose GPH family sucrose/H+ symporter Back     alignment and domain information
>TIGR00788 fbt folate/biopterin transporter Back     alignment and domain information
>COG2807 CynX Cyanate permease [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF12832 MFS_1_like: MFS_1 like family Back     alignment and domain information
>PF03092 BT1: BT1 family; InterPro: IPR004324 Members of this family are transmembrane proteins Back     alignment and domain information
>PF05631 DUF791: Protein of unknown function (DUF791); InterPro: IPR008509 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>KOG4686|consensus Back     alignment and domain information
>PF03825 Nuc_H_symport: Nucleoside H+ symporter Back     alignment and domain information
>KOG2533|consensus Back     alignment and domain information
>KOG3762|consensus Back     alignment and domain information
>PF06813 Nodulin-like: Nodulin-like; InterPro: IPR010658 This entry represents a conserved region within plant nodulin-like proteins and a number of uncharacterised proteins Back     alignment and domain information
>PF06963 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 This entry represents the solute carrier family 40 member 1 family of proteins, also known as Ferroportin 1 Back     alignment and domain information
>COG0477 ProP Permeases of the major facilitator superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / Inorganic ion transport and metabolism / General function prediction only] Back     alignment and domain information
>TIGR00769 AAA ADP/ATP carrier protein family Back     alignment and domain information
>PF05978 UNC-93: Ion channel regulatory protein UNC-93; InterPro: IPR010291 The proteins in this family are represented by UNC-93 from Caenorhabditis elegans Back     alignment and domain information
>PF12832 MFS_1_like: MFS_1 like family Back     alignment and domain information
>KOG2325|consensus Back     alignment and domain information
>KOG1479|consensus Back     alignment and domain information
>PF03209 PUCC: PUCC protein; InterPro: IPR004896 This protein is required for high-level transcription of the PUC operon Back     alignment and domain information
>PF06779 DUF1228: Protein of unknown function (DUF1228); InterPro: IPR010645 This entry represents the N terminus of several putative bacterial membrane proteins, which may be sugar transporters Back     alignment and domain information
>KOG3810|consensus Back     alignment and domain information
>KOG2816|consensus Back     alignment and domain information
>PF00854 PTR2: POT family; InterPro: IPR000109 This entry represents the POT (proton-dependent oligopeptide transport) family, which all appear to be proton dependent transporters Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>KOG3762|consensus Back     alignment and domain information
>TIGR00926 2A1704 Peptide:H+ symporter (also transports b-lactam antibiotics, the antitumor agent, bestatin, and various protease inhibitors) Back     alignment and domain information
>KOG2563|consensus Back     alignment and domain information
>PF01733 Nucleoside_tran: Nucleoside transporter; InterPro: IPR002259 Delayed-early response (DER) gene products include growth progression factors and several unknown products of novel cDNAs Back     alignment and domain information
>KOG3880|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query493
1pw4_A 451 Glycerol-3-phosphate transporter; transmembrane, i 2e-04
1pw4_A451 Glycerol-3-phosphate transporter; transmembrane, i 3e-04
2gfp_A 375 EMRD, multidrug resistance protein D; membrane pro 3e-04
2gfp_A375 EMRD, multidrug resistance protein D; membrane pro 3e-04
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Length = 451 Back     alignment and structure
 Score = 42.7 bits (101), Expect = 2e-04
 Identities = 15/64 (23%), Positives = 19/64 (29%), Gaps = 5/64 (7%)

Query: 410 AFFFCGAIVGGLVFGWVADRFG-RV---PALVLTNLVGFIFGVVTAFTKSFWQFALCRFF 465
                       + G V+DR   RV     L+L   V    G V   T S     +  F 
Sbjct: 70  GISIAYGF-SKFIMGSVSDRSNPRVFLPAGLILAAAVMLFMGFVPWATSSIAVMFVLLFL 128

Query: 466 VGLS 469
            G  
Sbjct: 129 CGWF 132


>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Length = 451 Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Length = 375 Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Length = 375 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query493
4gc0_A491 D-xylose-proton symporter; MFS, transport protein; 99.96
3o7q_A438 L-fucose-proton symporter; transporter, multi-PASS 99.9
1pw4_A451 Glycerol-3-phosphate transporter; transmembrane, i 99.88
4aps_A491 DI-OR tripeptide H+ symporter; transport protein, 99.84
2gfp_A375 EMRD, multidrug resistance protein D; membrane pro 99.83
2cfq_A417 Lactose permease; transport, transport mechanism, 99.7
2xut_A524 Proton/peptide symporter family protein; transport 99.64
4gc0_A 491 D-xylose-proton symporter; MFS, transport protein; 98.77
3o7q_A 438 L-fucose-proton symporter; transporter, multi-PASS 98.56
1pw4_A 451 Glycerol-3-phosphate transporter; transmembrane, i 98.45
2cfq_A417 Lactose permease; transport, transport mechanism, 98.33
2gfp_A 375 EMRD, multidrug resistance protein D; membrane pro 98.26
4aps_A 491 DI-OR tripeptide H+ symporter; transport protein, 98.22
2xut_A 524 Proton/peptide symporter family protein; transport 98.17
>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure
Probab=99.96  E-value=7.1e-29  Score=257.26  Aligned_cols=157  Identities=19%  Similarity=0.295  Sum_probs=129.0

Q ss_pred             cchhhHHHHHHHHHHHhhhhhhhhhhcccCChhHHHHHHHHHHHHHHHHH------------------hcccHHHHHHHH
Q psy13410         67 DTLSTWAQAFFFCGAIVGGLVFGWVADRFGRVPALVLTNLVGFIFGVITA------------------FTKSFWQFALCR  128 (493)
Q Consensus        67 ~~~~~~~~s~~~lg~~ig~~i~g~l~Dr~GRr~~l~~~~~~~~i~~~~~a------------------~a~s~~~l~~~R  128 (493)
                      +.+.+++++++++|..+|++++|+++||+|||++++++.+++.+++++++                  +++|+++++++|
T Consensus        54 ~~~~g~~~s~~~~G~~iG~~~~G~laDr~GRk~~l~~~~~l~~i~~i~~a~~~~~~~~~~~~~~~~~~~a~~~~~l~~~R  133 (491)
T 4gc0_A           54 NSLLGFCVASALIGCIIGGALGGYCSNRFGRRDSLKIAAVLFFISGVGSAWPELGFTSINPDNTVPVYLAGYVPEFVIYR  133 (491)
T ss_dssp             HHHHHHHHHTHHHHHHHHHHHHHHHHHHTCHHHHHHHHHHHHHHHHHHHHCTTTTTSCSSSSSSCCGGGGGCHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCHHHHHHHHHHHHHHHHHHHHHhhhhhhhcchhHHHHHHhhhHHHHHHHH
Confidence            45678999999999999999999999999999999999999999999999                  478999999999


Q ss_pred             HHHhhcccchhhhhhhhccccccccCccccccccccccccchhHHHHHHHHHHHHHHHH--------------HHHHHHH
Q psy13410        129 FFVGLSFDNCFTMMYILGMPIYKTRNLDFDDVLPHLGEFGRYQKVLFFSMILFAFAEAF--------------VYFSQIF  194 (493)
Q Consensus       129 ~l~Gi~~g~~~~~~~~~i~e~~~~~~R~~~~~~~~~g~~g~~~~~~~~~~~l~~~~~~~--------------~w~~~~~  194 (493)
                      +++|+|.|+..+++.++++|++|+++|         +..+...+.....+.+.+.....              .||+.+.
T Consensus       134 ~l~G~g~G~~~~~~~~~i~E~~p~~~r---------g~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  204 (491)
T 4gc0_A          134 IIGGIGVGLASMLSPMYIAELAPAHIR---------GKLVSFNQFAIIFGQLLVYCVNYFIARSGDASWLNTDGWRYMFA  204 (491)
T ss_dssp             HHHHHHHHHHHHHHHHHHHTTSCGGGH---------HHHHHHHHHHHHHHHHHHHHHHHHHHTTSCTTTTTTTHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHhhCCHHhh---------hhhHHhhhhhhhhhhhhhhhcchhhccccccccccchhhHHHhh
Confidence            999999999999999999999999988         44444444444444433333222              2777766


Q ss_pred             HHHHhhh----hheeccCCCchhhhhhccCHHHHHHHHHHHhcc
Q psy13410        195 ITVIPEH----YWCRVPELSHLDYADKEESHEEADTIAESYIKR  234 (493)
Q Consensus       195 ~~~i~~~----~~~~~pesp~~~~l~~~~~~~~a~~~l~~~~~~  234 (493)
                      ...++.+    ..+++|||||  |+..+++.+++.+.+++....
T Consensus       205 ~~~~~~~~~~~~~~~~peSp~--~L~~~~~~~~a~~~l~~~~~~  246 (491)
T 4gc0_A          205 SECIPALLFLMLLYTVPESPR--WLMSRGKQEQAEGILRKIMGN  246 (491)
T ss_dssp             TTHHHHHHHHHHGGGSCCCHH--HHHHTTCHHHHHHHHHHHHHH
T ss_pred             hhhhhhhhhhhhhhcCCCChH--HHHHcCchhHHHHhHHHhcCC
Confidence            6555544    3678999999  999999999999988877554



>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure
>2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* Back     alignment and structure
>2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} Back     alignment and structure
>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure
>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
>2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure
>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
>2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 493
d1pw4a_447 f.38.1.1 (A:) Glycerol-3-phosphate transporter {Es 5e-06
d1pw4a_ 447 f.38.1.1 (A:) Glycerol-3-phosphate transporter {Es 6e-04
d1pv7a_417 f.38.1.2 (A:) Lactose permease {Escherichia coli [ 2e-04
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Length = 447 Back     information, alignment and structure

class: Membrane and cell surface proteins and peptides
fold: MFS general substrate transporter
superfamily: MFS general substrate transporter
family: Glycerol-3-phosphate transporter
domain: Glycerol-3-phosphate transporter
species: Escherichia coli [TaxId: 562]
 Score = 46.2 bits (108), Expect = 5e-06
 Identities = 37/386 (9%), Positives = 85/386 (22%), Gaps = 24/386 (6%)

Query: 72  WAQAFFFCGAIVGGLVFGWVADRFGRVP----ALVLTNLVGFIFGVITAFTKSFWQFALC 127
           +A +           + G V+DR          L+L   V    G +   T S     + 
Sbjct: 63  FALSGISIAYGFSKFIMGSVSDRSNPRVFLPAGLILAAAVMLFMGFVPWATSSIAVMFVL 122

Query: 128 RFFVGLSFDNCFTMMYILGMPIYKTRNLDFDDVLPHLGEFGRYQKVLFFSMILFAFAEAF 187
            F  G      +       +  +  +                +         +       
Sbjct: 123 LFLCGWFQGMGWPPCGRTMVHWWSQKERGGI--------VSVWNCAHNVGGGIPPLLFLL 174

Query: 188 VYFSQIFITVIPEHYWCRVPELSHLDYADKEESHEEADTIAESYIKRNHTGDRGLHNSPR 247
                                ++   +A   ++ +          K ++  D        
Sbjct: 175 GMAWFNDWHAALYMPAFCAILVALFAFAMMRDTPQSCGLPPIEEYKNDYPDDYNEKAEQE 234

Query: 248 SSTHGSLNRESLKSRSLTRRNMDFVNRGFGENLGEFGRYQKVLFFSMILFAFAEAFVYFS 307
            +      +  L ++ L    +  V                          + +   +F+
Sbjct: 235 LTAKQIFMQYVLPNKLLWYIAIANVFVYLLRY-----------GILDWSPTYLKEVKHFA 283

Query: 308 QIFITVIPEHYWCRVPELSHLDFEQRKLISIPQIGAAFDSCRMYAVNYTHLLGSGITKAD 367
               +     Y       + L       +     GA            T +         
Sbjct: 284 LDKSSWAYFLYEYAGIPGTLLCGWMSDKVFRGNRGATGVFFMTLVTIATIVYWMNPAGNP 343

Query: 368 PSWPIVECQHGWDYDHSDIPYTTIATELNWVCTQDTLSTWAQAF-FFCGAIVGGLVFGWV 426
               I     G+      +     A EL       T + +   F +  G++    + G+ 
Sbjct: 344 TVDMICMIVIGFLIYGPVMLIGLHALELAPKKAAGTAAGFTGLFGYLGGSVAASAIVGYT 403

Query: 427 ADRFGRVPALVLTNLVGFIFGVVTAF 452
            D FG     ++      +  ++   
Sbjct: 404 VDFFGWDGGFMVMIGGSILAVILLIV 429


>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Length = 447 Back     information, alignment and structure
>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Length = 417 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query493
d1pw4a_447 Glycerol-3-phosphate transporter {Escherichia coli 99.89
d1pv7a_417 Lactose permease {Escherichia coli [TaxId: 562]} 99.73
d1pv7a_417 Lactose permease {Escherichia coli [TaxId: 562]} 98.43
d1pw4a_ 447 Glycerol-3-phosphate transporter {Escherichia coli 98.43
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: MFS general substrate transporter
superfamily: MFS general substrate transporter
family: Glycerol-3-phosphate transporter
domain: Glycerol-3-phosphate transporter
species: Escherichia coli [TaxId: 562]
Probab=99.89  E-value=6e-23  Score=206.68  Aligned_cols=95  Identities=11%  Similarity=-0.005  Sum_probs=88.6

Q ss_pred             ccccccccccchhhHHHHHHHHHHHhhhhhhhhhhcccCChhHHHHHHHHHHHHHHHHHhcc----cHHHHHHHHHHHhh
Q psy13410         58 PQLNWVCTQDTLSTWAQAFFFCGAIVGGLVFGWVADRFGRVPALVLTNLVGFIFGVITAFTK----SFWQFALCRFFVGL  133 (493)
Q Consensus        58 ~~~~~~~~~~~~~~~~~s~~~lg~~ig~~i~g~l~Dr~GRr~~l~~~~~~~~i~~~~~a~a~----s~~~l~~~R~l~Gi  133 (493)
                      .|+++   +..+.+++.+++.++.+++++++|+++||+|||+++.++.++.+++.+++++++    +++.+++.|++.|+
T Consensus        52 ~~~g~---s~~~~g~~~s~~~~~~~~~~~~~G~l~Dr~g~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~  128 (447)
T d1pw4a_          52 VEQGF---SRGDLGFALSGISIAYGFSKFIMGSVSDRSNPRVFLPAGLILAAAVMLFMGFVPWATSSIAVMFVLLFLCGW  128 (447)
T ss_dssp             TSSTT---CSSCHHHHHHHHHHHHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHHHHHHHHCHHHHSSSSHHHHHHHHHHH
T ss_pred             HHhCc---CHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCchHHHHHHHHHHHHHHhhccccchhhhhHHHHHHHHHHHHH
Confidence            45677   788899999999999999999999999999999999999999999999998874    78899999999999


Q ss_pred             cccchhhhhhhhccccccccCc
Q psy13410        134 SFDNCFTMMYILGMPIYKTRNL  155 (493)
Q Consensus       134 ~~g~~~~~~~~~i~e~~~~~~R  155 (493)
                      +.|...+....++.|++|+++|
T Consensus       129 ~~~~~~~~~~~~i~~~~~~~~r  150 (447)
T d1pw4a_         129 FQGMGWPPCGRTMVHWWSQKER  150 (447)
T ss_dssp             HHHHTHHHHHHHHHTTCTTTHH
T ss_pred             hhhhhhhHHHHHHHHHHHhhcc
Confidence            9999999999999999999866



>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure