Psyllid ID: psy13453

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760----
MAWRSLIPKLAYPSETLSLLIYESFKATHSLSGTPDQVRLSGLPDSEWLAYLTLRTIYESFRKSFLCPMCSGYCGRTLHQDIQSLNAPVSNGPLKVGGVLRRVYSSCLVPRGQKSLRTTVLFHFLFQHWQIPLGRRFRALKLWMTLRSYGLKGLQAYLRKHISLAKKFADLVEQDDRFELVCPPSMGLVCFRLKVRFWDKLDNLFGTISFGDNDLNKAVYDRIIARKVIYIVKGSFQDRLFMRFAICSSQTEESDVQLGWNEIRTATEEVLRGKSLGPAGKVMGGAQAIAGTESSGPADQVLGEIQPVARAESLGPVDELMGDVQAIAGGKNSGPVETVLNSDTPQEVRSEDTPLGGVLGEESSGGCGQQKLTPPVAKPLTVQGPVNPVDRSMNKAPPPYSIAIPLLDHNEVPGNKSFRGHSENLITLIIASDLIINSIPLTKASPVTPPPNEEFREFGKAAIDFIADYVDNIRERPVLPSVEPGYLASLVPGEMPEEGEDWRHIMRDMNTVIMPGITHWQSPQFNAYFPTGSSYPSIVGDMLSGAFGLIGFSWLSSPACTELEVLVMNWLGKALGLPEEFLNCSPGPGGGIIQSTASEATLVSILVAKRKMINHWQSKNPSLTENDIRNKLVAYTSDQSNSSVEKSAIIGDVPVRQLRSDDNGVLRGDALLTAVKEDLAKGLIPCCLIATLGTTGTCAFDNLEELGPICQEYNIWLHVDAAYAGSALLLPEYAHLKRGLEYVDSFDFNTHKWLLVNFDCSAMW
ccccccccccccccccHHHHHHHHHcccccccccccccccccccccccHHcEEEHHccccccEEEEcccccccccccccccccccccccccccccccccHHHccccccccccHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEccccEEEEEEEEEccccccccccccccccccHHHHHHHHHHHHccccEEEEEEEEccEEEEEEEEccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHccccccccccccHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHcccccccccccccccEEEcccccHHHHHHHHHHHHHHHHHHHHccccccccccccccEEEcccccHHHHHHHHHHccccEEEccccccccccHHHHHHHHHHHHHccccEEEEEEccccccccccccHHHHHHHHHHcccEEEEcHHcccccccccccHHHHccccccccccccccccccccccccccc
ccHHHHcHHcccccHHHHHHHHHHccHHcccccccHHHHHcccccHHHHHHHHHHHHHHHHHHHHccHHHHHHcccEEEcccHcccccccEEEEcccEEEEEEcccccccccHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHccccEEEEccEEEEEEEEEEccccccccccccccccccccHHHHHHHHHHHccccEEEEEEEEccEEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHcccccccccccccccccccccccccccccccccccccEEcccccccHHHHcccccccccccccccccccHccccHHHHHHHEcccccccccccccccccccEEEEcccccccccccccccccccccEEEEccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHcccccccccccHHHHHHHHHHHcccccccccccccEEEccccccHHHHHHHHHHHHHHHHcHcHcccHHHHHHHHHHHHHHHHHHcccHHHHcccccccccEEEccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHEccHHHcHHHHHHHHHHHEEEEEccccccccccHHHHHHHHHHHHHccccEEEEEEEcccccccccccHHHHHHHHHHccEEEEEEcHHcccccccHHHHHHHccHHEccccccccccEEEEEccccccc
mawrslipklaypsetLSLLIYESFKathslsgtpdqvrlsglpdsewLAYLTLRTIYESFRKsflcpmcsgycgrtlhqdiqslnapvsngplkvgGVLRRVYssclvprgqksLRTTVLFHFLFQHWQIPLGRRFRALKLWMTLRSYGLKGLQAYLRKHISLAKKFADLVeqddrfelvcppsmglvcFRLKVRFWDKldnlfgtisfgdndlnkAVYDRIIARKVIYIVKGSFQDRLFMRFAICssqteesdvqLGWNEIRTATEEVLrgkslgpagkvmggaqaiagtessgpadqvlgeiqpvaraeslgpvdelMGDVqaiaggknsgpvetvlnsdtpqevrsedtplggvlgeessggcgqqkltppvakpltvqgpvnpvdrsmnkapppysiaiplldhnevpgnksfrghsENLITLIIASDliinsipltkaspvtpppneefREFGKAAIDFIADYVdnirerpvlpsvepgylaslvpgempeegeDWRHIMRDMNtvimpgithwqspqfnayfptgssypsivgDMLSGAFGLigfswlsspacteLEVLVMNWLGkalglpeeflncspgpgggiiqsTASEATLVSILVAKRKMINHwqsknpsltendIRNKLVAYtsdqsnssveksaiigdvpvrqlrsddngvlRGDALLTAVKEDLAkglipccliatlgttgtcafdnleelgpicqeynIWLHVDAAYAGSALLLPEYAHLKRgleyvdsfdfntHKWLLVNFDCSAMW
mawrslipklaypSETLSLLIYESFKATHSLSGTPDQVRLSGLPDSEWLAYLTLRTIYESFRKSFLCPMCSGYCGRTLHQDIQSLNAPVSNGPLKVGGVLRRVYSSCLVPRGQKSLRTTVLFHFLfqhwqiplGRRFRALKLWMTLRSYGLKGLQAYLRKHISLAKKFADLVEQDDRFELVCPPSMGLVCFRLKVRFWDKLDNLfgtisfgdndlNKAVYDRIIARKVIYIVKGSFQDRLFMRFAICSSqteesdvqlgWNEIRTATEEVLRGKSLGPAGKVMGGAQAIAGTESSGPADQVLGEIQPVARAESLGPVDELMGDVQAIaggknsgpvETVLnsdtpqevrseDTPLGGVLGEESSGGCGQQKLTPPVAKPLTVQGPVNPVDRSMNKAPPPYSIAIPLLDHNEVPGNKSFRGHSENLITLIIASDLIINSIPLTKASPVTPPPNEEFREFGKAAIDFIADYVDNIRERPVLPSVEPGYLASLVPGEMPEEGEDWRHIMRDMNTVIMPGITHWQSPQFNAYFPTGSSYPSIVGDMLSGAFGLIGFSWLSSPACTELEVLVMNWLGKALGLPEEFLNCSPGPGGGIIQSTASEATLVSILVAKRKMINHwqsknpsltendIRNKLVAYtsdqsnssveksaiigdvpvrqlrsddngVLRGDALLTAVKEDLAKGLIPCCLIATLGTTGTCAFDNLEELGPICQEYNIWLHVDAAYAGSALLLPEYAHLKRGLEYVDSFDFNTHKWLLVNFDCSAMW
MAWRSLIPKLAYPSETLSLLIYESFKATHSLSGTPDQVRLSGLPDSEWLAYLTLRTIYESFRKSFLCPMCSGYCGRTLHQDIQSLNAPVSNGPLKVGGVLRRVYSSCLVPRGQKSLRTTVLFHFLFQHWQIPLGRRFRALKLWMTLRSYGLKGLQAYLRKHISLAKKFADLVEQDDRFELVCPPSMGLVCFRLKVRFWDKLDNLFGTISFGDNDLNKAVYDRIIARKVIYIVKGSFQDRLFMRFAICSSQTEESDVQLGWNEIRTATEEVLRGKSLGPAGKVMGGAQAIAGTESSGPADQVLGEIQPVARAESLGPVDELMGDVQAIAGGKNSGPVETVLNSDTPQEVRSEDTPlggvlgeessggcgQQKLTPPVAKPLTVQGPVNPVDRSMNKAPPPYSIAIPLLDHNEVPGNKSFRGHSENLITLIIASDLIINSIPLTKASPVTPPPNEEFREFGKAAIDFIADYVDNIRERPVLPSVEPGYLASLVPGEMPEEGEDWRHIMRDMNTVIMPGITHWQSPQFNAYFPTGSSYPSIVGDMLSGAFGLIGFSWLSSPACTELEVLVMNWLGKALGLPEEFLNCSPGPGGGIIQSTASEATLVSILVAKRKMINHWQSKNPSLTENDIRNKLVAYTSDQSNSSVEKSAIIGDVPVRQLRSDDNGVLRGDALLTAVKEDLAKGLIPCCLIATLGTTGTCAFDNLEELGPICQEYNIWLHVDAAYAGSALLLPEYAHLKRGLEYVDSFDFNTHKWLLVNFDCSAMW
****SLIPKLAYPSETLSLLIYESFKATHSLSGT*DQVRLSGLPDSEWLAYLTLRTIYESFRKSFLCPMCSGYCGRTLHQDIQSLNAPVSNGPLKVGGVLRRVYSSCLVPRGQKSLRTTVLFHFLFQHWQIPLGRRFRALKLWMTLRSYGLKGLQAYLRKHISLAKKFADLVEQDDRFELVCPPSMGLVCFRLKVRFWDKLDNLFGTISFGDNDLNKAVYDRIIARKVIYIVKGSFQDRLFMRFAICSSQTEESDVQLGWNEIRTATEEV***********************************************************************************************************************************IAIPLLDH********FRGHSENLITLIIASDLIINSIPLTK***********FREFGKAAIDFIADYVDNIRERPVLPSVEPGYLASLVPG*****GEDWRHIMRDMNTVIMPGITHWQSPQFNAYFPTGSSYPSIVGDMLSGAFGLIGFSWLSSPACTELEVLVMNWLGKALGLPEEFLNCSPGPGGGIIQSTASEATLVSILVAKRKMINHWQ*******************************IIGDVPVRQLRSDDNGVLRGDALLTAVKEDLAKGLIPCCLIATLGTTGTCAFDNLEELGPICQEYNIWLHVDAAYAGSALLLPEYAHLKRGLEYVDSFDFNTHKWLLVNFDCS***
****SLIPKLAYPSETLSLLIYESFKATHSLSGTPDQVRLSGLPDSEWLAYLTLRTIYESFRKSFLCPMCSGYCGRTLHQDIQSLNAPVSNGPLKVGGVLRRVYSSCLVPRGQKSLRTTVLFHFLFQHWQIPLGRRFRALKLWMTLRSYGLKGLQAYLRKHISLAKKFADLVEQDDRFELVCPPSMGLVCFRLKVRFWDKLDNLFGTISFGDNDLNKAVYDRIIARKVIYIVKGSFQDRLFMRFAICSSQTEESDVQLGWNEIRTATEEV***************************************************************************************************************************************************************IASDLIINSI***********PNEEFREFGKAAIDFIADYVDNIRERPVLPSVEPGYLASLVP*******EDWRHIMRDMNTVIMPGITHWQSPQFNAYFPTGSSYPSIVGDMLSGAFGLIGFSWLSSPACTELEVLVMNWLGKALGLPEEFLNCSPGPGGGIIQSTASEATLVSILVAKRKMINHWQSKNPSLTENDIRNKLVAYTSDQSNSSVEKSAIIGDVPVRQLRSDDNGVLRGDALLTAVKEDLAKGLIPCCLIATLGTTGTCAFDNLEELGPICQEYNIWLHVDAAYAGSALLLPEYAHLKRGLEYVDSFDFNTHKWLLVNFDCSAMW
MAWRSLIPKLAYPSETLSLLIYESFKATHSLSGTPDQVRLSGLPDSEWLAYLTLRTIYESFRKSFLCPMCSGYCGRTLHQDIQSLNAPVSNGPLKVGGVLRRVYSSCLVPRGQKSLRTTVLFHFLFQHWQIPLGRRFRALKLWMTLRSYGLKGLQAYLRKHISLAKKFADLVEQDDRFELVCPPSMGLVCFRLKVRFWDKLDNLFGTISFGDNDLNKAVYDRIIARKVIYIVKGSFQDRLFMRFAICSSQTEESDVQLGWNEIRTATEEVLRGKSLGPAGKVMGGAQAIAGTESSGPADQVLGEIQPVARAESLGPVDELMGDVQAIAGGKNSGPVETVLN***********TPLGGVLGEESSGGCGQQKLTPPVAKPLTVQGPVNPVDRSMNKAPPPYSIAIPLLDHNEVPGNKSFRGHSENLITLIIASDLIINSIPLTKASPVTPPPNEEFREFGKAAIDFIADYVDNIRERPVLPSVEPGYLASLVPGEMPEEGEDWRHIMRDMNTVIMPGITHWQSPQFNAYFPTGSSYPSIVGDMLSGAFGLIGFSWLSSPACTELEVLVMNWLGKALGLPEEFLNCSPGPGGGIIQSTASEATLVSILVAKRKMINHWQSKNPSLTENDIRNKLVAYT********EKSAIIGDVPVRQLRSDDNGVLRGDALLTAVKEDLAKGLIPCCLIATLGTTGTCAFDNLEELGPICQEYNIWLHVDAAYAGSALLLPEYAHLKRGLEYVDSFDFNTHKWLLVNFDCSAMW
*AWRSLIPKLAYPSETLSLLIYESFKATHSLSGTPDQVRLSGLPDSEWLAYLTLRTIYESFRKSFLCPMCSGYCGRTLHQDIQSLNAPVSNGPLKVGGVLRRVYSSCLVPRGQKSLRTTVLFHFLFQHWQIPLGRRFRALKLWMTLRSYGLKGLQAYLRKHISLAKKFADLVEQDDRFELVCPPSMGLVCFRLKVRFW***********FGDNDLNKAVYDRIIARKVIYIVKGSFQDRLFMRFAICSSQTEESDVQLGWNEIRTATEEVLRGK*****************************************************************************DTPLGGVLGEESSGGCGQQKLTPPVAKPLTVQGPVNPVDRSMNKAPPPYSIAIPLLDHNEVPGNKSFRGHSENLITLIIASDLII******KASPVTPPPNEEFREFGKAAIDFIADYVDNIRERPVLPSVEPGYLASLVPGEMPEEGEDWRHIMRDMNTVIMPGITHWQSPQFNAYFPTGSSYPSIVGDMLSGAFGLIGFSWLSSPACTELEVLVMNWLGKALGLPEEFLNCSPGPGGGIIQSTASEATLVSILVAKRKMINHWQSKNPSLTENDIRNKLVAYTSDQSNSSVEKSAIIGDVPVRQLRSDDNGVLRGDALLTAVKEDLAKGLIPCCLIATLGTTGTCAFDNLEELGPICQEYNIWLHVDAAYAGSALLLPEYAHLKRGLEYVDSFDFNTHKWLLVNFDCSAMW
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAWRSLIPKLAYPSETLSLLIYESFKATHSLSGTPDQVRLSGLPDSEWLAYLTLRTIYESFRKSFLCPMCSGYCGRTLHQDIQSLNAPVSNGPLKVGGVLRRVYSSCLVPRGQKSLRTTVLFHFLFQHWQIPLGRRFRALKLWMTLRSYGLKGLQAYLRKHISLAKKFADLVEQDDRFELVCPPSMGLVCFRLKVRFWDKLDNLFGTISFGDNDLNKAVYDRIIARKVIYIVKGSFQDRLFMRFAICSSQTEESDVQLGWNEIRTATEEVLRGKSLGPAGKVMGGAQAIAGTESSGPADQVLGEIQPVARAESLGPVDELMGDVQAIAGGKNSGPVETVLNSDTPQEVRSEDTPLGGVLGEESSGGCGQQKLTPPVAKPLTVQGPVNPVDRSMNKAPPPYSIAIPLLDHNEVPGNKSFRGHSENLITLIIASDLIINSIPLTKASPVTPPPNEEFREFGKAAIDFIADYVDNIRERPVLPSVEPGYLASLVPGEMPEEGEDWRHIMRDMNTVIMPGITHWQSPQFNAYFPTGSSYPSIVGDMLSGAFGLIGFSWLSSPACTELEVLVMNWLGKALGLPEEFLNCSPGPGGGIIQSTASEATLVSILVAKRKMINHWQSKNPSLTENDIRNKLVAYTSDQSNSSVEKSAIIGDVPVRQLRSDDNGVLRGDALLTAVKEDLAKGLIPCCLIATLGTTGTCAFDNLEELGPICQEYNIWLHVDAAYAGSALLLPEYAHLKRGLEYVDSFDFNTHKWLLVNFDCSAMW
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query764 2.2.26 [Sep-21-2011]
P18486 510 Alpha-methyldopa hypersen yes N/A 0.380 0.570 0.580 1e-113
P14173 480 Aromatic-L-amino-acid dec yes N/A 0.388 0.618 0.575 1e-108
P05031 510 Aromatic-L-amino-acid dec no N/A 0.405 0.607 0.578 1e-106
P20711 480 Aromatic-L-amino-acid dec no N/A 0.386 0.614 0.569 1e-106
O96567 510 Aromatic-L-amino-acid dec N/A N/A 0.405 0.607 0.578 1e-105
P48861 508 Aromatic-L-amino-acid dec N/A N/A 0.386 0.580 0.565 1e-105
O88533 480 Aromatic-L-amino-acid dec yes N/A 0.388 0.618 0.568 1e-103
P22781 480 Aromatic-L-amino-acid dec yes N/A 0.386 0.614 0.556 1e-103
P27718 487 Aromatic-L-amino-acid dec yes N/A 0.386 0.605 0.572 1e-102
P80041 486 Aromatic-L-amino-acid dec yes N/A 0.386 0.606 0.559 1e-101
>sp|P18486|L2AM_DROME Alpha-methyldopa hypersensitive protein OS=Drosophila melanogaster GN=amd PE=2 SV=2 Back     alignment and function desciption
 Score =  410 bits (1053), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 181/312 (58%), Positives = 248/312 (79%)

Query: 453 EEFREFGKAAIDFIADYVDNIRERPVLPSVEPGYLASLVPGEMPEEGEDWRHIMRDMNTV 512
           +EFREFGKAAID+IADY++NIR+  VLP+VEPGYL  L+P EMPEE E W+ ++ D++ V
Sbjct: 4   KEFREFGKAAIDYIADYLENIRDDDVLPNVEPGYLLDLLPTEMPEEPEAWKDVLGDISRV 63

Query: 513 IMPGITHWQSPQFNAYFPTGSSYPSIVGDMLSGAFGLIGFSWLSSPACTELEVLVMNWLG 572
           I PG+THWQSP  +AY+PT +SYPSIVG+ML+  FG+IGFSW+ SPACTELEV+VM+WL 
Sbjct: 64  IKPGLTHWQSPHMHAYYPTSTSYPSIVGEMLASGFGVIGFSWICSPACTELEVVVMDWLA 123

Query: 573 KALGLPEEFLNCSPGPGGGIIQSTASEATLVSILVAKRKMINHWQSKNPSLTENDIRNKL 632
           K L LP  F + S GPGGG+IQ +ASEA LV++L A+ + + +++  +P L+E+++R +L
Sbjct: 124 KFLKLPAHFQHASDGPGGGVIQGSASEAVLVAVLAAREQAVANYRESHPELSESEVRGRL 183

Query: 633 VAYTSDQSNSSVEKSAIIGDVPVRQLRSDDNGVLRGDALLTAVKEDLAKGLIPCCLIATL 692
           VAY+SDQSNS +EK+ ++  +P+R L + ++ VLRGD L  A++ED+A G IP   +ATL
Sbjct: 184 VAYSSDQSNSCIEKAGVLAAMPIRLLPAGEDFVLRGDTLRGAIEEDVAAGRIPVICVATL 243

Query: 693 GTTGTCAFDNLEELGPICQEYNIWLHVDAAYAGSALLLPEYAHLKRGLEYVDSFDFNTHK 752
           GTTGTCA+D++E L  +C+E+ +WLHVDAAYAG A  L E + L++GL+ VDS +FN HK
Sbjct: 244 GTTGTCAYDDIESLSAVCEEFKVWLHVDAAYAGGAFALEECSDLRKGLDRVDSLNFNLHK 303

Query: 753 WLLVNFDCSAMW 764
           ++LVNFDCSAMW
Sbjct: 304 FMLVNFDCSAMW 315
Participates in catecholamine metabolism. It plays a vital role in cuticle development.
Drosophila melanogaster (taxid: 7227)
EC: 4EC: .EC: 1EC: .EC: 1EC: .EC: -
>sp|P14173|DDC_RAT Aromatic-L-amino-acid decarboxylase OS=Rattus norvegicus GN=Ddc PE=1 SV=1 Back     alignment and function description
>sp|P05031|DDC_DROME Aromatic-L-amino-acid decarboxylase OS=Drosophila melanogaster GN=Ddc PE=1 SV=4 Back     alignment and function description
>sp|P20711|DDC_HUMAN Aromatic-L-amino-acid decarboxylase OS=Homo sapiens GN=DDC PE=1 SV=2 Back     alignment and function description
>sp|O96567|DDC_DROSI Aromatic-L-amino-acid decarboxylase OS=Drosophila simulans GN=Ddc PE=3 SV=2 Back     alignment and function description
>sp|P48861|DDC_MANSE Aromatic-L-amino-acid decarboxylase OS=Manduca sexta GN=Ddc PE=2 SV=1 Back     alignment and function description
>sp|O88533|DDC_MOUSE Aromatic-L-amino-acid decarboxylase OS=Mus musculus GN=Ddc PE=2 SV=1 Back     alignment and function description
>sp|P22781|DDC_CAVPO Aromatic-L-amino-acid decarboxylase OS=Cavia porcellus GN=DDC PE=2 SV=1 Back     alignment and function description
>sp|P27718|DDC_BOVIN Aromatic-L-amino-acid decarboxylase OS=Bos taurus GN=DDC PE=2 SV=2 Back     alignment and function description
>sp|P80041|DDC_PIG Aromatic-L-amino-acid decarboxylase OS=Sus scrofa GN=DDC PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query764
383858387512 PREDICTED: aromatic-L-amino-acid decarbo 0.388 0.580 0.629 1e-121
189237523 2575 PREDICTED: similar to AGAP009091-PA [Tri 0.387 0.114 0.623 1e-121
270006966501 hypothetical protein TcasGA2_TC013401 [T 0.387 0.590 0.623 1e-121
357611531501 hypothetical protein KGM_15075 [Danaus p 0.388 0.592 0.648 1e-121
193603599517 PREDICTED: aromatic-L-amino-acid decarbo 0.387 0.572 0.642 1e-120
389609325503 dopa decarboxylase 2 [Papilio xuthus] 0.388 0.590 0.642 1e-120
345493638519 PREDICTED: aromatic-L-amino-acid decarbo 0.387 0.570 0.613 1e-118
350418517512 PREDICTED: alpha-methyldopa hypersensiti 0.386 0.576 0.613 1e-117
340722534512 PREDICTED: alpha-methyldopa hypersensiti 0.388 0.580 0.607 1e-116
157127150521 aromatic amino acid decarboxylase [Aedes 0.386 0.566 0.596 1e-115
>gi|383858387|ref|XP_003704683.1| PREDICTED: aromatic-L-amino-acid decarboxylase-like [Megachile rotundata] Back     alignment and taxonomy information
 Score =  444 bits (1141), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 197/313 (62%), Positives = 249/313 (79%)

Query: 452 NEEFREFGKAAIDFIADYVDNIRERPVLPSVEPGYLASLVPGEMPEEGEDWRHIMRDMNT 511
            +EF +FGKAAIDF+A+Y D +R R VLP VEPGYL+ L+P E P++ E W+ +++D+  
Sbjct: 3   TKEFVDFGKAAIDFVANYTDTLRNRKVLPDVEPGYLSELLPEEAPQKAETWQEVLKDVEE 62

Query: 512 VIMPGITHWQSPQFNAYFPTGSSYPSIVGDMLSGAFGLIGFSWLSSPACTELEVLVMNWL 571
            I+PG+THW SP F+A++PT +SYP+IVG++LS     IGFSWL+SPACTELEV+ MNWL
Sbjct: 63  YIIPGVTHWNSPHFHAFYPTANSYPAIVGEILSCGISCIGFSWLASPACTELEVITMNWL 122

Query: 572 GKALGLPEEFLNCSPGPGGGIIQSTASEATLVSILVAKRKMINHWQSKNPSLTENDIRNK 631
           GK +GLP+EFLNCS GPGGG+IQ +ASE++LV +L AK +     +  +P   E  I++K
Sbjct: 123 GKLIGLPKEFLNCSEGPGGGVIQGSASESSLVCLLAAKEQTTRRLKHLHPDWDEASIKSK 182

Query: 632 LVAYTSDQSNSSVEKSAIIGDVPVRQLRSDDNGVLRGDALLTAVKEDLAKGLIPCCLIAT 691
           LVAYTSDQSNSSVEK+ I+  V ++ L +DD  V RG+ LL A+KEDL KGLIPCC+IAT
Sbjct: 183 LVAYTSDQSNSSVEKAGILASVTMKLLPADDKCVFRGETLLKAIKEDLVKGLIPCCVIAT 242

Query: 692 LGTTGTCAFDNLEELGPICQEYNIWLHVDAAYAGSALLLPEYAHLKRGLEYVDSFDFNTH 751
           LGTTGTCAFDNLEELGPIC EYN+WLHVDAAYAG+A + PEY +L  G+EY DSF+ N H
Sbjct: 243 LGTTGTCAFDNLEELGPICNEYNVWLHVDAAYAGAAFVCPEYRYLMSGVEYADSFNINPH 302

Query: 752 KWLLVNFDCSAMW 764
           KWLLVNFDCSA+W
Sbjct: 303 KWLLVNFDCSALW 315

Source: Megachile rotundata

Species: Megachile rotundata

Genus: Megachile

Family: Megachilidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|189237523|ref|XP_973109.2| PREDICTED: similar to AGAP009091-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|270006966|gb|EFA03414.1| hypothetical protein TcasGA2_TC013401 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|357611531|gb|EHJ67528.1| hypothetical protein KGM_15075 [Danaus plexippus] Back     alignment and taxonomy information
>gi|193603599|ref|XP_001950143.1| PREDICTED: aromatic-L-amino-acid decarboxylase-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|389609325|dbj|BAM18274.1| dopa decarboxylase 2 [Papilio xuthus] Back     alignment and taxonomy information
>gi|345493638|ref|XP_003427114.1| PREDICTED: aromatic-L-amino-acid decarboxylase-like isoform 2 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|350418517|ref|XP_003491883.1| PREDICTED: alpha-methyldopa hypersensitive protein-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340722534|ref|XP_003399659.1| PREDICTED: alpha-methyldopa hypersensitive protein-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|157127150|ref|XP_001661057.1| aromatic amino acid decarboxylase [Aedes aegypti] gi|108873022|gb|EAT37247.1| AAEL010734-PA [Aedes aegypti] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query764
FB|FBgn0000075 510 amd "alpha methyl dopa-resista 0.408 0.611 0.580 3.2e-104
FB|FBgn0000422 510 Ddc "Dopa decarboxylase" [Dros 0.405 0.607 0.578 1.4e-101
RGD|2494 480 Ddc "dopa decarboxylase (aroma 0.409 0.652 0.575 1.2e-99
MGI|MGI:94876 480 Ddc "dopa decarboxylase" [Mus 0.409 0.652 0.568 6.4e-99
ZFIN|ZDB-GENE-040426-2656 480 ddc "dopa decarboxylase" [Dani 0.407 0.647 0.562 1.3e-98
UNIPROTKB|F6R993380 DDC "Aromatic-L-amino-acid dec 0.407 0.818 0.572 7.4e-98
UNIPROTKB|P20711 480 DDC "Aromatic-L-amino-acid dec 0.407 0.647 0.569 9.4e-98
UNIPROTKB|E7ER62338 DDC "Aromatic-L-amino-acid dec 0.407 0.920 0.569 9.4e-98
UNIPROTKB|P27718 487 DDC "Aromatic-L-amino-acid dec 0.407 0.638 0.572 1.2e-97
UNIPROTKB|P80041 486 DDC "Aromatic-L-amino-acid dec 0.407 0.639 0.559 4.1e-97
FB|FBgn0000075 amd "alpha methyl dopa-resistant" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 1032 (368.3 bits), Expect = 3.2e-104, P = 3.2e-104
 Identities = 181/312 (58%), Positives = 248/312 (79%)

Query:   453 EEFREFGKAAIDFIADYVDNIRERPVLPSVEPGYLASLVPGEMPEEGEDWRHIMRDMNTV 512
             +EFREFGKAAID+IADY++NIR+  VLP+VEPGYL  L+P EMPEE E W+ ++ D++ V
Sbjct:     4 KEFREFGKAAIDYIADYLENIRDDDVLPNVEPGYLLDLLPTEMPEEPEAWKDVLGDISRV 63

Query:   513 IMPGITHWQSPQFNAYFPTGSSYPSIVGDMLSGAFGLIGFSWLSSPACTELEVLVMNWLG 572
             I PG+THWQSP  +AY+PT +SYPSIVG+ML+  FG+IGFSW+ SPACTELEV+VM+WL 
Sbjct:    64 IKPGLTHWQSPHMHAYYPTSTSYPSIVGEMLASGFGVIGFSWICSPACTELEVVVMDWLA 123

Query:   573 KALGLPEEFLNCSPGPGGGIIQSTASEATLVSILVAKRKMINHWQSKNPSLTENDIRNKL 632
             K L LP  F + S GPGGG+IQ +ASEA LV++L A+ + + +++  +P L+E+++R +L
Sbjct:   124 KFLKLPAHFQHASDGPGGGVIQGSASEAVLVAVLAAREQAVANYRESHPELSESEVRGRL 183

Query:   633 VAYTSDQSNSSVEKSAIIGDVPVRQLRSDDNGVLRGDALLTAVKEDLAKGLIPCCLIATL 692
             VAY+SDQSNS +EK+ ++  +P+R L + ++ VLRGD L  A++ED+A G IP   +ATL
Sbjct:   184 VAYSSDQSNSCIEKAGVLAAMPIRLLPAGEDFVLRGDTLRGAIEEDVAAGRIPVICVATL 243

Query:   693 GTTGTCAFDNLEELGPICQEYNIWLHVDAAYAGSALLLPEYAHLKRGLEYVDSFDFNTHK 752
             GTTGTCA+D++E L  +C+E+ +WLHVDAAYAG A  L E + L++GL+ VDS +FN HK
Sbjct:   244 GTTGTCAYDDIESLSAVCEEFKVWLHVDAAYAGGAFALEECSDLRKGLDRVDSLNFNLHK 303

Query:   753 WLLVNFDCSAMW 764
             ++LVNFDCSAMW
Sbjct:   304 FMLVNFDCSAMW 315
GO:0040003 "chitin-based cuticle development" evidence=NAS;IMP
GO:0006584 "catecholamine metabolic process" evidence=NAS;IMP
GO:0042417 "dopamine metabolic process" evidence=NAS
GO:0004058 "aromatic-L-amino-acid decarboxylase activity" evidence=ISS
GO:0005575 "cellular_component" evidence=ND
GO:0030170 "pyridoxal phosphate binding" evidence=IEA
GO:0006520 "cellular amino acid metabolic process" evidence=IEA
GO:0019239 "deaminase activity" evidence=IDA
GO:0016831 "carboxy-lyase activity" evidence=IDA
FB|FBgn0000422 Ddc "Dopa decarboxylase" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
RGD|2494 Ddc "dopa decarboxylase (aromatic L-amino acid decarboxylase)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:94876 Ddc "dopa decarboxylase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-2656 ddc "dopa decarboxylase" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F6R993 DDC "Aromatic-L-amino-acid decarboxylase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P20711 DDC "Aromatic-L-amino-acid decarboxylase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E7ER62 DDC "Aromatic-L-amino-acid decarboxylase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P27718 DDC "Aromatic-L-amino-acid decarboxylase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P80041 DDC "Aromatic-L-amino-acid decarboxylase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O88533DDC_MOUSE4, ., 1, ., 1, ., 2, 80.56860.38870.6187yesN/A
P80041DDC_PIG4, ., 1, ., 1, ., 2, 80.55940.38610.6069yesN/A
P22781DDC_CAVPO4, ., 1, ., 1, ., 2, 80.55620.38610.6145yesN/A
P27718DDC_BOVIN4, ., 1, ., 1, ., 2, 80.57230.38610.6057yesN/A
P14173DDC_RAT4, ., 1, ., 1, ., 2, 80.57500.38870.6187yesN/A
P18486L2AM_DROME4, ., 1, ., 1, ., -0.58010.38080.5705yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer4.1.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query764
pfam00282373 pfam00282, Pyridoxal_deC, Pyridoxal-dependent deca 1e-124
PLN02880 490 PLN02880, PLN02880, tyrosine decarboxylase 1e-102
PLN02590 539 PLN02590, PLN02590, probable tyrosine decarboxylas 5e-85
cd06450 345 cd06450, DOPA_deC_like, DOPA decarboxylase family 1e-82
COG0076 460 COG0076, GadB, Glutamate decarboxylase and related 2e-50
PLN02880490 PLN02880, PLN02880, tyrosine decarboxylase 2e-30
pfam00282373 pfam00282, Pyridoxal_deC, Pyridoxal-dependent deca 2e-25
cd06450345 cd06450, DOPA_deC_like, DOPA decarboxylase family 2e-24
PLN02590539 PLN02590, PLN02590, probable tyrosine decarboxylas 5e-21
TIGR03799 522 TIGR03799, NOD_PanD_pyr, putative pyridoxal-depend 4e-14
cd01494170 cd01494, AAT_I, Aspartate aminotransferase (AAT) s 4e-12
COG0076460 COG0076, GadB, Glutamate decarboxylase and related 2e-11
TIGR03812 373 TIGR03812, tyr_de_CO2_Arch, tyrosine decarboxylase 3e-11
PRK13520 371 PRK13520, PRK13520, L-tyrosine decarboxylase; Prov 7e-09
PRK02769 380 PRK02769, PRK02769, histidine decarboxylase; Provi 2e-08
pfam01212288 pfam01212, Beta_elim_lyase, Beta-eliminating lyase 3e-04
TIGR03531 444 TIGR03531, selenium_SpcS, O-phosphoseryl-tRNA(Sec) 3e-04
COG1104 386 COG1104, NifS, Cysteine sulfinate desulfinase/cyst 0.001
COG0520 405 COG0520, csdA, Selenocysteine lyase/Cysteine desul 0.003
>gnl|CDD|215836 pfam00282, Pyridoxal_deC, Pyridoxal-dependent decarboxylase conserved domain Back     alignment and domain information 
 Score =  375 bits (964), Expect = e-124
 Identities = 149/281 (53%), Positives = 195/281 (69%), Gaps = 7/281 (2%)

Query: 484 PGYLASLVPGEMPEEGEDWRHIMRDMNTVIMPGITHWQSPQFNAYFPTGSSYPSIVGDML 543
           PGYL  L+P   P   E    I+ D+   IMPG+T W SP F+AYFP G+SYPS++GDML
Sbjct: 1   PGYLRPLLPEAAPIIPEPLLDILGDIRKNIMPGVTTWHSPNFHAYFPAGNSYPSLLGDML 60

Query: 544 SGAFGLIGFSWLSSPACTELEVLVMNWLGKALGLPEEFLNCSPGPGGGIIQSTASEATLV 603
           S A    GF+W SSPACTELE +VM+WL K LGLP+EFL    G GGG++Q  +SE+ L+
Sbjct: 61  SDAINCNGFTWESSPACTELENVVMDWLAKMLGLPKEFLGS--GEGGGVLQGGSSESNLL 118

Query: 604 SILVAKRKMINHWQSKNPSLTENDIRNKLVAYTSDQSNSSVEKSAIIGDVPVRQLRSDDN 663
           ++L A+ K I   ++            KLVAYTSDQ++SS+EK+A+I  V +R++ +D+N
Sbjct: 119 ALLAARTKWIRRMKAAGKPSLG-----KLVAYTSDQAHSSIEKAALIAGVELREIPTDEN 173

Query: 664 GVLRGDALLTAVKEDLAKGLIPCCLIATLGTTGTCAFDNLEELGPICQEYNIWLHVDAAY 723
           G +RG  L  A++ED   GLIP  + ATLGTTG+ AFD L+ELG IC +Y++WLHVDAAY
Sbjct: 174 GKMRGMDLEKAIEEDKENGLIPFFVCATLGTTGSGAFDPLQELGDICNKYDLWLHVDAAY 233

Query: 724 AGSALLLPEYAHLKRGLEYVDSFDFNTHKWLLVNFDCSAMW 764
           AGSA + PE+ H   G+E  DSF FN HKW+LV  DCSA+W
Sbjct: 234 AGSAFICPEFRHWLFGIERADSFSFNPHKWMLVLLDCSALW 274

Length = 373
>gnl|CDD|215475 PLN02880, PLN02880, tyrosine decarboxylase Back     alignment and domain information
>gnl|CDD|178200 PLN02590, PLN02590, probable tyrosine decarboxylase Back     alignment and domain information
>gnl|CDD|99743 cd06450, DOPA_deC_like, DOPA decarboxylase family Back     alignment and domain information
>gnl|CDD|223154 COG0076, GadB, Glutamate decarboxylase and related PLP-dependent proteins [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|215475 PLN02880, PLN02880, tyrosine decarboxylase Back     alignment and domain information
>gnl|CDD|215836 pfam00282, Pyridoxal_deC, Pyridoxal-dependent decarboxylase conserved domain Back     alignment and domain information
>gnl|CDD|99743 cd06450, DOPA_deC_like, DOPA decarboxylase family Back     alignment and domain information
>gnl|CDD|178200 PLN02590, PLN02590, probable tyrosine decarboxylase Back     alignment and domain information
>gnl|CDD|163511 TIGR03799, NOD_PanD_pyr, putative pyridoxal-dependent aspartate 1-decarboxylase Back     alignment and domain information
>gnl|CDD|99742 cd01494, AAT_I, Aspartate aminotransferase (AAT) superfamily (fold type I) of pyridoxal phosphate (PLP)-dependent enzymes Back     alignment and domain information
>gnl|CDD|223154 COG0076, GadB, Glutamate decarboxylase and related PLP-dependent proteins [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|234361 TIGR03812, tyr_de_CO2_Arch, tyrosine decarboxylase MnfA Back     alignment and domain information
>gnl|CDD|237409 PRK13520, PRK13520, L-tyrosine decarboxylase; Provisional Back     alignment and domain information
>gnl|CDD|235068 PRK02769, PRK02769, histidine decarboxylase; Provisional Back     alignment and domain information
>gnl|CDD|216367 pfam01212, Beta_elim_lyase, Beta-eliminating lyase Back     alignment and domain information
>gnl|CDD|211833 TIGR03531, selenium_SpcS, O-phosphoseryl-tRNA(Sec) selenium transferase Back     alignment and domain information
>gnl|CDD|224029 COG1104, NifS, Cysteine sulfinate desulfinase/cysteine desulfurase and related enzymes [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|223594 COG0520, csdA, Selenocysteine lyase/Cysteine desulfurase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 764
PLN02590 539 probable tyrosine decarboxylase 100.0
KOG0628|consensus 511 100.0
PLN02880 490 tyrosine decarboxylase 100.0
KOG0629|consensus 510 100.0
PF00282373 Pyridoxal_deC: Pyridoxal-dependent decarboxylase c 100.0
TIGR03799 522 NOD_PanD_pyr putative pyridoxal-dependent aspartat 100.0
TIGR03811 608 tyr_de_CO2_Ent tyrosine decarboxylase, Enterococcu 100.0
PLN02590539 probable tyrosine decarboxylase 100.0
COG0076 460 GadB Glutamate decarboxylase and related PLP-depen 100.0
PLN02263 470 serine decarboxylase 100.0
PLN02880490 tyrosine decarboxylase 100.0
KOG0629|consensus510 100.0
TIGR01788 431 Glu-decarb-GAD glutamate decarboxylase. This model 100.0
TIGR03799522 NOD_PanD_pyr putative pyridoxal-dependent aspartat 100.0
KOG0628|consensus511 100.0
PLN03032 374 serine decarboxylase; Provisional 100.0
PRK02769 380 histidine decarboxylase; Provisional 100.0
PF00282373 Pyridoxal_deC: Pyridoxal-dependent decarboxylase c 100.0
KOG1383|consensus491 100.0
TIGR03811608 tyr_de_CO2_Ent tyrosine decarboxylase, Enterococcu 100.0
PLN02263470 serine decarboxylase 100.0
cd06450 345 DOPA_deC_like DOPA decarboxylase family. This fami 100.0
COG0076460 GadB Glutamate decarboxylase and related PLP-depen 99.98
TIGR01788431 Glu-decarb-GAD glutamate decarboxylase. This model 99.97
PLN03032374 serine decarboxylase; Provisional 99.97
PRK02769380 histidine decarboxylase; Provisional 99.95
COG1104 386 NifS Cysteine sulfinate desulfinase/cysteine desul 99.93
PRK05367 954 glycine dehydrogenase; Provisional 99.92
PRK13520 371 L-tyrosine decarboxylase; Provisional 99.91
KOG1383|consensus 491 99.91
TIGR03812 373 tyr_de_CO2_Arch tyrosine decarboxylase MnfA. Membe 99.9
TIGR03531 444 selenium_SpcS O-phosphoseryl-tRNA(Sec) selenium tr 99.87
cd06450345 DOPA_deC_like DOPA decarboxylase family. This fami 99.85
COG0520 405 csdA Selenocysteine lyase/Cysteine desulfurase [Po 99.84
TIGR00461 939 gcvP glycine dehydrogenase (decarboxylating). This 99.84
PLN02651 364 cysteine desulfurase 99.83
KOG1549|consensus 428 99.82
PRK04366 481 glycine dehydrogenase subunit 2; Validated 99.79
TIGR02006 402 IscS cysteine desulfurase IscS. This model represe 99.79
TIGR03402 379 FeS_nifS cysteine desulfurase NifS. Members of thi 99.78
TIGR03235 353 DNA_S_dndA cysteine desulfurase DndA. This model d 99.77
PRK14012 404 cysteine desulfurase; Provisional 99.75
cd06453 373 SufS_like Cysteine desulfurase (SufS)-like. This f 99.74
PRK02948 381 cysteine desulfurase; Provisional 99.74
PRK00451 447 glycine dehydrogenase subunit 1; Validated 99.74
TIGR01979 403 sufS cysteine desulfurases, SufS subfamily. This m 99.72
PF00266 371 Aminotran_5: Aminotransferase class-V; InterPro: I 99.71
TIGR01977 376 am_tr_V_EF2568 cysteine desulfurase family protein 99.71
TIGR03403 382 nifS_epsilon cysteine desulfurase, NifS family, ep 99.7
PRK09331 387 Sep-tRNA:Cys-tRNA synthetase; Provisional 99.7
PRK09295 406 bifunctional cysteine desulfurase/selenocysteine l 99.68
TIGR03392 398 FeS_syn_CsdA cysteine desulfurase, catalytic subun 99.67
cd06451 356 AGAT_like Alanine-glyoxylate aminotransferase (AGA 99.67
PRK13520371 L-tyrosine decarboxylase; Provisional 99.66
PRK10874 401 cysteine sulfinate desulfinase; Provisional 99.66
cd00613 398 GDC-P Glycine cleavage system P-protein, alpha- an 99.63
TIGR00461939 gcvP glycine dehydrogenase (decarboxylating). This 99.62
cd06452 361 SepCysS Sep-tRNA:Cys-tRNA synthase. This family be 99.62
PLN02855 424 Bifunctional selenocysteine lyase/cysteine desulfu 99.61
PLN02414 993 glycine dehydrogenase (decarboxylating) 99.61
cd00615294 Orn_deC_like Ornithine decarboxylase family. This 99.61
PRK12566 954 glycine dehydrogenase; Provisional 99.6
TIGR03812373 tyr_de_CO2_Arch tyrosine decarboxylase MnfA. Membe 99.58
cd01494170 AAT_I Aspartate aminotransferase (AAT) superfamily 99.57
TIGR01814 406 kynureninase kynureninase. This model describes ky 99.56
TIGR02326 363 transamin_PhnW 2-aminoethylphosphonate--pyruvate t 99.56
PLN02409 401 serine--glyoxylate aminotransaminase 99.56
PLN02724 805 Molybdenum cofactor sulfurase 99.55
TIGR01976 397 am_tr_V_VC1184 cysteine desulfurase family protein 99.55
PTZ00094 452 serine hydroxymethyltransferase; Provisional 99.53
PRK05367954 glycine dehydrogenase; Provisional 99.52
PF01212290 Beta_elim_lyase: Beta-eliminating lyase; InterPro: 99.52
TIGR03301 355 PhnW-AepZ 2-aminoethylphosphonate aminotransferase 99.51
TIGR02539 370 SepCysS Sep-tRNA:Cys-tRNA synthase. Aminoacylation 99.49
COG2008 342 GLY1 Threonine aldolase [Amino acid transport and 99.46
PLN02721 353 threonine aldolase 99.45
cd00609 350 AAT_like Aspartate aminotransferase family. This f 99.43
cd06502 338 TA_like Low-specificity threonine aldolase (TA). T 99.43
PRK13479 368 2-aminoethylphosphonate--pyruvate transaminase; Pr 99.42
PRK04366481 glycine dehydrogenase subunit 2; Validated 99.41
KOG1368|consensus 384 99.38
PF01276 417 OKR_DC_1: Orn/Lys/Arg decarboxylase, major domain; 99.37
TIGR01437 363 selA_rel uncharacterized pyridoxal phosphate-depen 99.34
PRK07179 407 hypothetical protein; Provisional 99.33
PRK03080 378 phosphoserine aminotransferase; Provisional 99.31
cd06454 349 KBL_like KBL_like; this family belongs to the pyri 99.3
PRK15029 755 arginine decarboxylase; Provisional 99.3
cd00616 352 AHBA_syn 3-amino-5-hydroxybenzoic acid synthase fa 99.3
PRK05937 370 8-amino-7-oxononanoate synthase; Provisional 99.28
cd00378 402 SHMT Serine-glycine hydroxymethyltransferase (SHMT 99.28
TIGR03531444 selenium_SpcS O-phosphoseryl-tRNA(Sec) selenium tr 99.28
TIGR01822 393 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A lig 99.27
PRK08361 391 aspartate aminotransferase; Provisional 99.26
KOG0630|consensus838 99.26
cd06453373 SufS_like Cysteine desulfurase (SufS)-like. This f 99.24
PRK00011 416 glyA serine hydroxymethyltransferase; Reviewed 99.23
PLN03226 475 serine hydroxymethyltransferase; Provisional 99.23
COG1103 382 Archaea-specific pyridoxal phosphate-dependent enz 99.23
COG1003 496 GcvP Glycine cleavage system protein P (pyridoxal- 99.21
TIGR01979403 sufS cysteine desulfurases, SufS subfamily. This m 99.19
PRK08134 433 O-acetylhomoserine aminocarboxypropyltransferase; 99.19
PRK13238 460 tnaA tryptophanase/L-cysteine desulfhydrase, PLP-d 99.18
cd00611 355 PSAT_like Phosphoserine aminotransferase (PSAT) fa 99.18
PRK11658 379 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate amin 99.16
PRK10874401 cysteine sulfinate desulfinase; Provisional 99.15
PRK06939 397 2-amino-3-ketobutyrate coenzyme A ligase; Provisio 99.15
TIGR03588 380 PseC UDP-4-keto-6-deoxy-N-acetylglucosamine 4-amin 99.15
PRK13034 416 serine hydroxymethyltransferase; Reviewed 99.14
PRK15399 713 lysine decarboxylase LdcC; Provisional 99.14
KOG0630|consensus 838 99.13
PRK04311 464 selenocysteine synthase; Provisional 99.13
TIGR00474 454 selA seryl-tRNA(sec) selenium transferase. In bact 99.13
TIGR01977376 am_tr_V_EF2568 cysteine desulfurase family protein 99.13
PRK06108 382 aspartate aminotransferase; Provisional 99.13
PRK13580 493 serine hydroxymethyltransferase; Provisional 99.12
PRK05764 393 aspartate aminotransferase; Provisional 99.11
PRK15400 714 lysine decarboxylase CadA; Provisional 99.11
TIGR01329 378 cysta_beta_ly_E cystathionine beta-lyase, eukaryot 99.08
PLN02414993 glycine dehydrogenase (decarboxylating) 99.07
PRK05613 437 O-acetylhomoserine aminocarboxypropyltransferase; 99.07
PRK09082 386 methionine aminotransferase; Validated 99.07
PRK05958 385 8-amino-7-oxononanoate synthase; Reviewed 99.06
TIGR02618 450 tyr_phenol_ly tyrosine phenol-lyase. This model de 99.06
PRK13578 720 ornithine decarboxylase; Provisional 99.05
TIGR03392398 FeS_syn_CsdA cysteine desulfurase, catalytic subun 99.05
PLN02271 586 serine hydroxymethyltransferase 99.05
PRK06225 380 aspartate aminotransferase; Provisional 99.05
cd00614 369 CGS_like CGS_like: Cystathionine gamma-synthase is 99.04
PRK08133 390 O-succinylhomoserine sulfhydrylase; Validated 99.04
PRK11706 375 TDP-4-oxo-6-deoxy-D-glucose transaminase; Provisio 99.03
PRK07777 387 aminotransferase; Validated 99.03
TIGR02379 376 ECA_wecE TDP-4-keto-6-deoxy-D-glucose transaminase 99.01
cd00613398 GDC-P Glycine cleavage system P-protein, alpha- an 99.01
PRK00451447 glycine dehydrogenase subunit 1; Validated 99.0
cd06451356 AGAT_like Alanine-glyoxylate aminotransferase (AGA 99.0
PRK13237 460 tyrosine phenol-lyase; Provisional 98.97
cd00617 431 Tnase_like Tryptophanase family (Tnase). This fami 98.97
PRK10534 333 L-threonine aldolase; Provisional 98.97
PRK12414 384 putative aminotransferase; Provisional 98.96
TIGR02006402 IscS cysteine desulfurase IscS. This model represe 98.96
TIGR03402379 FeS_nifS cysteine desulfurase NifS. Members of thi 98.96
TIGR01825 385 gly_Cac_T_rel pyridoxal phosphate-dependent acyltr 98.95
PRK09295406 bifunctional cysteine desulfurase/selenocysteine l 98.95
PLN02483 489 serine palmitoyltransferase 98.94
TIGR00858 360 bioF 8-amino-7-oxononanoate synthase. This model r 98.94
PRK05994 427 O-acetylhomoserine aminocarboxypropyltransferase; 98.94
PRK08912 387 hypothetical protein; Provisional 98.94
PRK15407 438 lipopolysaccharide biosynthesis protein RfbH; Prov 98.94
TIGR01328 391 met_gam_lyase methionine gamma-lyase. This model d 98.93
TIGR01141 346 hisC histidinol-phosphate aminotransferase. Histid 98.93
TIGR01326 418 OAH_OAS_sulfhy OAH/OAS sulfhydrylase. This model d 98.93
PRK05968 389 hypothetical protein; Provisional 98.93
PRK05957 389 aspartate aminotransferase; Provisional 98.93
PRK07812 436 O-acetylhomoserine aminocarboxypropyltransferase; 98.93
TIGR03403382 nifS_epsilon cysteine desulfurase, NifS family, ep 98.93
COG1104386 NifS Cysteine sulfinate desulfinase/cysteine desul 98.93
cd06452361 SepCysS Sep-tRNA:Cys-tRNA synthase. This family be 98.93
TIGR01325 380 O_suc_HS_sulf O-succinylhomoserine sulfhydrylase. 98.92
PRK07337 388 aminotransferase; Validated 98.92
PRK08960 387 hypothetical protein; Provisional 98.92
PTZ00433 412 tyrosine aminotransferase; Provisional 98.92
PLN02656 409 tyrosine transaminase 98.91
TIGR01821 402 5aminolev_synth 5-aminolevulinic acid synthase. Th 98.91
PRK06767 386 methionine gamma-lyase; Provisional 98.9
PRK09331387 Sep-tRNA:Cys-tRNA synthetase; Provisional 98.9
PRK08248 431 O-acetylhomoserine aminocarboxypropyltransferase; 98.9
PF01041 363 DegT_DnrJ_EryC1: DegT/DnrJ/EryC1/StrS aminotransfe 98.9
PRK05939 397 hypothetical protein; Provisional 98.9
PRK08574 385 cystathionine gamma-synthase; Provisional 98.89
PRK07503 403 methionine gamma-lyase; Provisional 98.89
PRK08064 390 cystathionine beta-lyase; Provisional 98.89
PRK07504 398 O-succinylhomoserine sulfhydrylase; Reviewed 98.89
PLN02855424 Bifunctional selenocysteine lyase/cysteine desulfu 98.89
PRK07050 394 cystathionine beta-lyase; Provisional 98.89
cd00610 413 OAT_like Acetyl ornithine aminotransferase family. 98.88
PRK13392 410 5-aminolevulinate synthase; Provisional 98.88
PLN02509 464 cystathionine beta-lyase 98.87
PRK09064 407 5-aminolevulinate synthase; Validated 98.87
PRK00950 361 histidinol-phosphate aminotransferase; Validated 98.87
PRK07309 391 aromatic amino acid aminotransferase; Validated 98.87
COG0399 374 WecE Predicted pyridoxal phosphate-dependent enzym 98.87
PLN00175 413 aminotransferase family protein; Provisional 98.87
TIGR02617 467 tnaA_trp_ase tryptophanase, leader peptide-associa 98.86
COG0520405 csdA Selenocysteine lyase/Cysteine desulfurase [Po 98.86
TIGR01366 361 serC_3 phosphoserine aminotransferase, putative. T 98.86
TIGR01265 403 tyr_nico_aTase tyrosine/nicotianamine aminotransfe 98.86
PRK06836 394 aspartate aminotransferase; Provisional 98.85
PRK08249 398 cystathionine gamma-synthase; Provisional 98.85
PRK08363 398 alanine aminotransferase; Validated 98.85
PRK05355 360 3-phosphoserine/phosphohydroxythreonine aminotrans 98.85
TIGR01324 377 cysta_beta_ly_B cystathionine beta-lyase, bacteria 98.85
TIGR03537 350 DapC succinyldiaminopimelate transaminase. Note: t 98.85
PRK07811 388 cystathionine gamma-synthase; Provisional 98.85
PRK08861 388 cystathionine gamma-synthase; Provisional 98.84
PLN02242 418 methionine gamma-lyase 98.84
PRK07324 373 transaminase; Validated 98.84
PRK09028 394 cystathionine beta-lyase; Provisional 98.83
PRK08114 395 cystathionine beta-lyase; Provisional 98.83
PRK07682 378 hypothetical protein; Validated 98.83
PRK07550 386 hypothetical protein; Provisional 98.82
PRK07810 403 O-succinylhomoserine sulfhydrylase; Provisional 98.82
PRK06207 405 aspartate aminotransferase; Provisional 98.82
PRK05942 394 aspartate aminotransferase; Provisional 98.8
PRK08776 405 cystathionine gamma-synthase; Provisional 98.8
PRK06234 400 methionine gamma-lyase; Provisional 98.8
TIGR01976397 am_tr_V_VC1184 cysteine desulfurase family protein 98.79
PLN00145 430 tyrosine/nicotianamine aminotransferase; Provision 98.78
PF00155 363 Aminotran_1_2: Aminotransferase class I and II 1-a 98.78
PRK07671 377 cystathionine beta-lyase; Provisional 98.78
COG0075 383 Serine-pyruvate aminotransferase/archaeal aspartat 98.77
PRK07683 387 aminotransferase A; Validated 98.76
PRK06084 425 O-acetylhomoserine aminocarboxypropyltransferase; 98.76
PRK13393 406 5-aminolevulinate synthase; Provisional 98.75
TIGR03540 383 DapC_direct LL-diaminopimelate aminotransferase. T 98.75
TIGR01364 349 serC_1 phosphoserine aminotransferase. This model 98.75
PRK07681 399 aspartate aminotransferase; Provisional 98.74
PRK06176 380 cystathionine gamma-synthase/cystathionine beta-ly 98.74
PLN02651364 cysteine desulfurase 98.73
COG0436 393 Aspartate/tyrosine/aromatic aminotransferase [Amin 98.73
PLN02376 496 1-aminocyclopropane-1-carboxylate synthase 98.71
TIGR01814406 kynureninase kynureninase. This model describes ky 98.71
PRK08045 386 cystathionine gamma-synthase; Provisional 98.71
PRK14012404 cysteine desulfurase; Provisional 98.71
PLN02721353 threonine aldolase 98.71
TIGR02326363 transamin_PhnW 2-aminoethylphosphonate--pyruvate t 98.7
PLN02187 462 rooty/superroot1 98.7
PRK02948381 cysteine desulfurase; Provisional 98.7
PTZ00377 481 alanine aminotransferase; Provisional 98.69
PLN02822 481 serine palmitoyltransferase 98.69
PRK03244 398 argD acetylornithine aminotransferase; Provisional 98.69
TIGR01140 330 L_thr_O3P_dcar L-threonine-O-3-phosphate decarboxy 98.68
TIGR03301355 PhnW-AepZ 2-aminoethylphosphonate aminotransferase 98.67
PRK14807 351 histidinol-phosphate aminotransferase; Provisional 98.67
PRK08247 366 cystathionine gamma-synthase; Reviewed 98.67
PRK06348 384 aspartate aminotransferase; Provisional 98.65
PRK06107 402 aspartate aminotransferase; Provisional 98.64
PRK08636 403 aspartate aminotransferase; Provisional 98.64
PRK07568 397 aspartate aminotransferase; Provisional 98.63
PRK06702 432 O-acetylhomoserine aminocarboxypropyltransferase; 98.63
TIGR02080 382 O_succ_thio_ly O-succinylhomoserine (thiol)-lyase. 98.63
PF00266371 Aminotran_5: Aminotransferase class-V; InterPro: I 98.63
TIGR02539370 SepCysS Sep-tRNA:Cys-tRNA synthase. Aminoacylation 98.62
PLN03227 392 serine palmitoyltransferase-like protein; Provisio 98.62
PLN02368 407 alanine transaminase 98.62
PRK05387 353 histidinol-phosphate aminotransferase; Provisional 98.62
PRK09265 404 aminotransferase AlaT; Validated 98.62
PRK08068 389 transaminase; Reviewed 98.62
TIGR03576 346 pyridox_MJ0158 pyridoxal phosphate enzyme, MJ0158 98.61
PLN02231 534 alanine transaminase 98.6
PRK13355 517 bifunctional HTH-domain containing protein/aminotr 98.6
PRK09276 385 LL-diaminopimelate aminotransferase; Provisional 98.6
PRK13479368 2-aminoethylphosphonate--pyruvate transaminase; Pr 98.57
TIGR01264 401 tyr_amTase_E tyrosine aminotransferase, eukaryotic 98.57
PRK08175 395 aminotransferase; Validated 98.56
PF05889 389 SLA_LP_auto_ag: Soluble liver antigen/liver pancre 98.55
PRK06460 376 hypothetical protein; Provisional 98.55
COG2008342 GLY1 Threonine aldolase [Amino acid transport and 98.55
PRK07505 402 hypothetical protein; Provisional 98.55
COG0156 388 BioF 7-keto-8-aminopelargonate synthetase and rela 98.55
cd06502338 TA_like Low-specificity threonine aldolase (TA). T 98.55
PRK08056 356 threonine-phosphate decarboxylase; Provisional 98.55
PRK04870 356 histidinol-phosphate aminotransferase; Provisional 98.54
PRK02731 367 histidinol-phosphate aminotransferase; Validated 98.53
PRK09105 370 putative aminotransferase; Provisional 98.52
PRK12566954 glycine dehydrogenase; Provisional 98.52
PRK01688 351 histidinol-phosphate aminotransferase; Provisional 98.51
PRK09148 405 aminotransferase; Validated 98.51
PRK09147 396 succinyldiaminopimelate transaminase; Provisional 98.51
PRK03321 352 putative aminotransferase; Provisional 98.51
PRK07582 366 cystathionine gamma-lyase; Validated 98.5
PLN00143 409 tyrosine/nicotianamine aminotransferase; Provision 98.5
cd00609350 AAT_like Aspartate aminotransferase family. This f 98.49
PRK05166 371 histidinol-phosphate aminotransferase; Provisional 98.48
PRK00854 401 rocD ornithine--oxo-acid transaminase; Reviewed 98.48
PRK03158 359 histidinol-phosphate aminotransferase; Provisional 98.48
PLN02450 468 1-aminocyclopropane-1-carboxylate synthase 98.47
PRK07366 388 succinyldiaminopimelate transaminase; Validated 98.47
COG0112 413 GlyA Glycine/serine hydroxymethyltransferase [Amin 98.47
PF00464 399 SHMT: Serine hydroxymethyltransferase; InterPro: I 98.47
PRK06290 410 aspartate aminotransferase; Provisional 98.47
PRK05967 395 cystathionine beta-lyase; Provisional 98.46
PTZ00125 400 ornithine aminotransferase-like protein; Provision 98.46
PRK03317 368 histidinol-phosphate aminotransferase; Provisional 98.46
TIGR00707 379 argD acetylornithine and succinylornithine aminotr 98.46
PRK07269 364 cystathionine gamma-synthase; Reviewed 98.46
PRK04073 396 rocD ornithine--oxo-acid transaminase; Provisional 98.44
PF02347 429 GDC-P: Glycine cleavage system P-protein; InterPro 98.44
TIGR01885 401 Orn_aminotrans ornithine aminotransferase. This mo 98.44
TIGR03538 393 DapC_gpp succinyldiaminopimelate transaminase. Thi 98.39
PRK04635 354 histidinol-phosphate aminotransferase; Provisional 98.39
PRK07908 349 hypothetical protein; Provisional 98.38
PRK03967 337 histidinol-phosphate aminotransferase; Provisional 98.36
PLN02607 447 1-aminocyclopropane-1-carboxylate synthase 98.36
PRK03715 395 argD acetylornithine transaminase protein; Provisi 98.36
PLN02624 474 ornithine-delta-aminotransferase 98.35
PRK15481 431 transcriptional regulatory protein PtsJ; Provision 98.35
PRK01278 389 argD acetylornithine transaminase protein; Provisi 98.34
PRK06434 384 cystathionine gamma-lyase; Validated 98.33
TIGR03246 397 arg_catab_astC succinylornithine transaminase fami 98.33
PLN03026 380 histidinol-phosphate aminotransferase; Provisional 98.33
PRK06855 433 aminotransferase; Validated 98.33
PRK02627 396 acetylornithine aminotransferase; Provisional 98.33
PRK02936 377 argD acetylornithine aminotransferase; Provisional 98.31
KOG2040|consensus 1001 98.29
PLN02409401 serine--glyoxylate aminotransaminase 98.25
PRK09257 396 aromatic amino acid aminotransferase; Provisional 98.24
TIGR03801 521 asp_4_decarbox aspartate 4-decarboxylase. This enz 98.22
PTZ00094452 serine hydroxymethyltransferase; Provisional 98.2
PRK01533 366 histidinol-phosphate aminotransferase; Validated 98.19
PRK03080378 phosphoserine aminotransferase; Provisional 98.18
cd00616352 AHBA_syn 3-amino-5-hydroxybenzoic acid synthase fa 98.18
PLN02955 476 8-amino-7-oxononanoate synthase 98.18
PRK05093 403 argD bifunctional N-succinyldiaminopimelate-aminot 98.17
PRK06358 354 threonine-phosphate decarboxylase; Provisional 98.17
KOG0257|consensus 420 98.17
KOG2862|consensus 385 98.14
PTZ00376 404 aspartate aminotransferase; Provisional 98.12
COG1167 459 ARO8 Transcriptional regulators containing a DNA-b 98.1
COG1982 557 LdcC Arginine/lysine/ornithine decarboxylases [Ami 98.09
PRK04260 375 acetylornithine aminotransferase; Provisional 98.08
TIGR03235353 DNA_S_dndA cysteine desulfurase DndA. This model d 98.07
PRK07590 409 L,L-diaminopimelate aminotransferase; Validated 98.06
PRK04781 364 histidinol-phosphate aminotransferase; Provisional 98.05
PRK09275 527 aspartate aminotransferase; Provisional 98.04
PRK08153 369 histidinol-phosphate aminotransferase; Provisional 98.03
PRK07865 364 N-succinyldiaminopimelate aminotransferase; Review 98.02
PRK05839 374 hypothetical protein; Provisional 98.02
cd06454349 KBL_like KBL_like; this family belongs to the pyri 98.0
PRK08637 388 hypothetical protein; Provisional 97.99
PRK12381 406 bifunctional succinylornithine transaminase/acetyl 97.98
PLN02672 1082 methionine S-methyltransferase 97.96
TIGR01365 374 serC_2 phosphoserine aminotransferase, Methanosarc 97.96
TIGR03539 357 DapC_actino succinyldiaminopimelate transaminase. 97.95
PRK02610 374 histidinol-phosphate aminotransferase; Provisional 97.94
PRK08354 311 putative aminotransferase; Provisional 97.94
PRK06425 332 histidinol-phosphate aminotransferase; Validated 97.93
COG1003496 GcvP Glycine cleavage system protein P (pyridoxal- 97.92
TIGR01822393 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A lig 97.89
PRK05964 423 adenosylmethionine--8-amino-7-oxononanoate transam 97.89
PRK14808 335 histidinol-phosphate aminotransferase; Provisional 97.88
PLN02452 365 phosphoserine transaminase 97.87
PF01053 386 Cys_Met_Meta_PP: Cys/Met metabolism PLP-dependent 97.87
PRK07049 427 methionine gamma-lyase; Validated 97.85
PRK07179407 hypothetical protein; Provisional 97.84
COG2873 426 MET17 O-acetylhomoserine sulfhydrylase [Amino acid 97.82
PRK12403 460 putative aminotransferase; Provisional 97.81
TIGR03372 442 putres_am_tran putrescine aminotransferase. Member 97.8
PRK05937370 8-amino-7-oxononanoate synthase; Provisional 97.78
PRK09264 425 diaminobutyrate--2-oxoglutarate aminotransferase; 97.77
TIGR03542 402 DAPAT_plant LL-diaminopimelate aminotransferase. T 97.77
PLN02760 504 4-aminobutyrate:pyruvate transaminase 97.76
PRK05958385 8-amino-7-oxononanoate synthase; Reviewed 97.76
PRK08117 433 4-aminobutyrate aminotransferase; Provisional 97.75
PRK13580493 serine hydroxymethyltransferase; Provisional 97.74
cd00611355 PSAT_like Phosphoserine aminotransferase (PSAT) fa 97.73
PRK14809 357 histidinol-phosphate aminotransferase; Provisional 97.72
KOG0259|consensus 447 97.72
PLN02822481 serine palmitoyltransferase 97.71
KOG0256|consensus 471 97.69
PRK06939397 2-amino-3-ketobutyrate coenzyme A ligase; Provisio 97.68
PRK07392 360 threonine-phosphate decarboxylase; Validated 97.68
TIGR00713 423 hemL glutamate-1-semialdehyde-2,1-aminomutase. Thi 97.67
PRK05769 441 4-aminobutyrate aminotransferase; Provisional 97.67
PRK05764393 aspartate aminotransferase; Provisional 97.66
COG0075383 Serine-pyruvate aminotransferase/archaeal aspartat 97.66
TIGR02407 412 ectoine_ectB diaminobutyrate--2-oxoglutarate amino 97.65
PRK00011416 glyA serine hydroxymethyltransferase; Reviewed 97.65
PRK05355360 3-phosphoserine/phosphohydroxythreonine aminotrans 97.63
PRK09440 416 avtA valine--pyruvate transaminase; Provisional 97.62
PRK11522 459 putrescine--2-oxoglutarate aminotransferase; Provi 97.6
PRK04013 364 argD acetylornithine/acetyl-lysine aminotransferas 97.6
TIGR01437363 selA_rel uncharacterized pyridoxal phosphate-depen 97.59
COG3844 407 Kynureninase [Amino acid transport and metabolism] 97.58
PRK04612 408 argD acetylornithine transaminase protein; Provisi 97.56
PLN02397 423 aspartate transaminase 97.56
TIGR01141346 hisC histidinol-phosphate aminotransferase. Histid 97.55
PRK08360 443 4-aminobutyrate aminotransferase; Provisional 97.55
COG1168 388 MalY Bifunctional PLP-dependent enzyme with beta-c 97.54
PRK12389 428 glutamate-1-semialdehyde aminotransferase; Provisi 97.51
PLN00144 382 acetylornithine transaminase 97.5
PLN03226475 serine hydroxymethyltransferase; Provisional 97.5
cd00378402 SHMT Serine-glycine hydroxymethyltransferase (SHMT 97.49
PRK00062 426 glutamate-1-semialdehyde aminotransferase; Provisi 97.49
TIGR00700 420 GABAtrnsam 4-aminobutyrate aminotransferase, proka 97.46
TIGR01821402 5aminolev_synth 5-aminolevulinic acid synthase. Th 97.46
COG1921 395 SelA Selenocysteine synthase [seryl-tRNASer seleni 97.45
PRK06062 451 hypothetical protein; Provisional 97.45
PRK05387353 histidinol-phosphate aminotransferase; Provisional 97.44
PRK01688351 histidinol-phosphate aminotransferase; Provisional 97.42
PRK10534333 L-threonine aldolase; Provisional 97.42
PRK05957389 aspartate aminotransferase; Provisional 97.41
TIGR01364349 serC_1 phosphoserine aminotransferase. This model 97.41
PRK06541 460 hypothetical protein; Provisional 97.4
PRK09792 421 4-aminobutyrate transaminase; Provisional 97.4
TIGR01366361 serC_3 phosphoserine aminotransferase, putative. T 97.39
COG0403 450 GcvP Glycine cleavage system protein P (pyridoxal- 97.39
PLN02482 474 glutamate-1-semialdehyde 2,1-aminomutase 97.36
PRK08088 425 4-aminobutyrate aminotransferase; Validated 97.36
PLN02483489 serine palmitoyltransferase 97.34
PRK07495 425 4-aminobutyrate aminotransferase; Provisional 97.34
PRK13360 442 omega amino acid--pyruvate transaminase; Provision 97.34
PRK06108382 aspartate aminotransferase; Provisional 97.34
PRK00950361 histidinol-phosphate aminotransferase; Validated 97.33
PF00155363 Aminotran_1_2: Aminotransferase class I and II 1-a 97.31
PRK09064407 5-aminolevulinate synthase; Validated 97.29
PLN00145430 tyrosine/nicotianamine aminotransferase; Provision 97.29
PRK09221 445 beta alanine--pyruvate transaminase; Provisional 97.29
KOG1368|consensus384 97.28
PRK07908349 hypothetical protein; Provisional 97.28
PRK06058 443 4-aminobutyrate aminotransferase; Provisional 97.26
PRK07678 451 aminotransferase; Validated 97.25
PRK05664 330 threonine-phosphate decarboxylase; Reviewed 97.24
COG0079 356 HisC Histidinol-phosphate/aromatic aminotransferas 97.19
PRK06225380 aspartate aminotransferase; Provisional 97.19
PRK07481 449 hypothetical protein; Provisional 97.17
KOG0053|consensus 409 97.17
TIGR01265403 tyr_nico_aTase tyrosine/nicotianamine aminotransfe 97.16
TIGR00699 464 GABAtrns_euk 4-aminobutyrate aminotransferase, euk 97.16
COG3977 417 Alanine-alpha-ketoisovalerate (or valine-pyruvate) 97.15
PRK08593 445 4-aminobutyrate aminotransferase; Provisional 97.15
PF00202339 Aminotran_3: Aminotransferase class-III; InterPro: 97.14
PRK12462 364 phosphoserine aminotransferase; Provisional 97.14
PLN03026380 histidinol-phosphate aminotransferase; Provisional 97.13
PRK04870356 histidinol-phosphate aminotransferase; Provisional 97.13
PRK13034416 serine hydroxymethyltransferase; Reviewed 97.12
PRK07036 466 hypothetical protein; Provisional 97.11
PRK06105 460 aminotransferase; Provisional 97.11
PRK05639 457 4-aminobutyrate aminotransferase; Provisional 97.11
PRK07480 456 putative aminotransferase; Validated 97.08
TIGR00858360 bioF 8-amino-7-oxononanoate synthase. This model r 97.07
PRK06777 421 4-aminobutyrate aminotransferase; Provisional 97.07
PRK14807351 histidinol-phosphate aminotransferase; Provisional 97.07
PRK00615 433 glutamate-1-semialdehyde aminotransferase; Provisi 97.06
PRK02731367 histidinol-phosphate aminotransferase; Validated 97.06
TIGR00709 442 dat 2,4-diaminobutyrate 4-transaminases. This fami 97.05
PRK06943 453 adenosylmethionine--8-amino-7-oxononanoate transam 97.04
PRK13393406 5-aminolevulinate synthase; Provisional 97.03
PLN02656409 tyrosine transaminase 97.03
PRK08361391 aspartate aminotransferase; Provisional 97.02
PRK07482 461 hypothetical protein; Provisional 97.01
PRK06149 972 hypothetical protein; Provisional 97.0
KOG0258|consensus 475 96.96
cd00614369 CGS_like CGS_like: Cystathionine gamma-synthase is 96.96
PRK05166371 histidinol-phosphate aminotransferase; Provisional 96.95
PRK07030 466 adenosylmethionine--8-amino-7-oxononanoate transam 96.94
PRK07986 428 adenosylmethionine--8-amino-7-oxononanoate transam 96.91
PRK06916 460 adenosylmethionine--8-amino-7-oxononanoate transam 96.9
TIGR01825385 gly_Cac_T_rel pyridoxal phosphate-dependent acyltr 96.9
PRK11658379 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate amin 96.9
PRK06918 451 4-aminobutyrate aminotransferase; Reviewed 96.89
PRK13355517 bifunctional HTH-domain containing protein/aminotr 96.89
PRK06959 339 putative threonine-phosphate decarboxylase; Provis 96.88
COG4992 404 ArgD Ornithine/acetylornithine aminotransferase [A 96.87
PLN03227392 serine palmitoyltransferase-like protein; Provisio 96.87
PLN02724805 Molybdenum cofactor sulfurase 96.83
PRK06082 459 4-aminobutyrate aminotransferase; Provisional 96.81
PRK06207405 aspartate aminotransferase; Provisional 96.8
PRK05965 459 hypothetical protein; Provisional 96.75
PLN02452365 phosphoserine transaminase 96.75
COG0160 447 GabT 4-aminobutyrate aminotransferase and related 96.75
PRK09105370 putative aminotransferase; Provisional 96.74
PRK04635354 histidinol-phosphate aminotransferase; Provisional 96.74
PRK07324373 transaminase; Validated 96.74
PLN00175413 aminotransferase family protein; Provisional 96.71
PRK13392410 5-aminolevulinate synthase; Provisional 96.69
PRK05630 422 adenosylmethionine--8-amino-7-oxononanoate transam 96.69
TIGR01264401 tyr_amTase_E tyrosine aminotransferase, eukaryotic 96.69
PRK07682378 hypothetical protein; Validated 96.67
KOG1549|consensus428 96.67
PRK07046 453 aminotransferase; Validated 96.66
KOG1357|consensus 519 96.66
PRK06173 429 adenosylmethionine--8-amino-7-oxononanoate transam 96.65
PRK09082386 methionine aminotransferase; Validated 96.64
PRK03158359 histidinol-phosphate aminotransferase; Provisional 96.63
TIGR00508 427 bioA adenosylmethionine-8-amino-7-oxononanoate tra 96.61
PRK04781364 histidinol-phosphate aminotransferase; Provisional 96.61
COG3033 471 TnaA Tryptophanase [Amino acid transport and metab 96.61
PRK06917 447 hypothetical protein; Provisional 96.6
PRK08363398 alanine aminotransferase; Validated 96.6
PRK06209 431 glutamate-1-semialdehyde 2,1-aminomutase; Provisio 96.6
PRK08153369 histidinol-phosphate aminotransferase; Provisional 96.59
KOG0634|consensus 472 96.59
PF03841 367 SelA: L-seryl-tRNA selenium transferase; InterPro: 96.56
PRK06938 464 diaminobutyrate--2-oxoglutarate aminotransferase; 96.54
PRK07483 443 hypothetical protein; Provisional 96.5
COG0156388 BioF 7-keto-8-aminopelargonate synthetase and rela 96.5
PRK09265404 aminotransferase AlaT; Validated 96.5
PRK07505402 hypothetical protein; Provisional 96.48
KOG3843|consensus 432 96.44
PRK08742 472 adenosylmethionine--8-amino-7-oxononanoate transam 96.43
TIGR03251 431 LAT_fam L-lysine 6-transaminase. Characterized mem 96.43
COG0001 432 HemL Glutamate-1-semialdehyde aminotransferase [Co 96.42
PLN00143409 tyrosine/nicotianamine aminotransferase; Provision 96.42
PRK12414384 putative aminotransferase; Provisional 96.4
PRK08297 443 L-lysine aminotransferase; Provisional 96.39
KOG2467|consensus 477 96.38
PRK06931 459 diaminobutyrate--2-oxoglutarate aminotransferase; 96.35
TIGR03588380 PseC UDP-4-keto-6-deoxy-N-acetylglucosamine 4-amin 96.33
PRK13238460 tnaA tryptophanase/L-cysteine desulfhydrase, PLP-d 96.3
cd00615294 Orn_deC_like Ornithine decarboxylase family. This 96.3
>PLN02590 probable tyrosine decarboxylase Back     alignment and domain information 
Probab=100.00  E-value=1.4e-66  Score=594.98  Aligned_cols=310  Identities=45%  Similarity=0.860  Sum_probs=290.5

Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHHHHhcCC----CCCCCCCChhhHhhcCCCCCCCCCCCHHHHHHHHHHHHcCCCCCC
Q psy13453        445 SPVTPPPNEEFREFGKAAIDFIADYVDNIRE----RPVLPSVEPGYLASLVPGEMPEEGEDWRHIMRDMNTVIMPGITHW  520 (764)
Q Consensus       445 ~~~~~~~~~~~~~~~~~~v~~i~~y~~~~~~----~~v~~~~~p~~l~~~l~~~lP~~g~~~~~il~~l~~~i~~~~~~~  520 (764)
                      +++..||+++||+.+++++|++.+|++++.+    +||.+...|+++++.++.++|++|++++++++++.+.+.++.++|
T Consensus        49 ~~~~~m~~~~~r~~~~~~~d~i~~~~~~~~~~~~~~pv~~~~~p~~l~~~l~~~~P~~g~~~~~il~~~~~~i~p~~~~~  128 (539)
T PLN02590         49 VKMKPMDSELLREQGHIMVDFIADYYKNLQDSPQDFPVLSQVQPGYLRDMLPDSAPERPESLKELLDDVSKKIMPGITHW  128 (539)
T ss_pred             ccCCCCCHHHHHHHHHHHHHHHHHHHhhccccccCCCCCCCCChHHHHHhcCCCCCCCCCCHHHHHHHHHHHHhccCCcC
Confidence            3445599999999999999999999999876    799999999999999999999999999999999999999999999


Q ss_pred             CCCccccccCCCCChHHHHHHHHHHhhcccCccccCCchHHHHHHHHHHHHHHHcCCCccccCCCCCCCcEEEeCChHHH
Q psy13453        521 QSPQFNAYFPTGSSYPSIVGDMLSGAFGLIGFSWLSSPACTELEVLVMNWLGKALGLPEEFLNCSPGPGGGIIQSTASEA  600 (764)
Q Consensus       521 ~~P~~~~~~~~~~~~~~~lad~l~~~lN~n~~~~~~sp~~t~lE~~v~~~la~llG~p~~~~~~~~~~~~GvfTsGgTeA  600 (764)
                      +||+||+|++++++++++++|++++++|+++++|+.+|++++||+++++||++++|+|++|.  ..+.++|+||+|||+|
T Consensus       129 ~hP~f~a~~~~~~~~~~~lgd~l~sa~n~~~~~~~~sPa~t~lE~~vi~wl~~l~glp~~~~--~~~~~gG~~~sGgSeA  206 (539)
T PLN02590        129 QSPSYFAYYASSTSVAGFLGEMLNAGLSVVGFTWLTSPAATELEIIVLDWLAKLLQLPDHFL--STGNGGGVIQGTGCEA  206 (539)
T ss_pred             CCCCeeEeccCCCcHHHHHHHHHHHhcccccCCcccCchhHHHHHHHHHHHHHHhCCCcccc--cCCCCceEEcCchHHH
Confidence            99999999999999999999999999999999999999999999999999999999998765  2344789999999999


Q ss_pred             HHHHHHHHHHHHhhhhccCCCCCccccccCceEEEecCCcchhHHHHHHhCCC---ceEEEecC--CCCcccHHHHHHHH
Q psy13453        601 TLVSILVAKRKMINHWQSKNPSLTENDIRNKLVAYTSDQSNSSVEKSAIIGDV---PVRQLRSD--DNGVLRGDALLTAV  675 (764)
Q Consensus       601 Nl~Al~aAR~~~~~~~~~~~~~~~~~~~~~~~vi~~S~~aH~Sv~kAa~~lGl---~v~~Vp~d--~~g~md~~~Le~~I  675 (764)
                      |++||.+||++..+..+..        ..+++++|+|+++|||+.|||+++|+   +++.||+|  ++++||+++|+++|
T Consensus       207 nl~al~aAR~~~~~~~g~~--------~~~~~vvy~S~~aH~Sv~KAa~ilGlg~~~vr~Vp~d~~~~~~md~~~L~~~I  278 (539)
T PLN02590        207 VLVVVLAARDRILKKVGKT--------LLPQLVVYGSDQTHSSFRKACLIGGIHEENIRLLKTDSSTNYGMPPESLEEAI  278 (539)
T ss_pred             HHHHHHHHHHHHHhhhccc--------CCCCEEEEecCCchHHHHHHHHHcCCCcccEEEEeCCCCCCCcCCHHHHHHHH
Confidence            9999999999876543221        24678999999999999999999999   69999998  46899999999999


Q ss_pred             HHhhhcCCCceEEEEeeccCCccccccHHHHHHHHHhcCCEEEEeccccccccccchhhhhhcCCCcccEEEEcCCccCC
Q psy13453        676 KEDLAKGLIPCCLIATLGTTGTCAFDNLEELGPICQEYNIWLHVDAAYAGSALLLPEYAHLKRGLEYVDSFDFNTHKWLL  755 (764)
Q Consensus       676 ~~~~~~G~~p~~VvataGTT~~GaiDpl~eIa~i~~~~glwLHVDaA~Gg~~l~~~~~r~~l~gie~aDSit~d~HK~l~  755 (764)
                      ++++++|.+|++||+|+|||.+|+||||++|+++|++||+||||||||||+++++|+++++++|+|+||||++|+||||+
T Consensus       279 ~~d~~~g~~P~~VvaTaGTT~tGaiDpl~~Ia~i~~~~g~WlHVDaA~GG~al~~~~~r~~~~Gie~ADSit~D~HK~l~  358 (539)
T PLN02590        279 SHDLAKGFIPFFICATVGTTSSAAVDPLVPLGNIAKKYGIWLHVDAAYAGNACICPEYRKFIDGIENADSFNMNAHKWLF  358 (539)
T ss_pred             HHHHhcCCCcEEEEEEeCCCCCcccCCHHHHHHHHHHhCCeEEEecchhhhhhcChhhHHHhcCCccCCEEEECchhhcC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCcCceeeC
Q psy13453        756 VNFDCSAMW  764 (764)
Q Consensus       756 ~P~~~g~l~  764 (764)
                      +|++||++|
T Consensus       359 ~p~~cg~ll  367 (539)
T PLN02590        359 ANQTCSPLW  367 (539)
T ss_pred             cCcCEEEEE
Confidence            999999986

>KOG0628|consensus Back     alignment and domain information
>PLN02880 tyrosine decarboxylase Back     alignment and domain information
>KOG0629|consensus Back     alignment and domain information
>PF00282 Pyridoxal_deC: Pyridoxal-dependent decarboxylase conserved domain; InterPro: IPR002129 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) Back     alignment and domain information
>TIGR03799 NOD_PanD_pyr putative pyridoxal-dependent aspartate 1-decarboxylase Back     alignment and domain information
>TIGR03811 tyr_de_CO2_Ent tyrosine decarboxylase, Enterococcus type Back     alignment and domain information
>PLN02590 probable tyrosine decarboxylase Back     alignment and domain information
>COG0076 GadB Glutamate decarboxylase and related PLP-dependent proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02263 serine decarboxylase Back     alignment and domain information
>PLN02880 tyrosine decarboxylase Back     alignment and domain information
>KOG0629|consensus Back     alignment and domain information
>TIGR01788 Glu-decarb-GAD glutamate decarboxylase Back     alignment and domain information
>TIGR03799 NOD_PanD_pyr putative pyridoxal-dependent aspartate 1-decarboxylase Back     alignment and domain information
>KOG0628|consensus Back     alignment and domain information
>PLN03032 serine decarboxylase; Provisional Back     alignment and domain information
>PRK02769 histidine decarboxylase; Provisional Back     alignment and domain information
>PF00282 Pyridoxal_deC: Pyridoxal-dependent decarboxylase conserved domain; InterPro: IPR002129 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) Back     alignment and domain information
>KOG1383|consensus Back     alignment and domain information
>TIGR03811 tyr_de_CO2_Ent tyrosine decarboxylase, Enterococcus type Back     alignment and domain information
>PLN02263 serine decarboxylase Back     alignment and domain information
>cd06450 DOPA_deC_like DOPA decarboxylase family Back     alignment and domain information
>COG0076 GadB Glutamate decarboxylase and related PLP-dependent proteins [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01788 Glu-decarb-GAD glutamate decarboxylase Back     alignment and domain information
>PLN03032 serine decarboxylase; Provisional Back     alignment and domain information
>PRK02769 histidine decarboxylase; Provisional Back     alignment and domain information
>COG1104 NifS Cysteine sulfinate desulfinase/cysteine desulfurase and related enzymes [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05367 glycine dehydrogenase; Provisional Back     alignment and domain information
>PRK13520 L-tyrosine decarboxylase; Provisional Back     alignment and domain information
>KOG1383|consensus Back     alignment and domain information
>TIGR03812 tyr_de_CO2_Arch tyrosine decarboxylase MnfA Back     alignment and domain information
>TIGR03531 selenium_SpcS O-phosphoseryl-tRNA(Sec) selenium transferase Back     alignment and domain information
>cd06450 DOPA_deC_like DOPA decarboxylase family Back     alignment and domain information
>COG0520 csdA Selenocysteine lyase/Cysteine desulfurase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00461 gcvP glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>PLN02651 cysteine desulfurase Back     alignment and domain information
>KOG1549|consensus Back     alignment and domain information
>PRK04366 glycine dehydrogenase subunit 2; Validated Back     alignment and domain information
>TIGR02006 IscS cysteine desulfurase IscS Back     alignment and domain information
>TIGR03402 FeS_nifS cysteine desulfurase NifS Back     alignment and domain information
>TIGR03235 DNA_S_dndA cysteine desulfurase DndA Back     alignment and domain information
>PRK14012 cysteine desulfurase; Provisional Back     alignment and domain information
>cd06453 SufS_like Cysteine desulfurase (SufS)-like Back     alignment and domain information
>PRK02948 cysteine desulfurase; Provisional Back     alignment and domain information
>PRK00451 glycine dehydrogenase subunit 1; Validated Back     alignment and domain information
>TIGR01979 sufS cysteine desulfurases, SufS subfamily Back     alignment and domain information
>PF00266 Aminotran_5: Aminotransferase class-V; InterPro: IPR000192 Aminotransferases share certain mechanistic features with other pyridoxal- phosphate dependent enzymes, such as the covalent binding of the pyridoxal- phosphate group to a lysine residue Back     alignment and domain information
>TIGR01977 am_tr_V_EF2568 cysteine desulfurase family protein Back     alignment and domain information
>TIGR03403 nifS_epsilon cysteine desulfurase, NifS family, epsilon proteobacteria type Back     alignment and domain information
>PRK09331 Sep-tRNA:Cys-tRNA synthetase; Provisional Back     alignment and domain information
>PRK09295 bifunctional cysteine desulfurase/selenocysteine lyase; Validated Back     alignment and domain information
>TIGR03392 FeS_syn_CsdA cysteine desulfurase, catalytic subunit CsdA Back     alignment and domain information
>cd06451 AGAT_like Alanine-glyoxylate aminotransferase (AGAT) family Back     alignment and domain information
>PRK13520 L-tyrosine decarboxylase; Provisional Back     alignment and domain information
>PRK10874 cysteine sulfinate desulfinase; Provisional Back     alignment and domain information
>cd00613 GDC-P Glycine cleavage system P-protein, alpha- and beta-subunits Back     alignment and domain information
>TIGR00461 gcvP glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>cd06452 SepCysS Sep-tRNA:Cys-tRNA synthase Back     alignment and domain information
>PLN02855 Bifunctional selenocysteine lyase/cysteine desulfurase Back     alignment and domain information
>PLN02414 glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>cd00615 Orn_deC_like Ornithine decarboxylase family Back     alignment and domain information
>PRK12566 glycine dehydrogenase; Provisional Back     alignment and domain information
>TIGR03812 tyr_de_CO2_Arch tyrosine decarboxylase MnfA Back     alignment and domain information
>cd01494 AAT_I Aspartate aminotransferase (AAT) superfamily (fold type I) of pyridoxal phosphate (PLP)-dependent enzymes Back     alignment and domain information
>TIGR01814 kynureninase kynureninase Back     alignment and domain information
>TIGR02326 transamin_PhnW 2-aminoethylphosphonate--pyruvate transaminase Back     alignment and domain information
>PLN02409 serine--glyoxylate aminotransaminase Back     alignment and domain information
>PLN02724 Molybdenum cofactor sulfurase Back     alignment and domain information
>TIGR01976 am_tr_V_VC1184 cysteine desulfurase family protein, VC1184 subfamily Back     alignment and domain information
>PTZ00094 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>PRK05367 glycine dehydrogenase; Provisional Back     alignment and domain information
>PF01212 Beta_elim_lyase: Beta-eliminating lyase; InterPro: IPR001597 This domain is found in many tryptophanases (tryptophan indole-lyase, TNase), tyrosine phenol-lyases (TPL) and threonine aldolases Back     alignment and domain information
>TIGR03301 PhnW-AepZ 2-aminoethylphosphonate aminotransferase Back     alignment and domain information
>TIGR02539 SepCysS Sep-tRNA:Cys-tRNA synthase Back     alignment and domain information
>COG2008 GLY1 Threonine aldolase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02721 threonine aldolase Back     alignment and domain information
>cd00609 AAT_like Aspartate aminotransferase family Back     alignment and domain information
>cd06502 TA_like Low-specificity threonine aldolase (TA) Back     alignment and domain information
>PRK13479 2-aminoethylphosphonate--pyruvate transaminase; Provisional Back     alignment and domain information
>PRK04366 glycine dehydrogenase subunit 2; Validated Back     alignment and domain information
>KOG1368|consensus Back     alignment and domain information
>PF01276 OKR_DC_1: Orn/Lys/Arg decarboxylase, major domain; InterPro: IPR000310 Pyridoxal-dependent decarboxylases are bacterial proteins acting on ornithine, lysine, arginine and related substrates [] Back     alignment and domain information
>TIGR01437 selA_rel uncharacterized pyridoxal phosphate-dependent enzyme Back     alignment and domain information
>PRK07179 hypothetical protein; Provisional Back     alignment and domain information
>PRK03080 phosphoserine aminotransferase; Provisional Back     alignment and domain information
>cd06454 KBL_like KBL_like; this family belongs to the pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I) Back     alignment and domain information
>PRK15029 arginine decarboxylase; Provisional Back     alignment and domain information
>cd00616 AHBA_syn 3-amino-5-hydroxybenzoic acid synthase family (AHBA_syn) Back     alignment and domain information
>PRK05937 8-amino-7-oxononanoate synthase; Provisional Back     alignment and domain information
>cd00378 SHMT Serine-glycine hydroxymethyltransferase (SHMT) Back     alignment and domain information
>TIGR03531 selenium_SpcS O-phosphoseryl-tRNA(Sec) selenium transferase Back     alignment and domain information
>TIGR01822 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A ligase Back     alignment and domain information
>PRK08361 aspartate aminotransferase; Provisional Back     alignment and domain information
>KOG0630|consensus Back     alignment and domain information
>cd06453 SufS_like Cysteine desulfurase (SufS)-like Back     alignment and domain information
>PRK00011 glyA serine hydroxymethyltransferase; Reviewed Back     alignment and domain information
>PLN03226 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>COG1103 Archaea-specific pyridoxal phosphate-dependent enzymes [General function prediction only] Back     alignment and domain information
>COG1003 GcvP Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01979 sufS cysteine desulfurases, SufS subfamily Back     alignment and domain information
>PRK08134 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK13238 tnaA tryptophanase/L-cysteine desulfhydrase, PLP-dependent; Provisional Back     alignment and domain information
>cd00611 PSAT_like Phosphoserine aminotransferase (PSAT) family Back     alignment and domain information
>PRK11658 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>PRK10874 cysteine sulfinate desulfinase; Provisional Back     alignment and domain information
>PRK06939 2-amino-3-ketobutyrate coenzyme A ligase; Provisional Back     alignment and domain information
>TIGR03588 PseC UDP-4-keto-6-deoxy-N-acetylglucosamine 4-aminotransferase Back     alignment and domain information
>PRK13034 serine hydroxymethyltransferase; Reviewed Back     alignment and domain information
>PRK15399 lysine decarboxylase LdcC; Provisional Back     alignment and domain information
>KOG0630|consensus Back     alignment and domain information
>PRK04311 selenocysteine synthase; Provisional Back     alignment and domain information
>TIGR00474 selA seryl-tRNA(sec) selenium transferase Back     alignment and domain information
>TIGR01977 am_tr_V_EF2568 cysteine desulfurase family protein Back     alignment and domain information
>PRK06108 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK13580 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>PRK05764 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK15400 lysine decarboxylase CadA; Provisional Back     alignment and domain information
>TIGR01329 cysta_beta_ly_E cystathionine beta-lyase, eukaryotic Back     alignment and domain information
>PLN02414 glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK05613 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK09082 methionine aminotransferase; Validated Back     alignment and domain information
>PRK05958 8-amino-7-oxononanoate synthase; Reviewed Back     alignment and domain information
>TIGR02618 tyr_phenol_ly tyrosine phenol-lyase Back     alignment and domain information
>PRK13578 ornithine decarboxylase; Provisional Back     alignment and domain information
>TIGR03392 FeS_syn_CsdA cysteine desulfurase, catalytic subunit CsdA Back     alignment and domain information
>PLN02271 serine hydroxymethyltransferase Back     alignment and domain information
>PRK06225 aspartate aminotransferase; Provisional Back     alignment and domain information
>cd00614 CGS_like CGS_like: Cystathionine gamma-synthase is a PLP dependent enzyme and catalyzes the committed step of methionine biosynthesis Back     alignment and domain information
>PRK08133 O-succinylhomoserine sulfhydrylase; Validated Back     alignment and domain information
>PRK11706 TDP-4-oxo-6-deoxy-D-glucose transaminase; Provisional Back     alignment and domain information
>PRK07777 aminotransferase; Validated Back     alignment and domain information
>TIGR02379 ECA_wecE TDP-4-keto-6-deoxy-D-glucose transaminase Back     alignment and domain information
>cd00613 GDC-P Glycine cleavage system P-protein, alpha- and beta-subunits Back     alignment and domain information
>PRK00451 glycine dehydrogenase subunit 1; Validated Back     alignment and domain information
>cd06451 AGAT_like Alanine-glyoxylate aminotransferase (AGAT) family Back     alignment and domain information
>PRK13237 tyrosine phenol-lyase; Provisional Back     alignment and domain information
>cd00617 Tnase_like Tryptophanase family (Tnase) Back     alignment and domain information
>PRK10534 L-threonine aldolase; Provisional Back     alignment and domain information
>PRK12414 putative aminotransferase; Provisional Back     alignment and domain information
>TIGR02006 IscS cysteine desulfurase IscS Back     alignment and domain information
>TIGR03402 FeS_nifS cysteine desulfurase NifS Back     alignment and domain information
>TIGR01825 gly_Cac_T_rel pyridoxal phosphate-dependent acyltransferase, putative Back     alignment and domain information
>PRK09295 bifunctional cysteine desulfurase/selenocysteine lyase; Validated Back     alignment and domain information
>PLN02483 serine palmitoyltransferase Back     alignment and domain information
>TIGR00858 bioF 8-amino-7-oxononanoate synthase Back     alignment and domain information
>PRK05994 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK08912 hypothetical protein; Provisional Back     alignment and domain information
>PRK15407 lipopolysaccharide biosynthesis protein RfbH; Provisional Back     alignment and domain information
>TIGR01328 met_gam_lyase methionine gamma-lyase Back     alignment and domain information
>TIGR01141 hisC histidinol-phosphate aminotransferase Back     alignment and domain information
>TIGR01326 OAH_OAS_sulfhy OAH/OAS sulfhydrylase Back     alignment and domain information
>PRK05968 hypothetical protein; Provisional Back     alignment and domain information
>PRK05957 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07812 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>TIGR03403 nifS_epsilon cysteine desulfurase, NifS family, epsilon proteobacteria type Back     alignment and domain information
>COG1104 NifS Cysteine sulfinate desulfinase/cysteine desulfurase and related enzymes [Amino acid transport and metabolism] Back     alignment and domain information
>cd06452 SepCysS Sep-tRNA:Cys-tRNA synthase Back     alignment and domain information
>TIGR01325 O_suc_HS_sulf O-succinylhomoserine sulfhydrylase Back     alignment and domain information
>PRK07337 aminotransferase; Validated Back     alignment and domain information
>PRK08960 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00433 tyrosine aminotransferase; Provisional Back     alignment and domain information
>PLN02656 tyrosine transaminase Back     alignment and domain information
>TIGR01821 5aminolev_synth 5-aminolevulinic acid synthase Back     alignment and domain information
>PRK06767 methionine gamma-lyase; Provisional Back     alignment and domain information
>PRK09331 Sep-tRNA:Cys-tRNA synthetase; Provisional Back     alignment and domain information
>PRK08248 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PF01041 DegT_DnrJ_EryC1: DegT/DnrJ/EryC1/StrS aminotransferase family; InterPro: IPR000653 This entry represents a family that are probably all pyridoxal-phosphate-dependent aminotransferase enzymes with a variety of molecular functions Back     alignment and domain information
>PRK05939 hypothetical protein; Provisional Back     alignment and domain information
>PRK08574 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK07503 methionine gamma-lyase; Provisional Back     alignment and domain information
>PRK08064 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK07504 O-succinylhomoserine sulfhydrylase; Reviewed Back     alignment and domain information
>PLN02855 Bifunctional selenocysteine lyase/cysteine desulfurase Back     alignment and domain information
>PRK07050 cystathionine beta-lyase; Provisional Back     alignment and domain information
>cd00610 OAT_like Acetyl ornithine aminotransferase family Back     alignment and domain information
>PRK13392 5-aminolevulinate synthase; Provisional Back     alignment and domain information
>PLN02509 cystathionine beta-lyase Back     alignment and domain information
>PRK09064 5-aminolevulinate synthase; Validated Back     alignment and domain information
>PRK00950 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PRK07309 aromatic amino acid aminotransferase; Validated Back     alignment and domain information
>COG0399 WecE Predicted pyridoxal phosphate-dependent enzyme apparently involved in regulation of cell wall biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN00175 aminotransferase family protein; Provisional Back     alignment and domain information
>TIGR02617 tnaA_trp_ase tryptophanase, leader peptide-associated Back     alignment and domain information
>COG0520 csdA Selenocysteine lyase/Cysteine desulfurase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01366 serC_3 phosphoserine aminotransferase, putative Back     alignment and domain information
>TIGR01265 tyr_nico_aTase tyrosine/nicotianamine aminotransferases Back     alignment and domain information
>PRK06836 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK08249 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK08363 alanine aminotransferase; Validated Back     alignment and domain information
>PRK05355 3-phosphoserine/phosphohydroxythreonine aminotransferase; Provisional Back     alignment and domain information
>TIGR01324 cysta_beta_ly_B cystathionine beta-lyase, bacterial Back     alignment and domain information
>TIGR03537 DapC succinyldiaminopimelate transaminase Back     alignment and domain information
>PRK07811 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK08861 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PLN02242 methionine gamma-lyase Back     alignment and domain information
>PRK07324 transaminase; Validated Back     alignment and domain information
>PRK09028 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK08114 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK07682 hypothetical protein; Validated Back     alignment and domain information
>PRK07550 hypothetical protein; Provisional Back     alignment and domain information
>PRK07810 O-succinylhomoserine sulfhydrylase; Provisional Back     alignment and domain information
>PRK06207 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK05942 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK08776 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK06234 methionine gamma-lyase; Provisional Back     alignment and domain information
>TIGR01976 am_tr_V_VC1184 cysteine desulfurase family protein, VC1184 subfamily Back     alignment and domain information
>PLN00145 tyrosine/nicotianamine aminotransferase; Provisional Back     alignment and domain information
>PF00155 Aminotran_1_2: Aminotransferase class I and II 1-aminocyclopropane-1-carboxylate synthase signature aspartate aminotransferase signature; InterPro: IPR004839 Aminotransferases share certain mechanistic features with other pyridoxal-phosphate dependent enzymes, such as the covalent binding of the pyridoxal-phosphate group to a lysine residue Back     alignment and domain information
>PRK07671 cystathionine beta-lyase; Provisional Back     alignment and domain information
>COG0075 Serine-pyruvate aminotransferase/archaeal aspartate aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07683 aminotransferase A; Validated Back     alignment and domain information
>PRK06084 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK13393 5-aminolevulinate synthase; Provisional Back     alignment and domain information
>TIGR03540 DapC_direct LL-diaminopimelate aminotransferase Back     alignment and domain information
>TIGR01364 serC_1 phosphoserine aminotransferase Back     alignment and domain information
>PRK07681 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK06176 cystathionine gamma-synthase/cystathionine beta-lyase; Validated Back     alignment and domain information
>PLN02651 cysteine desulfurase Back     alignment and domain information
>COG0436 Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02376 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>TIGR01814 kynureninase kynureninase Back     alignment and domain information
>PRK08045 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK14012 cysteine desulfurase; Provisional Back     alignment and domain information
>PLN02721 threonine aldolase Back     alignment and domain information
>TIGR02326 transamin_PhnW 2-aminoethylphosphonate--pyruvate transaminase Back     alignment and domain information
>PLN02187 rooty/superroot1 Back     alignment and domain information
>PRK02948 cysteine desulfurase; Provisional Back     alignment and domain information
>PTZ00377 alanine aminotransferase; Provisional Back     alignment and domain information
>PLN02822 serine palmitoyltransferase Back     alignment and domain information
>PRK03244 argD acetylornithine aminotransferase; Provisional Back     alignment and domain information
>TIGR01140 L_thr_O3P_dcar L-threonine-O-3-phosphate decarboxylase Back     alignment and domain information
>TIGR03301 PhnW-AepZ 2-aminoethylphosphonate aminotransferase Back     alignment and domain information
>PRK14807 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK08247 cystathionine gamma-synthase; Reviewed Back     alignment and domain information
>PRK06348 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK06107 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK08636 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07568 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK06702 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>TIGR02080 O_succ_thio_ly O-succinylhomoserine (thiol)-lyase Back     alignment and domain information
>PF00266 Aminotran_5: Aminotransferase class-V; InterPro: IPR000192 Aminotransferases share certain mechanistic features with other pyridoxal- phosphate dependent enzymes, such as the covalent binding of the pyridoxal- phosphate group to a lysine residue Back     alignment and domain information
>TIGR02539 SepCysS Sep-tRNA:Cys-tRNA synthase Back     alignment and domain information
>PLN03227 serine palmitoyltransferase-like protein; Provisional Back     alignment and domain information
>PLN02368 alanine transaminase Back     alignment and domain information
>PRK05387 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK09265 aminotransferase AlaT; Validated Back     alignment and domain information
>PRK08068 transaminase; Reviewed Back     alignment and domain information
>TIGR03576 pyridox_MJ0158 pyridoxal phosphate enzyme, MJ0158 family Back     alignment and domain information
>PLN02231 alanine transaminase Back     alignment and domain information
>PRK13355 bifunctional HTH-domain containing protein/aminotransferase; Provisional Back     alignment and domain information
>PRK09276 LL-diaminopimelate aminotransferase; Provisional Back     alignment and domain information
>PRK13479 2-aminoethylphosphonate--pyruvate transaminase; Provisional Back     alignment and domain information
>TIGR01264 tyr_amTase_E tyrosine aminotransferase, eukaryotic Back     alignment and domain information
>PRK08175 aminotransferase; Validated Back     alignment and domain information
>PF05889 SLA_LP_auto_ag: Soluble liver antigen/liver pancreas antigen (SLA/LP autoantigen); InterPro: IPR008829 This family consists of several eukaryotic and archaeal proteins which are related to the Homo sapiens soluble liver antigen/liver pancreas antigen (SLA/LP autoantigen) Back     alignment and domain information
>PRK06460 hypothetical protein; Provisional Back     alignment and domain information
>COG2008 GLY1 Threonine aldolase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07505 hypothetical protein; Provisional Back     alignment and domain information
>COG0156 BioF 7-keto-8-aminopelargonate synthetase and related enzymes [Coenzyme metabolism] Back     alignment and domain information
>cd06502 TA_like Low-specificity threonine aldolase (TA) Back     alignment and domain information
>PRK08056 threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK04870 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK02731 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PRK09105 putative aminotransferase; Provisional Back     alignment and domain information
>PRK12566 glycine dehydrogenase; Provisional Back     alignment and domain information
>PRK01688 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK09148 aminotransferase; Validated Back     alignment and domain information
>PRK09147 succinyldiaminopimelate transaminase; Provisional Back     alignment and domain information
>PRK03321 putative aminotransferase; Provisional Back     alignment and domain information
>PRK07582 cystathionine gamma-lyase; Validated Back     alignment and domain information
>PLN00143 tyrosine/nicotianamine aminotransferase; Provisional Back     alignment and domain information
>cd00609 AAT_like Aspartate aminotransferase family Back     alignment and domain information
>PRK05166 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK00854 rocD ornithine--oxo-acid transaminase; Reviewed Back     alignment and domain information
>PRK03158 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PLN02450 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>PRK07366 succinyldiaminopimelate transaminase; Validated Back     alignment and domain information
>COG0112 GlyA Glycine/serine hydroxymethyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PF00464 SHMT: Serine hydroxymethyltransferase; InterPro: IPR001085 Synonym(s): Serine hydroxymethyltransferase, Serine aldolase, Threonine aldolase Serine hydroxymethyltransferase (SHMT) is a pyridoxal phosphate (PLP) dependent enzyme and belongs to the aspartate aminotransferase superfamily (fold type I) [] Back     alignment and domain information
>PRK06290 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK05967 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PTZ00125 ornithine aminotransferase-like protein; Provisional Back     alignment and domain information
>PRK03317 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>TIGR00707 argD acetylornithine and succinylornithine aminotransferases Back     alignment and domain information
>PRK07269 cystathionine gamma-synthase; Reviewed Back     alignment and domain information
>PRK04073 rocD ornithine--oxo-acid transaminase; Provisional Back     alignment and domain information
>PF02347 GDC-P: Glycine cleavage system P-protein; InterPro: IPR020580 This family consists of glycine cleavage system P-proteins (1 Back     alignment and domain information
>TIGR01885 Orn_aminotrans ornithine aminotransferase Back     alignment and domain information
>TIGR03538 DapC_gpp succinyldiaminopimelate transaminase Back     alignment and domain information
>PRK04635 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK07908 hypothetical protein; Provisional Back     alignment and domain information
>PRK03967 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PLN02607 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>PRK03715 argD acetylornithine transaminase protein; Provisional Back     alignment and domain information
>PLN02624 ornithine-delta-aminotransferase Back     alignment and domain information
>PRK15481 transcriptional regulatory protein PtsJ; Provisional Back     alignment and domain information
>PRK01278 argD acetylornithine transaminase protein; Provisional Back     alignment and domain information
>PRK06434 cystathionine gamma-lyase; Validated Back     alignment and domain information
>TIGR03246 arg_catab_astC succinylornithine transaminase family Back     alignment and domain information
>PLN03026 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK06855 aminotransferase; Validated Back     alignment and domain information
>PRK02627 acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PRK02936 argD acetylornithine aminotransferase; Provisional Back     alignment and domain information
>KOG2040|consensus Back     alignment and domain information
>PLN02409 serine--glyoxylate aminotransaminase Back     alignment and domain information
>PRK09257 aromatic amino acid aminotransferase; Provisional Back     alignment and domain information
>TIGR03801 asp_4_decarbox aspartate 4-decarboxylase Back     alignment and domain information
>PTZ00094 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>PRK01533 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PRK03080 phosphoserine aminotransferase; Provisional Back     alignment and domain information
>cd00616 AHBA_syn 3-amino-5-hydroxybenzoic acid synthase family (AHBA_syn) Back     alignment and domain information
>PLN02955 8-amino-7-oxononanoate synthase Back     alignment and domain information
>PRK05093 argD bifunctional N-succinyldiaminopimelate-aminotransferase/acetylornithine transaminase protein; Reviewed Back     alignment and domain information
>PRK06358 threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>KOG0257|consensus Back     alignment and domain information
>KOG2862|consensus Back     alignment and domain information
>PTZ00376 aspartate aminotransferase; Provisional Back     alignment and domain information
>COG1167 ARO8 Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>COG1982 LdcC Arginine/lysine/ornithine decarboxylases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK04260 acetylornithine aminotransferase; Provisional Back     alignment and domain information
>TIGR03235 DNA_S_dndA cysteine desulfurase DndA Back     alignment and domain information
>PRK07590 L,L-diaminopimelate aminotransferase; Validated Back     alignment and domain information
>PRK04781 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK09275 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK08153 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK07865 N-succinyldiaminopimelate aminotransferase; Reviewed Back     alignment and domain information
>PRK05839 hypothetical protein; Provisional Back     alignment and domain information
>cd06454 KBL_like KBL_like; this family belongs to the pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I) Back     alignment and domain information
>PRK08637 hypothetical protein; Provisional Back     alignment and domain information
>PRK12381 bifunctional succinylornithine transaminase/acetylornithine transaminase; Provisional Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>TIGR01365 serC_2 phosphoserine aminotransferase, Methanosarcina type Back     alignment and domain information
>TIGR03539 DapC_actino succinyldiaminopimelate transaminase Back     alignment and domain information
>PRK02610 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK08354 putative aminotransferase; Provisional Back     alignment and domain information
>PRK06425 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>COG1003 GcvP Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01822 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A ligase Back     alignment and domain information
>PRK05964 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK14808 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PLN02452 phosphoserine transaminase Back     alignment and domain information
>PF01053 Cys_Met_Meta_PP: Cys/Met metabolism PLP-dependent enzyme; InterPro: IPR000277 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) Back     alignment and domain information
>PRK07049 methionine gamma-lyase; Validated Back     alignment and domain information
>PRK07179 hypothetical protein; Provisional Back     alignment and domain information
>COG2873 MET17 O-acetylhomoserine sulfhydrylase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12403 putative aminotransferase; Provisional Back     alignment and domain information
>TIGR03372 putres_am_tran putrescine aminotransferase Back     alignment and domain information
>PRK05937 8-amino-7-oxononanoate synthase; Provisional Back     alignment and domain information
>PRK09264 diaminobutyrate--2-oxoglutarate aminotransferase; Validated Back     alignment and domain information
>TIGR03542 DAPAT_plant LL-diaminopimelate aminotransferase Back     alignment and domain information
>PLN02760 4-aminobutyrate:pyruvate transaminase Back     alignment and domain information
>PRK05958 8-amino-7-oxononanoate synthase; Reviewed Back     alignment and domain information
>PRK08117 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK13580 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>cd00611 PSAT_like Phosphoserine aminotransferase (PSAT) family Back     alignment and domain information
>PRK14809 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>KOG0259|consensus Back     alignment and domain information
>PLN02822 serine palmitoyltransferase Back     alignment and domain information
>KOG0256|consensus Back     alignment and domain information
>PRK06939 2-amino-3-ketobutyrate coenzyme A ligase; Provisional Back     alignment and domain information
>PRK07392 threonine-phosphate decarboxylase; Validated Back     alignment and domain information
>TIGR00713 hemL glutamate-1-semialdehyde-2,1-aminomutase Back     alignment and domain information
>PRK05769 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK05764 aspartate aminotransferase; Provisional Back     alignment and domain information
>COG0075 Serine-pyruvate aminotransferase/archaeal aspartate aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02407 ectoine_ectB diaminobutyrate--2-oxoglutarate aminotransferase Back     alignment and domain information
>PRK00011 glyA serine hydroxymethyltransferase; Reviewed Back     alignment and domain information
>PRK05355 3-phosphoserine/phosphohydroxythreonine aminotransferase; Provisional Back     alignment and domain information
>PRK09440 avtA valine--pyruvate transaminase; Provisional Back     alignment and domain information
>PRK11522 putrescine--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>PRK04013 argD acetylornithine/acetyl-lysine aminotransferase; Provisional Back     alignment and domain information
>TIGR01437 selA_rel uncharacterized pyridoxal phosphate-dependent enzyme Back     alignment and domain information
>COG3844 Kynureninase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK04612 argD acetylornithine transaminase protein; Provisional Back     alignment and domain information
>PLN02397 aspartate transaminase Back     alignment and domain information
>TIGR01141 hisC histidinol-phosphate aminotransferase Back     alignment and domain information
>PRK08360 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>COG1168 MalY Bifunctional PLP-dependent enzyme with beta-cystathionase and maltose regulon repressor activities [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12389 glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>PLN00144 acetylornithine transaminase Back     alignment and domain information
>PLN03226 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>cd00378 SHMT Serine-glycine hydroxymethyltransferase (SHMT) Back     alignment and domain information
>PRK00062 glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>TIGR00700 GABAtrnsam 4-aminobutyrate aminotransferase, prokaryotic type Back     alignment and domain information
>TIGR01821 5aminolev_synth 5-aminolevulinic acid synthase Back     alignment and domain information
>COG1921 SelA Selenocysteine synthase [seryl-tRNASer selenium transferase] [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06062 hypothetical protein; Provisional Back     alignment and domain information
>PRK05387 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK01688 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK10534 L-threonine aldolase; Provisional Back     alignment and domain information
>PRK05957 aspartate aminotransferase; Provisional Back     alignment and domain information
>TIGR01364 serC_1 phosphoserine aminotransferase Back     alignment and domain information
>PRK06541 hypothetical protein; Provisional Back     alignment and domain information
>PRK09792 4-aminobutyrate transaminase; Provisional Back     alignment and domain information
>TIGR01366 serC_3 phosphoserine aminotransferase, putative Back     alignment and domain information
>COG0403 GcvP Glycine cleavage system protein P (pyridoxal-binding), N-terminal domain [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02482 glutamate-1-semialdehyde 2,1-aminomutase Back     alignment and domain information
>PRK08088 4-aminobutyrate aminotransferase; Validated Back     alignment and domain information
>PLN02483 serine palmitoyltransferase Back     alignment and domain information
>PRK07495 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK13360 omega amino acid--pyruvate transaminase; Provisional Back     alignment and domain information
>PRK06108 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK00950 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PF00155 Aminotran_1_2: Aminotransferase class I and II 1-aminocyclopropane-1-carboxylate synthase signature aspartate aminotransferase signature; InterPro: IPR004839 Aminotransferases share certain mechanistic features with other pyridoxal-phosphate dependent enzymes, such as the covalent binding of the pyridoxal-phosphate group to a lysine residue Back     alignment and domain information
>PRK09064 5-aminolevulinate synthase; Validated Back     alignment and domain information
>PLN00145 tyrosine/nicotianamine aminotransferase; Provisional Back     alignment and domain information
>PRK09221 beta alanine--pyruvate transaminase; Provisional Back     alignment and domain information
>KOG1368|consensus Back     alignment and domain information
>PRK07908 hypothetical protein; Provisional Back     alignment and domain information
>PRK06058 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK07678 aminotransferase; Validated Back     alignment and domain information
>PRK05664 threonine-phosphate decarboxylase; Reviewed Back     alignment and domain information
>COG0079 HisC Histidinol-phosphate/aromatic aminotransferase and cobyric acid decarboxylase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06225 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07481 hypothetical protein; Provisional Back     alignment and domain information
>KOG0053|consensus Back     alignment and domain information
>TIGR01265 tyr_nico_aTase tyrosine/nicotianamine aminotransferases Back     alignment and domain information
>TIGR00699 GABAtrns_euk 4-aminobutyrate aminotransferase, eukaryotic type Back     alignment and domain information
>COG3977 Alanine-alpha-ketoisovalerate (or valine-pyruvate) aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08593 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PF00202 Aminotran_3: Aminotransferase class-III; InterPro: IPR005814 Aminotransferases share certain mechanistic features with other pyridoxalphosphate-dependent enzymes, such as the covalent binding of the pyridoxalphosphate group to a lysine residue Back     alignment and domain information
>PRK12462 phosphoserine aminotransferase; Provisional Back     alignment and domain information
>PLN03026 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK04870 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK13034 serine hydroxymethyltransferase; Reviewed Back     alignment and domain information
>PRK07036 hypothetical protein; Provisional Back     alignment and domain information
>PRK06105 aminotransferase; Provisional Back     alignment and domain information
>PRK05639 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK07480 putative aminotransferase; Validated Back     alignment and domain information
>TIGR00858 bioF 8-amino-7-oxononanoate synthase Back     alignment and domain information
>PRK06777 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK14807 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK00615 glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>PRK02731 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>TIGR00709 dat 2,4-diaminobutyrate 4-transaminases Back     alignment and domain information
>PRK06943 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK13393 5-aminolevulinate synthase; Provisional Back     alignment and domain information
>PLN02656 tyrosine transaminase Back     alignment and domain information
>PRK08361 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07482 hypothetical protein; Provisional Back     alignment and domain information
>PRK06149 hypothetical protein; Provisional Back     alignment and domain information
>KOG0258|consensus Back     alignment and domain information
>cd00614 CGS_like CGS_like: Cystathionine gamma-synthase is a PLP dependent enzyme and catalyzes the committed step of methionine biosynthesis Back     alignment and domain information
>PRK05166 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK07030 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK07986 adenosylmethionine--8-amino-7-oxononanoate transaminase; Validated Back     alignment and domain information
>PRK06916 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>TIGR01825 gly_Cac_T_rel pyridoxal phosphate-dependent acyltransferase, putative Back     alignment and domain information
>PRK11658 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>PRK06918 4-aminobutyrate aminotransferase; Reviewed Back     alignment and domain information
>PRK13355 bifunctional HTH-domain containing protein/aminotransferase; Provisional Back     alignment and domain information
>PRK06959 putative threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>COG4992 ArgD Ornithine/acetylornithine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN03227 serine palmitoyltransferase-like protein; Provisional Back     alignment and domain information
>PLN02724 Molybdenum cofactor sulfurase Back     alignment and domain information
>PRK06082 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK06207 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK05965 hypothetical protein; Provisional Back     alignment and domain information
>PLN02452 phosphoserine transaminase Back     alignment and domain information
>COG0160 GabT 4-aminobutyrate aminotransferase and related aminotransferases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09105 putative aminotransferase; Provisional Back     alignment and domain information
>PRK04635 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK07324 transaminase; Validated Back     alignment and domain information
>PLN00175 aminotransferase family protein; Provisional Back     alignment and domain information
>PRK13392 5-aminolevulinate synthase; Provisional Back     alignment and domain information
>PRK05630 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>TIGR01264 tyr_amTase_E tyrosine aminotransferase, eukaryotic Back     alignment and domain information
>PRK07682 hypothetical protein; Validated Back     alignment and domain information
>KOG1549|consensus Back     alignment and domain information
>PRK07046 aminotransferase; Validated Back     alignment and domain information
>KOG1357|consensus Back     alignment and domain information
>PRK06173 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK09082 methionine aminotransferase; Validated Back     alignment and domain information
>PRK03158 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>TIGR00508 bioA adenosylmethionine-8-amino-7-oxononanoate transaminase Back     alignment and domain information
>PRK04781 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>COG3033 TnaA Tryptophanase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06917 hypothetical protein; Provisional Back     alignment and domain information
>PRK08363 alanine aminotransferase; Validated Back     alignment and domain information
>PRK06209 glutamate-1-semialdehyde 2,1-aminomutase; Provisional Back     alignment and domain information
>PRK08153 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>KOG0634|consensus Back     alignment and domain information
>PF03841 SelA: L-seryl-tRNA selenium transferase; InterPro: IPR018319 In prokaryotes, the incorporation of selenocysteine as the 21st amino acid, encoded by TGA, requires several elements: SelC is the tRNA itself, SelD acts as a donor of reduced selenium, SelA modifies a serine residue on SelC into selenocysteine, and SelB is a selenocysteine-specific translation elongation factor Back     alignment and domain information
>PRK06938 diaminobutyrate--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>PRK07483 hypothetical protein; Provisional Back     alignment and domain information
>COG0156 BioF 7-keto-8-aminopelargonate synthetase and related enzymes [Coenzyme metabolism] Back     alignment and domain information
>PRK09265 aminotransferase AlaT; Validated Back     alignment and domain information
>PRK07505 hypothetical protein; Provisional Back     alignment and domain information
>KOG3843|consensus Back     alignment and domain information
>PRK08742 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>TIGR03251 LAT_fam L-lysine 6-transaminase Back     alignment and domain information
>COG0001 HemL Glutamate-1-semialdehyde aminotransferase [Coenzyme metabolism] Back     alignment and domain information
>PLN00143 tyrosine/nicotianamine aminotransferase; Provisional Back     alignment and domain information
>PRK12414 putative aminotransferase; Provisional Back     alignment and domain information
>PRK08297 L-lysine aminotransferase; Provisional Back     alignment and domain information
>KOG2467|consensus Back     alignment and domain information
>PRK06931 diaminobutyrate--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>TIGR03588 PseC UDP-4-keto-6-deoxy-N-acetylglucosamine 4-aminotransferase Back     alignment and domain information
>PRK13238 tnaA tryptophanase/L-cysteine desulfhydrase, PLP-dependent; Provisional Back     alignment and domain information
>cd00615 Orn_deC_like Ornithine decarboxylase family Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query764
3rbf_A 480 Crystal Structure Of Human Aromatic L-Amino Acid De 1e-107
3rch_A 480 Crystal Structure Of Human Aromatic L-Amino Acid De 1e-106
3k40_A 475 Crystal Structure Of Drosophila 3,4-Dihydroxyphenyl 1e-106
1js3_A 486 Crystal Structure Of Dopa Decarboxylase In Complex 1e-102
4e1o_A 481 Human Histidine Decarboxylase Complex With Histidin 7e-97
3vp6_A 511 Structural Characterization Of Glutamic Acid Decarb 2e-22
2okj_A 504 The X-Ray Crystal Structure Of The 67kda Isoform Of 2e-22
2jis_A 515 Human Cysteine Sulfinic Acid Decarboxylase (Csad) I 3e-22
2okk_A 497 The X-Ray Crystal Structure Of The 65kda Isoform Of 2e-20
2qma_A 497 Crystal Structure Of Glutamate Decarboxylase Domain 9e-14
3f9t_A 397 Crystal Structure Of L-tyrosine Decarboxylase Mfna 2e-06
>pdb|3RBF|A Chain A, Crystal Structure Of Human Aromatic L-Amino Acid Decarboxylase (Aadc) In The Apo Form Length = 480 Back     alignment and structure 
Iteration: 1

 Score =  386 bits (991), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 177/311 (56%), Positives = 232/311 (74%)
Query: 454 EFREFGKAAIDFIADYVDNIRERPVLPSVEPGYLASLVPGEMPEEGEDWRHIMRDMNTVI 513
           EFR  GK  +D++A+Y++ I  R V P VEPGYL  L+P   P+E + +  I+ D+  +I
Sbjct: 5   EFRRRGKEMVDYVANYMEGIEGRQVYPDVEPGYLRPLIPAAAPQEPDTFEDIINDVEKII 64
Query: 514 MPGITHWQSPQFNAYFPTGSSYPSIVGDMLSGAFGLIGFSWLSSPACTELEVLVMNWLGK 573
           MPG+THW SP F AYFPT SSYP+++ DML GA G IGFSW +SPACTELE ++M+WLGK
Sbjct: 65  MPGVTHWHSPYFFAYFPTASSYPAMLADMLCGAIGCIGFSWAASPACTELETVMMDWLGK 124
Query: 574 ALGLPEEFLNCSPGPGGGIIQSTASEATLVSILVAKRKMINHWQSKNPSLTENDIRNKLV 633
            L LP+ FLN   G GGG+IQ +ASEATLV++L A+ K+I+  Q+ +P LT+  I  KLV
Sbjct: 125 MLELPKAFLNEKAGEGGGVIQGSASEATLVALLAARTKVIHRLQAASPELTQAAIMEKLV 184
Query: 634 AYTSDQSNSSVEKSAIIGDVPVRQLRSDDNGVLRGDALLTAVKEDLAKGLIPCCLIATLG 693
           AY+SDQ++SSVE++ +IG V ++ + SD N  +R  AL  A++ D A GLIP  ++ATLG
Sbjct: 185 AYSSDQAHSSVERAGLIGGVKLKAIPSDGNFAMRASALQEALERDKAAGLIPFFMVATLG 244
Query: 694 TTGTCAFDNLEELGPICQEYNIWLHVDAAYAGSALLLPEYAHLKRGLEYVDSFDFNTHKW 753
           TT  C+FDNL E+GPIC + +IWLHVDAAYAGSA + PE+ HL  G+E+ DSF+FN HKW
Sbjct: 245 TTTCCSFDNLLEVGPICNKEDIWLHVDAAYAGSAFICPEFRHLLNGVEFADSFNFNPHKW 304
Query: 754 LLVNFDCSAMW 764
           LLVNFDCSAMW
Sbjct: 305 LLVNFDCSAMW 315
>pdb|3RCH|A Chain A, Crystal Structure Of Human Aromatic L-Amino Acid Decarboxylase (Aadc) In The Open Conformation With Llp And Plp Bound To Chain-A And Chain- B Respectively Length = 480 Back     alignment and structure
>pdb|3K40|A Chain A, Crystal Structure Of Drosophila 3,4-Dihydroxyphenylalanine Decarboxylase Length = 475 Back     alignment and structure
>pdb|1JS3|A Chain A, Crystal Structure Of Dopa Decarboxylase In Complex With The Inhibitor Carbidopa Length = 486 Back     alignment and structure
>pdb|4E1O|A Chain A, Human Histidine Decarboxylase Complex With Histidine Methyl Ester (Hme) Length = 481 Back     alignment and structure
>pdb|3VP6|A Chain A, Structural Characterization Of Glutamic Acid Decarboxylase; Insights Into The Mechanism Of Autoinactivation Length = 511 Back     alignment and structure
>pdb|2OKJ|A Chain A, The X-Ray Crystal Structure Of The 67kda Isoform Of Glutamic Acid Decarboxylase (Gad67) Length = 504 Back     alignment and structure
>pdb|2JIS|A Chain A, Human Cysteine Sulfinic Acid Decarboxylase (Csad) In Complex With Plp. Length = 515 Back     alignment and structure
>pdb|2OKK|A Chain A, The X-Ray Crystal Structure Of The 65kda Isoform Of Glutamic Acid Decarboxylase (Gad65) Length = 497 Back     alignment and structure
>pdb|2QMA|A Chain A, Crystal Structure Of Glutamate Decarboxylase Domain Of Diaminobutyrate-Pyruvate Transaminase And L-2,4-Diaminobutyrate Decarboxylase From Vibrio Parahaemolyticus Length = 497 Back     alignment and structure
>pdb|3F9T|A Chain A, Crystal Structure Of L-tyrosine Decarboxylase Mfna (ec 4.1.1.25) (np_247014.1) From Methanococcus Jannaschii At 2.11 A Resolution Length = 397 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query764
1js3_A 486 DDC;, DOPA decarboxylase; carbidopa, parkinson'S d 1e-154
1js3_A486 DDC;, DOPA decarboxylase; carbidopa, parkinson'S d 8e-49
4e1o_A 481 HDC, histidine decarboxylase; lyase; HET: PLP PVH; 1e-153
4e1o_A481 HDC, histidine decarboxylase; lyase; HET: PLP PVH; 4e-49
3k40_A 475 Aromatic-L-amino-acid decarboxylase; PLP dependent 1e-152
3k40_A475 Aromatic-L-amino-acid decarboxylase; PLP dependent 6e-50
2okj_A 504 Glutamate decarboxylase 1; PLP-dependent decarboxy 1e-138
2okj_A504 Glutamate decarboxylase 1; PLP-dependent decarboxy 8e-40
2qma_A 497 Diaminobutyrate-pyruvate transaminase and L-2,4- d 1e-134
2qma_A497 Diaminobutyrate-pyruvate transaminase and L-2,4- d 7e-44
2jis_A 515 Cysteine sulfinic acid decarboxylase; pyridoxal ph 1e-132
2jis_A515 Cysteine sulfinic acid decarboxylase; pyridoxal ph 4e-40
3mc6_A 497 Sphingosine-1-phosphate lyase; carboxy-lyase activ 6e-30
3mc6_A497 Sphingosine-1-phosphate lyase; carboxy-lyase activ 3e-08
3mad_A 514 Sphingosine-1-phosphate lyase; carboxy-lyase activ 3e-29
3mad_A514 Sphingosine-1-phosphate lyase; carboxy-lyase activ 1e-08
2z67_A 456 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 1e-28
2z67_A456 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 2e-05
3f9t_A 397 TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L 3e-27
3f9t_A397 TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L 5e-06
3hbx_A 502 GAD 1, glutamate decarboxylase 1; calmodulin-bindi 8e-19
2dgk_A 452 GAD-beta, GADB, glutamate decarboxylase beta; gadb 3e-16
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-04
3bc8_A 450 O-phosphoseryl-tRNA(SEC) selenium transferase; dis 3e-07
3hl2_A 501 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 7e-07
1ax4_A 467 Tryptophanase; tryptophan biosynthesis, tryptophan 4e-06
2oqx_A 467 Tryptophanase; lyase, pyridoxal phosphate, tryptop 4e-04
>1js3_A DDC;, DOPA decarboxylase; carbidopa, parkinson'S disease, vitamin; HET: PLP 142; 2.25A {Sus scrofa} SCOP: c.67.1.6 PDB: 1js6_A* 3rch_A* 3rbl_A 3rbf_A* Length = 486 Back     alignment and structure
 Score =  457 bits (1177), Expect = e-154
 Identities = 174/312 (55%), Positives = 229/312 (73%)

Query: 453 EEFREFGKAAIDFIADYVDNIRERPVLPSVEPGYLASLVPGEMPEEGEDWRHIMRDMNTV 512
            +FR  GK  +D++ADY++ I  R V P V+PGYL  L+P   P+E + +  I++D+  +
Sbjct: 4   SDFRRRGKEMVDYMADYLEGIEGRQVYPDVQPGYLRPLIPATAPQEPDTFEDILQDVEKI 63

Query: 513 IMPGITHWQSPQFNAYFPTGSSYPSIVGDMLSGAFGLIGFSWLSSPACTELEVLVMNWLG 572
           IMPG+THW SP F AYFPT SSYP+++ DML GA G IGFSW +SPACTELE ++M+WLG
Sbjct: 64  IMPGVTHWHSPYFFAYFPTASSYPAMLADMLCGAIGCIGFSWAASPACTELETVMMDWLG 123

Query: 573 KALGLPEEFLNCSPGPGGGIIQSTASEATLVSILVAKRKMINHWQSKNPSLTENDIRNKL 632
           K L LPE FL    G GGG+IQ +ASEATLV++L A+ K++   Q+ +P LT+  +  KL
Sbjct: 124 KMLQLPEAFLAGEAGEGGGVIQGSASEATLVALLAARTKVVRRLQAASPGLTQGAVLEKL 183

Query: 633 VAYTSDQSNSSVEKSAIIGDVPVRQLRSDDNGVLRGDALLTAVKEDLAKGLIPCCLIATL 692
           VAY SDQ++SSVE++ +IG V ++ + SD    +R  AL  A++ D A GLIP  ++ATL
Sbjct: 184 VAYASDQAHSSVERAGLIGGVKLKAIPSDGKFAMRASALQEALERDKAAGLIPFFVVATL 243

Query: 693 GTTGTCAFDNLEELGPICQEYNIWLHVDAAYAGSALLLPEYAHLKRGLEYVDSFDFNTHK 752
           GTT  C+FDNL E+GPIC E +IWLHVDAAYAGSA + PE+ HL  G+E+ DSF+FN HK
Sbjct: 244 GTTSCCSFDNLLEVGPICHEEDIWLHVDAAYAGSAFICPEFRHLLNGVEFADSFNFNPHK 303

Query: 753 WLLVNFDCSAMW 764
           WLLVNFDCSAMW
Sbjct: 304 WLLVNFDCSAMW 315
>1js3_A DDC;, DOPA decarboxylase; carbidopa, parkinson'S disease, vitamin; HET: PLP 142; 2.25A {Sus scrofa} SCOP: c.67.1.6 PDB: 1js6_A* 3rch_A* 3rbl_A 3rbf_A* Length = 486 Back     alignment and structure
>4e1o_A HDC, histidine decarboxylase; lyase; HET: PLP PVH; 1.80A {Homo sapiens} Length = 481 Back     alignment and structure
>4e1o_A HDC, histidine decarboxylase; lyase; HET: PLP PVH; 1.80A {Homo sapiens} Length = 481 Back     alignment and structure
>3k40_A Aromatic-L-amino-acid decarboxylase; PLP dependent protein, alpha beta protein, alternative splicing, catecholamine biosynthesis, lyase; HET: LLP; 1.75A {Drosophila melanogaster} Length = 475 Back     alignment and structure
>3k40_A Aromatic-L-amino-acid decarboxylase; PLP dependent protein, alpha beta protein, alternative splicing, catecholamine biosynthesis, lyase; HET: LLP; 1.75A {Drosophila melanogaster} Length = 475 Back     alignment and structure
>2okj_A Glutamate decarboxylase 1; PLP-dependent decarboxylase, lyase; HET: LLP PLZ; 2.30A {Homo sapiens} PDB: 2okk_A* Length = 504 Back     alignment and structure
>2okj_A Glutamate decarboxylase 1; PLP-dependent decarboxylase, lyase; HET: LLP PLZ; 2.30A {Homo sapiens} PDB: 2okk_A* Length = 504 Back     alignment and structure
>2qma_A Diaminobutyrate-pyruvate transaminase and L-2,4- diaminobutyrate decarboxylase; structural genomics, APC91511.1, glutamate decarboxylase; HET: MSE; 1.81A {Vibrio parahaemolyticus} Length = 497 Back     alignment and structure
>2qma_A Diaminobutyrate-pyruvate transaminase and L-2,4- diaminobutyrate decarboxylase; structural genomics, APC91511.1, glutamate decarboxylase; HET: MSE; 1.81A {Vibrio parahaemolyticus} Length = 497 Back     alignment and structure
>2jis_A Cysteine sulfinic acid decarboxylase; pyridoxal phosphate, alternative splicing, pyridoxal phosphate (PLP), structural genomics consortium (SGC); HET: PLP; 1.6A {Homo sapiens} Length = 515 Back     alignment and structure
>2jis_A Cysteine sulfinic acid decarboxylase; pyridoxal phosphate, alternative splicing, pyridoxal phosphate (PLP), structural genomics consortium (SGC); HET: PLP; 1.6A {Homo sapiens} Length = 515 Back     alignment and structure
>3mc6_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxyl phosphate; HET: LLP; 3.15A {Saccharomyces cerevisiae} Length = 497 Back     alignment and structure
>3mc6_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxyl phosphate; HET: LLP; 3.15A {Saccharomyces cerevisiae} Length = 497 Back     alignment and structure
>3mad_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxal phosphate; HET: LLP; 2.00A {Symbiobacterium thermophilum} PDB: 3maf_A* 3mau_A* 3mbb_A* Length = 514 Back     alignment and structure
>3mad_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxal phosphate; HET: LLP; 2.00A {Symbiobacterium thermophilum} PDB: 3maf_A* 3mau_A* 3mbb_A* Length = 514 Back     alignment and structure
>2z67_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine biosynthesis, seven-stranded BETE-strand, PYR 5'-phosphate; HET: PLP; 2.50A {Methanococcus maripaludis} SCOP: c.67.1.9 Length = 456 Back     alignment and structure
>2z67_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine biosynthesis, seven-stranded BETE-strand, PYR 5'-phosphate; HET: PLP; 2.50A {Methanococcus maripaludis} SCOP: c.67.1.9 Length = 456 Back     alignment and structure
>3f9t_A TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L-tyrosine decarboxylase MFNA (EC 4.1.1.25), ST genomics; HET: PLP; 2.11A {Methanocaldococcus jannaschii} Length = 397 Back     alignment and structure
>3f9t_A TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L-tyrosine decarboxylase MFNA (EC 4.1.1.25), ST genomics; HET: PLP; 2.11A {Methanocaldococcus jannaschii} Length = 397 Back     alignment and structure
>3hbx_A GAD 1, glutamate decarboxylase 1; calmodulin-binding, lyase, pyridoxal phosphate; HET: LLP; 2.67A {Arabidopsis thaliana} Length = 502 Back     alignment and structure
>2dgk_A GAD-beta, GADB, glutamate decarboxylase beta; gadbd1-14, autoinhibition, substituted aldamine, lyase; HET: PLP; 1.90A {Escherichia coli} PDB: 2dgm_A* 1pmo_A* 2dgl_A* 1pmm_A* 3fz6_A* 3fz7_A 3fz8_A* 1xey_A* Length = 452 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3bc8_A O-phosphoseryl-tRNA(SEC) selenium transferase; disorder-order transition, phosphate-loop, pyridoxal phospha selenocysteine synthase (SECS, sepsecs); HET: LLP; 1.65A {Mus musculus} SCOP: c.67.1.9 PDB: 3bca_A* 3bcb_A* Length = 450 Back     alignment and structure
>3hl2_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine, sepsecs, protein-RNA complex, alternative splicing, cytoplasm, protein biosynthesis, pyridoxal phosphate, selenium; HET: PLR SEP; 2.81A {Homo sapiens} Length = 501 Back     alignment and structure
>1ax4_A Tryptophanase; tryptophan biosynthesis, tryptophan indole-lyase, pyridoxal 5'-phosphate, monovalent cation binding site; HET: LLP; 2.10A {Proteus vulgaris} SCOP: c.67.1.2 Length = 467 Back     alignment and structure
>2oqx_A Tryptophanase; lyase, pyridoxal phosphate, tryptophan catabolism; HET: CME EPE; 1.90A {Escherichia coli} SCOP: c.67.1.2 PDB: 2c44_A 2v1p_A* 2v0y_A* Length = 467 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query764
4e1o_A 481 HDC, histidine decarboxylase; lyase; HET: PLP PVH; 100.0
3k40_A 475 Aromatic-L-amino-acid decarboxylase; PLP dependent 100.0
3vp6_A 511 Glutamate decarboxylase 1; catalytic loop SWAP, ly 100.0
1js3_A 486 DDC;, DOPA decarboxylase; carbidopa, parkinson'S d 100.0
2okj_A 504 Glutamate decarboxylase 1; PLP-dependent decarboxy 100.0
2jis_A 515 Cysteine sulfinic acid decarboxylase; pyridoxal ph 100.0
2qma_A 497 Diaminobutyrate-pyruvate transaminase and L-2,4- d 100.0
2dgk_A 452 GAD-beta, GADB, glutamate decarboxylase beta; gadb 100.0
3k40_A475 Aromatic-L-amino-acid decarboxylase; PLP dependent 100.0
4e1o_A481 HDC, histidine decarboxylase; lyase; HET: PLP PVH; 100.0
3vp6_A511 Glutamate decarboxylase 1; catalytic loop SWAP, ly 99.97
3hbx_A 502 GAD 1, glutamate decarboxylase 1; calmodulin-bindi 99.97
3bc8_A 450 O-phosphoseryl-tRNA(SEC) selenium transferase; dis 99.97
1js3_A486 DDC;, DOPA decarboxylase; carbidopa, parkinson'S d 99.97
2okj_A504 Glutamate decarboxylase 1; PLP-dependent decarboxy 99.96
2qma_A497 Diaminobutyrate-pyruvate transaminase and L-2,4- d 99.96
2jis_A515 Cysteine sulfinic acid decarboxylase; pyridoxal ph 99.96
3mc6_A 497 Sphingosine-1-phosphate lyase; carboxy-lyase activ 99.95
3mad_A 514 Sphingosine-1-phosphate lyase; carboxy-lyase activ 99.95
2z67_A 456 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 99.94
3f9t_A 397 TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L 99.91
2dgk_A452 GAD-beta, GADB, glutamate decarboxylase beta; gadb 99.9
3mad_A514 Sphingosine-1-phosphate lyase; carboxy-lyase activ 99.88
3hbx_A502 GAD 1, glutamate decarboxylase 1; calmodulin-bindi 99.87
1wyu_B 474 Glycine dehydrogenase subunit 2 (P-protein); alpha 99.87
3mc6_A497 Sphingosine-1-phosphate lyase; carboxy-lyase activ 99.86
3hl2_A 501 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 99.82
3nnk_A 411 Ureidoglycine-glyoxylate aminotransferase; PLP-dep 99.73
3isl_A 416 Purine catabolism protein PUCG; pyridoxalphosphate 99.72
4hvk_A 382 Probable cysteine desulfurase 2; transferase and I 99.72
2yrr_A 353 Aminotransferase, class V; structural genomics, NP 99.72
4eb5_A 382 Probable cysteine desulfurase 2; scaffold, transfe 99.71
2dr1_A 386 PH1308 protein, 386AA long hypothetical serine ami 99.71
3lvm_A 423 Cysteine desulfurase; structural genomics, montrea 99.7
2z9v_A 392 Aspartate aminotransferase; pyridoxamine, pyruvate 99.7
3vax_A 400 Putative uncharacterized protein DNDA; desulfurase 99.7
2bkw_A 385 Alanine-glyoxylate aminotransferase 1; analine-gly 99.69
3bc8_A450 O-phosphoseryl-tRNA(SEC) selenium transferase; dis 99.69
3a9z_A 432 Selenocysteine lyase; PLP, cytoplasm, pyridoxal ph 99.68
1vjo_A 393 Alanine--glyoxylate aminotransferase; 17130350, AL 99.68
1eg5_A 384 Aminotransferase; PLP-dependent enzymes, iron-sulf 99.68
3kgw_A 393 Alanine-glyoxylate aminotransferase; AAH25799.1, p 99.67
3zrp_A 384 Serine-pyruvate aminotransferase (AGXT); HET: PLP; 99.67
2huf_A 393 Alanine glyoxylate aminotransferase; alpha and bet 99.67
1svv_A 359 Threonine aldolase; structural genomics, structura 99.65
2e7j_A 371 SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-st 99.65
1iug_A 352 Putative aspartate aminotransferase; wild type, py 99.65
3ffr_A 362 Phosphoserine aminotransferase SERC; structural ge 99.65
2ch1_A 396 3-hydroxykynurenine transaminase; PLP-enzyme, kynu 99.65
1wyu_A 438 Glycine dehydrogenase (decarboxylating) subunit 1; 99.64
1t3i_A 420 Probable cysteine desulfurase; PLP-binding enzyme, 99.64
1v72_A 356 Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2 99.64
3cai_A 406 Possible aminotransferase; RV3778C; 1.80A {Mycobac 99.63
1m32_A 366 2-aminoethylphosphonate-pyruvate aminotransferase; 99.63
3e9k_A 465 Kynureninase; kynurenine-L-hydrolase, kynurenine h 99.62
1kmj_A 406 Selenocysteine lyase; persulfide perselenide NIFS 99.61
3f0h_A 376 Aminotransferase; RER070207000802, structural geno 99.61
2vyc_A 755 Biodegradative arginine decarboxylase; pyridoxal p 99.58
2x3l_A 446 ORN/Lys/Arg decarboxylase family protein; lyase; H 99.58
1elu_A 390 L-cysteine/L-cystine C-S lyase; FES cluster biosyn 99.56
2z67_A456 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 99.53
1j32_A 388 Aspartate aminotransferase; HET: PLP; 2.10A {Phorm 99.53
2w8t_A 427 SPT, serine palmitoyltransferase; HET: LLP; 1.25A 99.53
2fnu_A 375 Aminotransferase; protein-product complex, structu 99.51
1qz9_A 416 Kynureninase; kynurenine, tryptophan, PLP, vitamin 99.5
3dzz_A 391 Putative pyridoxal 5'-phosphate-dependent C-S LYA; 99.5
1gd9_A 389 Aspartate aminotransferase; pyridoxal enzyme, temp 99.49
3frk_A 373 QDTB; aminotransferase, sugar-modification, natura 99.48
1ax4_A 467 Tryptophanase; tryptophan biosynthesis, tryptophan 99.48
1b9h_A 388 AHBA synthase, protein (3-amino-5-hydroxybenzoic a 99.48
3ke3_A 379 Putative serine-pyruvate aminotransferase; structu 99.48
1o4s_A 389 Aspartate aminotransferase; TM1255, structural gen 99.47
3f9t_A397 TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L 99.46
3tqx_A 399 2-amino-3-ketobutyrate coenzyme A ligase; energy m 99.46
2c81_A 418 Glutamine-2-deoxy-scyllo-inosose aminotransferase; 99.46
3nyt_A 367 Aminotransferase WBPE; PLP binding, nucleotide-sug 99.46
3uwc_A 374 Nucleotide-sugar aminotransferase; lipopolysacchar 99.46
1rv3_A 483 Serine hydroxymethyltransferase, cytosolic; one-ca 99.46
2rfv_A 398 Methionine gamma-lyase; pyridoxal-5'-phosphate, PL 99.46
3nra_A 407 Aspartate aminotransferase; structural genomics, j 99.45
1c4k_A 730 Protein (ornithine decarboxylase); lyase; HET: PLP 99.45
3dr4_A 391 Putative perosamine synthetase; deoxysugar, pyrido 99.44
2gb3_A 409 Aspartate aminotransferase; TM1698, structural gen 99.44
2zc0_A 407 Alanine glyoxylate transaminase; alanine:glyoxylat 99.44
2cb1_A 412 O-acetyl homoserine sulfhydrylase; PLP enzyme, lya 99.44
1o69_A 394 Aminotransferase; structural genomics, unknown fun 99.43
2o0r_A 411 RV0858C (N-succinyldiaminopimelate aminotransfera; 99.43
1u08_A 386 Hypothetical aminotransferase YBDL; alpha beta pro 99.43
3a2b_A 398 Serine palmitoyltransferase; vitamin B6-dependent 99.43
2oqx_A 467 Tryptophanase; lyase, pyridoxal phosphate, tryptop 99.42
1xi9_A 406 Putative transaminase; alanine aminotransferase, s 99.42
1fc4_A 401 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino 99.42
3qm2_A 386 Phosphoserine aminotransferase; structural genomic 99.42
1v2d_A 381 Glutamine aminotransferase; PLP, riken structural 99.42
2a7v_A 490 Serine hydroxymethyltransferase; structural genomi 99.42
3m5u_A 361 Phosphoserine aminotransferase; alpha-beta half sa 99.41
3b8x_A 390 WBDK, pyridoxamine 5-phosphate-dependent dehydrase 99.4
3hl2_A501 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 99.4
1gc0_A 398 Methionine gamma-lyase; pyridoxal-5'-phosphate; HE 99.4
4dq6_A 391 Putative pyridoxal phosphate-dependent transferas; 99.39
3e77_A 377 Phosphoserine aminotransferase; SERC, PLP, structu 99.39
3n0l_A 417 Serine hydroxymethyltransferase; alpha beta class, 99.39
3cq5_A 369 Histidinol-phosphate aminotransferase; PLP, PMP, a 99.39
2vi8_A 405 Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, 99.38
3g0t_A 437 Putative aminotransferase; NP_905498.1, putative a 99.38
3qhx_A 392 Cystathionine gamma-synthase METB (CGS); structura 99.38
3l8a_A 421 METC, putative aminotransferase, probable beta-cys 99.37
3kax_A 383 Aminotransferase, classes I and II; PLP, C-S lyase 99.37
1bs0_A 384 Protein (8-amino-7-oxonanoate synthase); PLP-depen 99.36
3acz_A 389 Methionine gamma-lyase; L-methionine; HET: LLP; 1. 99.36
3ly1_A 354 Putative histidinol-phosphate aminotransferase; st 99.36
2ctz_A 421 O-acetyl-L-homoserine sulfhydrylase; crystal, O-ac 99.36
3lws_A 357 Aromatic amino acid beta-eliminating lyase/threoni 99.35
3euc_A 367 Histidinol-phosphate aminotransferase 2; YP_297314 99.35
3piu_A 435 1-aminocyclopropane-1-carboxylate synthase; fruit 99.35
1yiz_A 429 Kynurenine aminotransferase; glutamine transaminas 99.35
1c7n_A 399 Cystalysin; transferase, aminotransferase, pyridox 99.34
1jg8_A 347 L-ALLO-threonine aldolase; glycine biosynthesis, p 99.34
2z61_A 370 Probable aspartate aminotransferase 2; amino acid 99.34
1vp4_A 425 Aminotransferase, putative; structural genomics, j 99.34
3h14_A 391 Aminotransferase, classes I and II; YP_167802.1, S 99.34
2dkj_A 407 Serine hydroxymethyltransferase; PLP dependent enz 99.34
2oga_A 399 Transaminase; PLP-dependent enzyme, desosamine, de 99.34
1iay_A 428 ACC synthase 2, 1-aminocyclopropane-1-carboxylate 99.34
2ez2_A 456 Beta-tyrosinase, tyrosine phenol-lyase; PLP-depend 99.33
3ele_A 398 Amino transferase; RER070207001803, structural gen 99.33
1mdo_A 393 ARNB aminotransferase; type 1 aminotransferase fol 99.33
1d2f_A 390 MALY protein; aminotransferase fold, large PLP-bin 99.33
3pj0_A 359 LMO0305 protein; structural genomics, joint center 99.31
1e5e_A 404 MGL, methionine gamma-lyase; methionine biosynthes 99.31
1cs1_A 386 CGS, protein (cystathionine gamma-synthase); lyase 99.31
3ju7_A 377 Putative PLP-dependent aminotransferase; NP_978343 99.3
3gbx_A 420 Serine hydroxymethyltransferase; structural genomi 99.3
1w23_A 360 Phosphoserine aminotransferase; pyridoxal-5'-phosp 99.29
3ffh_A 363 Histidinol-phosphate aminotransferase; APC88260, l 99.29
3tcm_A 500 Alanine aminotransferase 2; pyridoxal phosphate (P 99.29
2zyj_A 397 Alpha-aminodipate aminotransferase; alpha-aminoadi 99.29
3n75_A 715 LDC, lysine decarboxylase, inducible; pyridoxal-5' 99.29
2x5d_A 412 Probable aminotransferase; HET: LLP PLP; 2.25A {Ps 99.29
1qgn_A 445 Protein (cystathionine gamma-synthase); methionine 99.28
1pff_A 331 Methionine gamma-lyase; homocysteine; 2.50A {Trich 99.28
1b5p_A 385 Protein (aspartate aminotransferase); pyridoxal en 99.28
3fsl_A 397 Aromatic-amino-acid aminotransferase; tyrosine ami 99.28
2po3_A 424 4-dehydrase; external aldimine, PLP, aminotransfer 99.27
2dou_A 376 Probable N-succinyldiaminopimelate aminotransfera; 99.27
1vef_A 395 Acetylornithine/acetyl-lysine aminotransferase; PL 99.27
3ndn_A 414 O-succinylhomoserine sulfhydrylase; seattle struct 99.27
3kki_A 409 CAI-1 autoinducer synthase; quorum sensing, CQSA, 99.27
3aow_A 448 Putative uncharacterized protein PH0207; protein-P 99.27
3ri6_A 430 O-acetylhomoserine sulfhydrylase; PYR 5'-phosphate 99.26
2fyf_A 398 PSAT, phosphoserine aminotransferase; PLP-dependen 99.26
3fdb_A 377 Beta C-S lyase, putative PLP-dependent beta-cystat 99.26
3ezs_A 376 Aminotransferase ASPB; NP_207418.1, structural gen 99.26
3get_A 365 Histidinol-phosphate aminotransferase; NP_281508.1 99.26
3b46_A 447 Aminotransferase BNA3; kynurenine aminotransferase 99.26
3op7_A 375 Aminotransferase class I and II; PLP-dependent tra 99.26
3ftb_A 361 Histidinol-phosphate aminotransferase; structural 99.25
3i16_A 427 Aluminum resistance protein; YP_878183.1, carbon-s 99.25
1bw0_A 416 TAT, protein (tyrosine aminotransferase); tyrosine 99.25
2o1b_A 404 Aminotransferase, class I; aminotrasferase; HET: P 99.25
2c0r_A 362 PSAT, phosphoserine aminotransferase; pyridoxal-5' 99.25
3ecd_A 425 Serine hydroxymethyltransferase 2; ssgcid, decode, 99.25
3jtx_A 396 Aminotransferase; NP_283882.1, structural genomics 99.24
2bwn_A 401 5-aminolevulinate synthase; tetrapyrrole biosynthe 99.24
3e2y_A 410 Kynurenine-oxoglutarate transaminase 3; alpha beta 99.23
4f4e_A 420 Aromatic-amino-acid aminotransferase; ssgcid, stru 99.23
1ibj_A 464 CBL, cystathionine beta-lyase; PLP-dependent enzym 99.23
2fq6_A 415 Cystathionine beta-lyase; protein-inhibitor comple 99.23
3fvs_A 422 Kynurenine--oxoglutarate transaminase 1; alpha bet 99.22
3jzl_A 409 Putative cystathionine beta-lyase involved in ALU 99.22
3dyd_A 427 Tyrosine aminotransferase; PLP, SGC, structural ge 99.2
3ht4_A 431 Aluminum resistance protein; lyase, putative cysta 99.2
2ord_A 397 Acoat, acetylornithine aminotransferase; TM1785, a 99.18
3h7f_A 447 Serine hydroxymethyltransferase 1; cytoplasm, one- 99.18
1ajs_A 412 Aspartate aminotransferase; PIG, in the presence o 99.17
7aat_A 401 Aspartate aminotransferase; transferase(aminotrans 99.17
2ay1_A 394 Aroat, aromatic amino acid aminotransferase; HET: 99.17
3bb8_A 437 CDP-4-keto-6-deoxy-D-glucose-3-dehydrase; aspartat 99.17
2eh6_A 375 Acoat, acetylornithine aminotransferase; ARGD, str 99.16
1yaa_A 412 Aspartate aminotransferase; HET: PLP; 2.05A {Sacch 99.16
1wyu_B474 Glycine dehydrogenase subunit 2 (P-protein); alpha 99.16
3hvy_A 427 Cystathionine beta-lyase family protein, YNBB B.S 99.16
4adb_A 406 Succinylornithine transaminase; transferase, PLP e 99.15
1s0a_A 429 Adenosylmethionine-8-amino-7-oxononanoate aminotra 99.15
1n8p_A 393 Cystathionine gamma-lyase; three open alpha/beta s 99.15
3if2_A 444 Aminotransferase; YP_265399.1, structura genomics, 99.14
3ihj_A 498 Alanine aminotransferase 2; helix, structural geno 99.14
3nnk_A411 Ureidoglycine-glyoxylate aminotransferase; PLP-dep 99.14
3cog_A 403 Cystathionine gamma-lyase; CTH, PLP, propargylglyc 99.13
2q7w_A 396 Aspartate aminotransferase; mechanism-based inhibi 99.13
3rq1_A 418 Aminotransferase class I and II; structural genomi 99.12
3t18_A 413 Aminotransferase class I and II; PSI-biology, MCSG 99.1
3nmy_A 400 Xometc, cystathionine gamma-lyase-like protein; Cy 99.1
1lc5_A 364 COBD, L-threonine-O-3-phosphate decarboxylase; PLP 99.1
3hdo_A 360 Histidinol-phosphate aminotransferase; PSI-II, his 99.1
3p1t_A 337 Putative histidinol-phosphate aminotransferase; PL 99.09
3e9k_A465 Kynureninase; kynurenine-L-hydrolase, kynurenine h 99.08
4hvk_A382 Probable cysteine desulfurase 2; transferase and I 99.08
3meb_A 448 Aspartate aminotransferase; pyridoxal PHOS transfe 99.08
3isl_A416 Purine catabolism protein PUCG; pyridoxalphosphate 99.08
2aeu_A 374 Hypothetical protein MJ0158; selenocysteine syntha 99.08
1fg7_A 356 Histidinol phosphate aminotransferase; HISC, histi 99.07
2pb2_A 420 Acetylornithine/succinyldiaminopimelate aminotran; 99.07
3ruy_A 392 Ornithine aminotransferase; structural genomics, c 99.07
2x5f_A 430 Aspartate_tyrosine_phenylalanine pyridoxal-5' phos 99.06
1sff_A 426 4-aminobutyrate aminotransferase; enzyme complexes 99.05
1wyu_A438 Glycine dehydrogenase (decarboxylating) subunit 1; 99.05
3dxv_A 439 Alpha-amino-epsilon-caprolactam racemase; fold-TYP 99.05
3nx3_A 395 Acoat, acetylornithine aminotransferase; csgid, st 99.04
2yrr_A353 Aminotransferase, class V; structural genomics, NP 99.03
2r2n_A 425 Kynurenine/alpha-aminoadipate aminotransferase mit 99.0
3ppl_A 427 Aspartate aminotransferase; dimer, PLP-dependent t 99.0
3kgw_A393 Alanine-glyoxylate aminotransferase; AAH25799.1, p 98.99
3ez1_A 423 Aminotransferase MOCR family; YP_604413.1, struct 98.98
3zrp_A384 Serine-pyruvate aminotransferase (AGXT); HET: PLP; 98.98
2eo5_A 419 419AA long hypothetical aminotransferase; PLP enzy 98.97
1t3i_A420 Probable cysteine desulfurase; PLP-binding enzyme, 98.97
2dr1_A386 PH1308 protein, 386AA long hypothetical serine ami 98.97
3i4j_A 430 Aminotransferase, class III; structural GENOMICS,N 98.94
4eb5_A382 Probable cysteine desulfurase 2; scaffold, transfe 98.93
3b1d_A 392 Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococ 98.46
3f6t_A 533 Aspartate aminotransferase; YP_194538.1, STRU geno 98.91
1vjo_A393 Alanine--glyoxylate aminotransferase; 17130350, AL 98.91
1z7d_A 433 Ornithine aminotransferase; structural genomics co 98.91
4e77_A 429 Glutamate-1-semialdehyde 2,1-aminomutase; structur 98.91
3fq8_A 427 Glutamate-1-semialdehyde 2,1-aminomutase; drug res 98.9
3a8u_X 449 Omega-amino acid--pyruvate aminotransferase; large 98.9
1kmj_A406 Selenocysteine lyase; persulfide perselenide NIFS 98.9
3ffr_A362 Phosphoserine aminotransferase SERC; structural ge 98.89
4eu1_A 409 Mitochondrial aspartate aminotransferase; ssgcid, 98.89
2oat_A 439 Ornithine aminotransferase; 5-fluoromethylornithin 98.88
2z9v_A392 Aspartate aminotransferase; pyridoxamine, pyruvate 98.88
3l44_A 434 Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha 98.87
3k28_A 429 Glutamate-1-semialdehyde 2,1-aminomutase 2; biosyn 98.87
2huf_A393 Alanine glyoxylate aminotransferase; alpha and bet 98.86
1uu1_A 335 Histidinol-phosphate aminotransferase; histidine b 98.86
1eg5_A384 Aminotransferase; PLP-dependent enzymes, iron-sulf 98.85
3lvm_A423 Cysteine desulfurase; structural genomics, montrea 98.84
3g7q_A 417 Valine-pyruvate aminotransferase; NP_462565.1, str 98.84
2cy8_A 453 D-phgat, D-phenylglycine aminotransferase; structu 98.83
3fkd_A 350 L-threonine-O-3-phosphate decarboxylase; structura 98.83
3n5m_A 452 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 98.82
3qgu_A 449 LL-diaminopimelate aminotransferase; L-lysine, pyr 98.82
3dod_A 448 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 98.81
2ch1_A396 3-hydroxykynurenine transaminase; PLP-enzyme, kynu 98.81
1zod_A 433 DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, 98.8
3ei9_A 432 LL-diaminopimelate aminotransferase; lysine biosyn 98.8
2epj_A 434 Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy 98.79
3d6k_A 422 Putative aminotransferase; APC82464, corynebacteri 98.79
3asa_A 400 LL-diaminopimelate aminotransferase; PLP dependent 98.79
1m32_A366 2-aminoethylphosphonate-pyruvate aminotransferase; 98.78
2bkw_A385 Alanine-glyoxylate aminotransferase 1; analine-gly 98.77
3tfu_A 457 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 98.76
4a6r_A 459 Omega transaminase; transferase, PLP-binding enzym 98.76
3gju_A 460 Putative aminotransferase; pyridoxal phosphate, PL 98.75
3oks_A 451 4-aminobutyrate transaminase; ssgcid, transferase, 98.7
3hmu_A 472 Aminotransferase, class III; structural genomics, 98.7
2cjg_A 449 L-lysine-epsilon aminotransferase; internal aldimi 98.69
1elu_A390 L-cysteine/L-cystine C-S lyase; FES cluster biosyn 98.66
1ohv_A 472 4-aminobutyrate aminotransferase; PLP-dependent en 98.65
2e7j_A371 SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-st 98.65
1iug_A352 Putative aspartate aminotransferase; wild type, py 98.65
4ffc_A 453 4-aminobutyrate aminotransferase (GABT); structura 98.62
1b9h_A388 AHBA synthase, protein (3-amino-5-hydroxybenzoic a 98.62
3i5t_A 476 Aminotransferase; pyridoxal 5'-phosphate, PSI-2, N 98.61
3cai_A406 Possible aminotransferase; RV3778C; 1.80A {Mycobac 98.6
3vax_A400 Putative uncharacterized protein DNDA; desulfurase 98.58
1v72_A356 Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2 98.58
1qz9_A416 Kynureninase; kynurenine, tryptophan, PLP, vitamin 98.57
3f0h_A376 Aminotransferase; RER070207000802, structural geno 98.57
2e7u_A 424 Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy 98.57
3qm2_A386 Phosphoserine aminotransferase; structural genomic 98.55
3e77_A377 Phosphoserine aminotransferase; SERC, PLP, structu 98.51
1svv_A359 Threonine aldolase; structural genomics, structura 98.5
1j32_A388 Aspartate aminotransferase; HET: PLP; 2.10A {Phorm 98.49
3a9z_A432 Selenocysteine lyase; PLP, cytoplasm, pyridoxal ph 98.48
3dzz_A391 Putative pyridoxal 5'-phosphate-dependent C-S LYA; 98.47
3euc_A367 Histidinol-phosphate aminotransferase 2; YP_297314 98.44
2c0r_A362 PSAT, phosphoserine aminotransferase; pyridoxal-5' 98.44
3tqx_A399 2-amino-3-ketobutyrate coenzyme A ligase; energy m 98.43
3ffh_A363 Histidinol-phosphate aminotransferase; APC88260, l 98.42
3nra_A407 Aspartate aminotransferase; structural genomics, j 98.4
2fnu_A375 Aminotransferase; protein-product complex, structu 98.4
3dr4_A391 Putative perosamine synthetase; deoxysugar, pyrido 98.36
3ou5_A 490 Serine hydroxymethyltransferase, mitochondrial; st 98.36
2bwn_A401 5-aminolevulinate synthase; tetrapyrrole biosynthe 98.36
2zc0_A407 Alanine glyoxylate transaminase; alanine:glyoxylat 98.34
3uwc_A374 Nucleotide-sugar aminotransferase; lipopolysacchar 98.33
3m5u_A361 Phosphoserine aminotransferase; alpha-beta half sa 98.29
2zy4_A 546 L-aspartate beta-decarboxylase; pyridoxal 5'-phosp 98.28
1w23_A360 Phosphoserine aminotransferase; pyridoxal-5'-phosp 98.28
3b8x_A390 WBDK, pyridoxamine 5-phosphate-dependent dehydrase 98.28
4dq6_A391 Putative pyridoxal phosphate-dependent transferas; 98.28
2oga_A399 Transaminase; PLP-dependent enzyme, desosamine, de 98.28
1o69_A394 Aminotransferase; structural genomics, unknown fun 98.28
2fyf_A398 PSAT, phosphoserine aminotransferase; PLP-dependen 98.28
2w8t_A427 SPT, serine palmitoyltransferase; HET: LLP; 1.25A 98.27
3dyd_A427 Tyrosine aminotransferase; PLP, SGC, structural ge 98.24
3ke3_A379 Putative serine-pyruvate aminotransferase; structu 98.22
2vyc_A755 Biodegradative arginine decarboxylase; pyridoxal p 98.21
3ly1_A354 Putative histidinol-phosphate aminotransferase; st 98.19
3op7_A375 Aminotransferase class I and II; PLP-dependent tra 98.19
1v2d_A381 Glutamine aminotransferase; PLP, riken structural 98.18
1bw0_A416 TAT, protein (tyrosine aminotransferase); tyrosine 98.18
3l8a_A421 METC, putative aminotransferase, probable beta-cys 98.18
2c81_A418 Glutamine-2-deoxy-scyllo-inosose aminotransferase; 98.13
3frk_A373 QDTB; aminotransferase, sugar-modification, natura 98.13
2po3_A424 4-dehydrase; external aldimine, PLP, aminotransfer 98.12
3ftb_A361 Histidinol-phosphate aminotransferase; structural 98.12
1xi9_A406 Putative transaminase; alanine aminotransferase, s 98.1
2zyj_A397 Alpha-aminodipate aminotransferase; alpha-aminoadi 98.1
3piu_A435 1-aminocyclopropane-1-carboxylate synthase; fruit 98.1
3cq5_A369 Histidinol-phosphate aminotransferase; PLP, PMP, a 98.1
3k7y_A 405 Aspartate aminotransferase; aminotrans pyridoxal p 98.09
1gd9_A389 Aspartate aminotransferase; pyridoxal enzyme, temp 98.09
2dkj_A407 Serine hydroxymethyltransferase; PLP dependent enz 98.08
1vp4_A425 Aminotransferase, putative; structural genomics, j 98.08
1mdo_A393 ARNB aminotransferase; type 1 aminotransferase fol 98.08
2gb3_A409 Aspartate aminotransferase; TM1698, structural gen 98.06
3g0t_A437 Putative aminotransferase; NP_905498.1, putative a 98.05
1fc4_A401 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino 98.03
3fdb_A377 Beta C-S lyase, putative PLP-dependent beta-cystat 98.03
1iay_A428 ACC synthase 2, 1-aminocyclopropane-1-carboxylate 98.02
1c7n_A399 Cystalysin; transferase, aminotransferase, pyridox 98.01
3get_A365 Histidinol-phosphate aminotransferase; NP_281508.1 98.01
3kax_A383 Aminotransferase, classes I and II; PLP, C-S lyase 98.01
3aow_A448 Putative uncharacterized protein PH0207; protein-P 98.0
1rv3_A483 Serine hydroxymethyltransferase, cytosolic; one-ca 98.0
2vi8_A405 Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, 97.99
3gbx_A420 Serine hydroxymethyltransferase; structural genomi 97.97
2yky_A 465 Beta-transaminase; transferase; HET: PLP SFE; 1.69 97.21
1o4s_A389 Aspartate aminotransferase; TM1255, structural gen 97.95
3a2b_A398 Serine palmitoyltransferase; vitamin B6-dependent 97.94
1fg7_A356 Histidinol phosphate aminotransferase; HISC, histi 97.94
3tcm_A500 Alanine aminotransferase 2; pyridoxal phosphate (P 97.93
3n0l_A417 Serine hydroxymethyltransferase; alpha beta class, 97.93
4ao9_A 454 Beta-phenylalanine aminotransferase; HET: PLP; 1.5 97.92
2a7v_A490 Serine hydroxymethyltransferase; structural genomi 97.91
1u08_A386 Hypothetical aminotransferase YBDL; alpha beta pro 97.91
1c4k_A730 Protein (ornithine decarboxylase); lyase; HET: PLP 97.88
1bs0_A384 Protein (8-amino-7-oxonanoate synthase); PLP-depen 97.86
3p1t_A337 Putative histidinol-phosphate aminotransferase; PL 97.86
2o0r_A411 RV0858C (N-succinyldiaminopimelate aminotransfera; 97.85
3h14_A391 Aminotransferase, classes I and II; YP_167802.1, S 97.85
3kki_A409 CAI-1 autoinducer synthase; quorum sensing, CQSA, 97.85
2x3l_A446 ORN/Lys/Arg decarboxylase family protein; lyase; H 97.83
3nyt_A367 Aminotransferase WBPE; PLP binding, nucleotide-sug 97.81
3ecd_A425 Serine hydroxymethyltransferase 2; ssgcid, decode, 97.79
1d2f_A390 MALY protein; aminotransferase fold, large PLP-bin 97.79
1b5p_A385 Protein (aspartate aminotransferase); pyridoxal en 97.77
2cb1_A412 O-acetyl homoserine sulfhydrylase; PLP enzyme, lya 97.73
3ri6_A430 O-acetylhomoserine sulfhydrylase; PYR 5'-phosphate 97.71
3lws_A357 Aromatic amino acid beta-eliminating lyase/threoni 97.71
2ez2_A456 Beta-tyrosinase, tyrosine phenol-lyase; PLP-depend 97.67
3bwn_A 391 AT1G70560, L-tryptophan aminotransferase; auxin sy 97.67
3ele_A398 Amino transferase; RER070207001803, structural gen 97.66
2dou_A376 Probable N-succinyldiaminopimelate aminotransfera; 97.65
3fvs_A422 Kynurenine--oxoglutarate transaminase 1; alpha bet 97.63
1gc0_A398 Methionine gamma-lyase; pyridoxal-5'-phosphate; HE 97.62
3pj0_A359 LMO0305 protein; structural genomics, joint center 97.61
1cs1_A386 CGS, protein (cystathionine gamma-synthase); lyase 97.59
3ju7_A377 Putative PLP-dependent aminotransferase; NP_978343 97.57
1yiz_A429 Kynurenine aminotransferase; glutamine transaminas 97.57
1ax4_A467 Tryptophanase; tryptophan biosynthesis, tryptophan 97.54
1e5e_A404 MGL, methionine gamma-lyase; methionine biosynthes 97.51
2rfv_A398 Methionine gamma-lyase; pyridoxal-5'-phosphate, PL 97.51
3ihj_A498 Alanine aminotransferase 2; helix, structural geno 97.49
2z61_A370 Probable aspartate aminotransferase 2; amino acid 97.49
3hdo_A360 Histidinol-phosphate aminotransferase; PSI-II, his 97.49
3bb8_A437 CDP-4-keto-6-deoxy-D-glucose-3-dehydrase; aspartat 97.48
1qgn_A445 Protein (cystathionine gamma-synthase); methionine 97.47
1jg8_A347 L-ALLO-threonine aldolase; glycine biosynthesis, p 97.41
2r2n_A425 Kynurenine/alpha-aminoadipate aminotransferase mit 97.39
3ez1_A423 Aminotransferase MOCR family; YP_604413.1, struct 97.39
3qhx_A392 Cystathionine gamma-synthase METB (CGS); structura 97.38
4atq_A 456 4-aminobutyrate transaminase; transferase; HET: PL 97.37
1lc5_A364 COBD, L-threonine-O-3-phosphate decarboxylase; PLP 97.36
3h7f_A447 Serine hydroxymethyltransferase 1; cytoplasm, one- 97.36
3e2y_A410 Kynurenine-oxoglutarate transaminase 3; alpha beta 97.34
2x5d_A412 Probable aminotransferase; HET: LLP PLP; 2.25A {Ps 97.34
2o1b_A404 Aminotransferase, class I; aminotrasferase; HET: P 97.29
4e3q_A 473 Pyruvate transaminase; aminotransferase, transfera 97.26
3ndn_A414 O-succinylhomoserine sulfhydrylase; seattle struct 97.23
2oqx_A467 Tryptophanase; lyase, pyridoxal phosphate, tryptop 97.2
3ppl_A427 Aspartate aminotransferase; dimer, PLP-dependent t 97.19
2ctz_A421 O-acetyl-L-homoserine sulfhydrylase; crystal, O-ac 97.16
3if2_A444 Aminotransferase; YP_265399.1, structura genomics, 97.14
3rq1_A418 Aminotransferase class I and II; structural genomi 97.07
2ord_A397 Acoat, acetylornithine aminotransferase; TM1785, a 97.07
4a0g_A 831 Adenosylmethionine-8-amino-7-oxononanoate aminotra 97.06
1sff_A426 4-aminobutyrate aminotransferase; enzyme complexes 97.04
2x5f_A430 Aspartate_tyrosine_phenylalanine pyridoxal-5' phos 97.04
3fkd_A350 L-threonine-O-3-phosphate decarboxylase; structura 97.01
3ezs_A376 Aminotransferase ASPB; NP_207418.1, structural gen 97.0
3d6k_A422 Putative aminotransferase; APC82464, corynebacteri 96.96
3b46_A447 Aminotransferase BNA3; kynurenine aminotransferase 96.96
3nmy_A400 Xometc, cystathionine gamma-lyase-like protein; Cy 96.92
1uu1_A335 Histidinol-phosphate aminotransferase; histidine b 96.85
3jtx_A396 Aminotransferase; NP_283882.1, structural genomics 96.84
3b1d_A392 Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococ 95.87
1vef_A395 Acetylornithine/acetyl-lysine aminotransferase; PL 96.81
4h51_A 420 Aspartate aminotransferase; ssgcid, structural gen 96.79
1ajs_A412 Aspartate aminotransferase; PIG, in the presence o 96.78
3fsl_A397 Aromatic-amino-acid aminotransferase; tyrosine ami 96.77
3i16_A427 Aluminum resistance protein; YP_878183.1, carbon-s 96.71
2hox_A 427 ALLIIN lyase 1; cysteine sulphoxide lyase, ALLIINA 96.67
3ruy_A392 Ornithine aminotransferase; structural genomics, c 96.64
3acz_A389 Methionine gamma-lyase; L-methionine; HET: LLP; 1. 96.58
2eh6_A375 Acoat, acetylornithine aminotransferase; ARGD, str 96.56
3t18_A413 Aminotransferase class I and II; PSI-biology, MCSG 96.52
3cog_A403 Cystathionine gamma-lyase; CTH, PLP, propargylglyc 96.4
4f4e_A420 Aromatic-amino-acid aminotransferase; ssgcid, stru 96.33
3g7q_A417 Valine-pyruvate aminotransferase; NP_462565.1, str 96.3
1ibj_A464 CBL, cystathionine beta-lyase; PLP-dependent enzym 96.24
3jzl_A409 Putative cystathionine beta-lyase involved in ALU 96.17
4adb_A406 Succinylornithine transaminase; transferase, PLP e 96.12
3ei9_A432 LL-diaminopimelate aminotransferase; lysine biosyn 96.11
2eo5_A419 419AA long hypothetical aminotransferase; PLP enzy 96.03
1pff_A331 Methionine gamma-lyase; homocysteine; 2.50A {Trich 96.01
3qgu_A449 LL-diaminopimelate aminotransferase; L-lysine, pyr 96.0
2pb2_A420 Acetylornithine/succinyldiaminopimelate aminotran; 96.0
2ay1_A394 Aroat, aromatic amino acid aminotransferase; HET: 95.97
2aeu_A374 Hypothetical protein MJ0158; selenocysteine syntha 95.93
3f6t_A533 Aspartate aminotransferase; YP_194538.1, STRU geno 95.77
3dxv_A439 Alpha-amino-epsilon-caprolactam racemase; fold-TYP 95.74
1yaa_A412 Aspartate aminotransferase; HET: PLP; 2.05A {Sacch 95.68
1n8p_A393 Cystathionine gamma-lyase; three open alpha/beta s 95.58
3ht4_A431 Aluminum resistance protein; lyase, putative cysta 95.56
3hvy_A427 Cystathionine beta-lyase family protein, YNBB B.S 95.55
3nx3_A395 Acoat, acetylornithine aminotransferase; csgid, st 95.31
3n75_A715 LDC, lysine decarboxylase, inducible; pyridoxal-5' 95.23
2oat_A439 Ornithine aminotransferase; 5-fluoromethylornithin 95.18
2q7w_A396 Aspartate aminotransferase; mechanism-based inhibi 95.0
1z7d_A433 Ornithine aminotransferase; structural genomics co 94.92
2cjg_A449 L-lysine-epsilon aminotransferase; internal aldimi 94.87
3a8u_X449 Omega-amino acid--pyruvate aminotransferase; large 94.73
1zod_A433 DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, 94.64
3meb_A448 Aspartate aminotransferase; pyridoxal PHOS transfe 94.58
3l44_A434 Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha 94.46
1s0a_A429 Adenosylmethionine-8-amino-7-oxononanoate aminotra 94.42
4eu1_A409 Mitochondrial aspartate aminotransferase; ssgcid, 94.35
3asa_A400 LL-diaminopimelate aminotransferase; PLP dependent 94.33
2fq6_A415 Cystathionine beta-lyase; protein-inhibitor comple 94.3
1ohv_A472 4-aminobutyrate aminotransferase; PLP-dependent en 93.89
7aat_A401 Aspartate aminotransferase; transferase(aminotrans 93.81
3gju_A460 Putative aminotransferase; pyridoxal phosphate, PL 93.4
3hmu_A472 Aminotransferase, class III; structural genomics, 93.2
3dod_A448 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 93.1
3i4j_A430 Aminotransferase, class III; structural GENOMICS,N 92.66
3n5m_A452 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 92.56
3ou5_A490 Serine hydroxymethyltransferase, mitochondrial; st 91.75
3tfu_A457 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 91.22
3oks_A451 4-aminobutyrate transaminase; ssgcid, transferase, 91.11
3k28_A429 Glutamate-1-semialdehyde 2,1-aminomutase 2; biosyn 90.92
2epj_A434 Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy 89.8
2hox_A427 ALLIIN lyase 1; cysteine sulphoxide lyase, ALLIINA 89.45
4ffc_A453 4-aminobutyrate aminotransferase (GABT); structura 88.73
3fq8_A427 Glutamate-1-semialdehyde 2,1-aminomutase; drug res 88.32
2cy8_A453 D-phgat, D-phenylglycine aminotransferase; structu 88.14
4a6r_A459 Omega transaminase; transferase, PLP-binding enzym 87.74
4e77_A429 Glutamate-1-semialdehyde 2,1-aminomutase; structur 84.43
>4e1o_A HDC, histidine decarboxylase; lyase; HET: PLP PVH; 1.80A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=7.3e-56  Score=504.69  Aligned_cols=319  Identities=50%  Similarity=0.969  Sum_probs=295.2

Q ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHHhcCCCCCCCCCChhhHhhcCCCCCCCCCCCHHHHHHHHHHHHcCCCCCCCCCcc
Q psy13453        446 PVTPPPNEEFREFGKAAIDFIADYVDNIRERPVLPSVEPGYLASLVPGEMPEEGEDWRHIMRDMNTVIMPGITHWQSPQF  525 (764)
Q Consensus       446 ~~~~~~~~~~~~~~~~~v~~i~~y~~~~~~~~v~~~~~p~~l~~~l~~~lP~~g~~~~~il~~l~~~i~~~~~~~~~P~~  525 (764)
                      ++.+||.++||+++++++|.+++|+++++++||.+.++|+++++.++..+|++|.+++++++++.+.+.++.++|+||+|
T Consensus         2 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~p~~   81 (481)
T 4e1o_A            2 PLGSMEPEEYRERGREMVDYICQYLSTVRERRVTPDVQPGYLRAQLPESAPEDPDSWDSIFGDIERIIMPGVVHWQSPHM   81 (481)
T ss_dssp             ---CCCHHHHHHHHHHHHHHHHHHHHSGGGSCSSCCCCTTTTGGGSCSSCCSSCCCHHHHHHHHHHHTGGGCCCTTSTTB
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHhccccCCCCCCCCHHHHHHhcCCCCCCCCCCHHHHHHHHHHHHhcCCCCCCCCCe
Confidence            46789999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccccCCCCChHHHHHHHHHHhhcccCccccCCchHHHHHHHHHHHHHHHcCCCccccC-CCCCCCcEEEeCChHHHHHHH
Q psy13453        526 NAYFPTGSSYPSIVGDMLSGAFGLIGFSWLSSPACTELEVLVMNWLGKALGLPEEFLN-CSPGPGGGIIQSTASEATLVS  604 (764)
Q Consensus       526 ~~~~~~~~~~~~~lad~l~~~lN~n~~~~~~sp~~t~lE~~v~~~la~llG~p~~~~~-~~~~~~~GvfTsGgTeANl~A  604 (764)
                      |+|++++.++++++++++.+++|+|...|..+|.++++|+++++|+++++|+|.++.. ...+.++|+||+|||+||++|
T Consensus        82 ~~~~~~~~~~~~~~~~~~~~~~n~~~~~~~~~p~~~~lE~~v~~~l~~l~g~~~~~~~~~~~~~~~g~~~~ggt~an~~a  161 (481)
T 4e1o_A           82 HAYYPALTSWPSLLGDMLADAINCLGFTWASSPACTELEMNVMDWLAKMLGLPEHFLHHHPSSQGGGVLQSTVSESTLIA  161 (481)
T ss_dssp             CSSSCCCCCHHHHHHHHHHHHHCCCCSSTTTCHHHHHHHHHHHHHHHHHHTCCGGGCTTCTTCBCEEEEESCHHHHHHHH
T ss_pred             eEeCCCCCCHHHHHHHHHHHHhCcccCCcCCCcHHHHHHHHHHHHHHHHhCCChhhhccccCCCCceEEeCchHHHHHHH
Confidence            9999999999999999999999999999999999999999999999999999986532 122346899999999999999


Q ss_pred             HHHHHHHHhhhhccCCCCCccccccCceEEEecCCcchhHHHHHHhCCCceEEEecCCCCcccHHHHHHHHHHhhhcCCC
Q psy13453        605 ILVAKRKMINHWQSKNPSLTENDIRNKLVAYTSDQSNSSVEKSAIIGDVPVRQLRSDDNGVLRGDALLTAVKEDLAKGLI  684 (764)
Q Consensus       605 l~aAR~~~~~~~~~~~~~~~~~~~~~~~vi~~S~~aH~Sv~kAa~~lGl~v~~Vp~d~~g~md~~~Le~~I~~~~~~G~~  684 (764)
                      +++||++..++.+..++++.+.+..++.+||+|+.+|+|+.|++++.|.+++.||+|++|+||+++|+++|+++.++|..
T Consensus       162 l~~ar~~~~~~~~~~~~~~~~~~~~~~~~v~~s~~~H~s~~~~~~~~g~~~~~v~~~~~~~~d~~~Le~~i~~~~~~g~~  241 (481)
T 4e1o_A          162 LLAARKNKILEMKTSEPDADESSLNARLVAYASDQAHSSVEKAGLISLVKMKFLPVDDNFSLRGEALQKAIEEDKQRGLV  241 (481)
T ss_dssp             HHHHHHHHHHHHHHHCTTSCHHHHHTTEEEEEETTSCHHHHHHHHHHTCEEEEECCCTTSCCCHHHHHHHHHHHHHTTCE
T ss_pred             HHHHHHHHHHHhhhcCcccccccccCCeEEEEcCcchHHHHHHHHhCCCceEEEEcCCCCcCCHHHHHHHHHHHHhCCCC
Confidence            99999988776544445454445567889999999999999999999999999999999999999999999999889999


Q ss_pred             ceEEEEeeccCCccccccHHHHHHHHHhcCCEEEEeccccccccccchhhhhhcCCCcccEEEEcCCccCCCCcCceeeC
Q psy13453        685 PCCLIATLGTTGTCAFDNLEELGPICQEYNIWLHVDAAYAGSALLLPEYAHLKRGLEYVDSFDFNTHKWLLVNFDCSAMW  764 (764)
Q Consensus       685 p~~VvataGTT~~GaiDpl~eIa~i~~~~glwLHVDaA~Gg~~l~~~~~r~~l~gie~aDSit~d~HK~l~~P~~~g~l~  764 (764)
                      |++|++|+|||.+|++|||++|+++|++||+|+|||||||+++++++++++.+.|+++|||+++|+|||+++|++||++|
T Consensus       242 ~~~vv~~~~~t~~G~id~l~~I~~la~~~~~~lhvDaA~g~~~~~~~~~~~~~~gi~~aDsi~~~~hK~l~~p~g~g~l~  321 (481)
T 4e1o_A          242 PVFVCATLGTTGVCAFDCLSELGPICAREGLWLHIDAAYAGTAFLCPEFRGFLKGIEYADSFTFNPSKWMMVHFDCTGFW  321 (481)
T ss_dssp             EEEEEEEBSCTTTCCBCCHHHHHHHHHHHTCEEEEECTTGGGGGGSGGGGGGGTTGGGCSEEEECHHHHSSCCSSCEEEE
T ss_pred             cEEEEEecCCCCCcCcCCHHHHHHHHHHcCCeEEeehhhHHHHHhChhhHHHhcCcccCCEEEEChHHhcCCCCceEEEE
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999975
>3k40_A Aromatic-L-amino-acid decarboxylase; PLP dependent protein, alpha beta protein, alternative splicing, catecholamine biosynthesis, lyase; HET: LLP; 1.75A {Drosophila melanogaster} SCOP: c.67.1.6 Back     alignment and structure
>3vp6_A Glutamate decarboxylase 1; catalytic loop SWAP, lyase; HET: LLP HLD; 2.10A {Homo sapiens} PDB: 2okj_A* 2okk_A* Back     alignment and structure
>1js3_A DDC;, DOPA decarboxylase; carbidopa, parkinson'S disease, vitamin; HET: PLP 142; 2.25A {Sus scrofa} SCOP: c.67.1.6 PDB: 1js6_A* 3rch_A* 3rbl_A 3rbf_A* Back     alignment and structure
>2okj_A Glutamate decarboxylase 1; PLP-dependent decarboxylase, lyase; HET: LLP PLZ; 2.30A {Homo sapiens} PDB: 2okk_A* Back     alignment and structure
>2jis_A Cysteine sulfinic acid decarboxylase; pyridoxal phosphate, alternative splicing, pyridoxal phosphate (PLP), structural genomics consortium (SGC); HET: PLP; 1.6A {Homo sapiens} Back     alignment and structure
>2qma_A Diaminobutyrate-pyruvate transaminase and L-2,4- diaminobutyrate decarboxylase; structural genomics, APC91511.1, glutamate decarboxylase; HET: MSE; 1.81A {Vibrio parahaemolyticus} Back     alignment and structure
>2dgk_A GAD-beta, GADB, glutamate decarboxylase beta; gadbd1-14, autoinhibition, substituted aldamine, lyase; HET: PLP; 1.90A {Escherichia coli} PDB: 2dgm_A* 1pmo_A* 2dgl_A* 1pmm_A* 3fz6_A* 3fz7_A 3fz8_A* 1xey_A* Back     alignment and structure
>3k40_A Aromatic-L-amino-acid decarboxylase; PLP dependent protein, alpha beta protein, alternative splicing, catecholamine biosynthesis, lyase; HET: LLP; 1.75A {Drosophila melanogaster} SCOP: c.67.1.6 Back     alignment and structure
>4e1o_A HDC, histidine decarboxylase; lyase; HET: PLP PVH; 1.80A {Homo sapiens} Back     alignment and structure
>3vp6_A Glutamate decarboxylase 1; catalytic loop SWAP, lyase; HET: LLP HLD; 2.10A {Homo sapiens} PDB: 2okj_A* 2okk_A* Back     alignment and structure
>3hbx_A GAD 1, glutamate decarboxylase 1; calmodulin-binding, lyase, pyridoxal phosphate; HET: LLP; 2.67A {Arabidopsis thaliana} Back     alignment and structure
>3bc8_A O-phosphoseryl-tRNA(SEC) selenium transferase; disorder-order transition, phosphate-loop, pyridoxal phospha selenocysteine synthase (SECS, sepsecs); HET: LLP; 1.65A {Mus musculus} SCOP: c.67.1.9 PDB: 3bca_A* 3bcb_A* Back     alignment and structure
>1js3_A DDC;, DOPA decarboxylase; carbidopa, parkinson'S disease, vitamin; HET: PLP 142; 2.25A {Sus scrofa} SCOP: c.67.1.6 PDB: 1js6_A* 3rch_A* 3rbl_A 3rbf_A* Back     alignment and structure
>2okj_A Glutamate decarboxylase 1; PLP-dependent decarboxylase, lyase; HET: LLP PLZ; 2.30A {Homo sapiens} PDB: 2okk_A* Back     alignment and structure
>2qma_A Diaminobutyrate-pyruvate transaminase and L-2,4- diaminobutyrate decarboxylase; structural genomics, APC91511.1, glutamate decarboxylase; HET: MSE; 1.81A {Vibrio parahaemolyticus} Back     alignment and structure
>2jis_A Cysteine sulfinic acid decarboxylase; pyridoxal phosphate, alternative splicing, pyridoxal phosphate (PLP), structural genomics consortium (SGC); HET: PLP; 1.6A {Homo sapiens} Back     alignment and structure
>3mc6_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxyl phosphate; HET: LLP; 3.15A {Saccharomyces cerevisiae} Back     alignment and structure
>3mad_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxal phosphate; HET: LLP; 2.00A {Symbiobacterium thermophilum} PDB: 3maf_A* 3mau_A* 3mbb_A* Back     alignment and structure
>2z67_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine biosynthesis, seven-stranded BETE-strand, PYR 5'-phosphate; HET: PLP; 2.50A {Methanococcus maripaludis} SCOP: c.67.1.9 Back     alignment and structure
>3f9t_A TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L-tyrosine decarboxylase MFNA (EC 4.1.1.25), ST genomics; HET: PLP; 2.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>2dgk_A GAD-beta, GADB, glutamate decarboxylase beta; gadbd1-14, autoinhibition, substituted aldamine, lyase; HET: PLP; 1.90A {Escherichia coli} PDB: 2dgm_A* 1pmo_A* 2dgl_A* 1pmm_A* 3fz6_A* 3fz7_A 3fz8_A* 1xey_A* Back     alignment and structure
>3mad_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxal phosphate; HET: LLP; 2.00A {Symbiobacterium thermophilum} PDB: 3maf_A* 3mau_A* 3mbb_A* Back     alignment and structure
>3hbx_A GAD 1, glutamate decarboxylase 1; calmodulin-binding, lyase, pyridoxal phosphate; HET: LLP; 2.67A {Arabidopsis thaliana} Back     alignment and structure
>1wyu_B Glycine dehydrogenase subunit 2 (P-protein); alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_B* 1wyv_B* Back     alignment and structure
>3mc6_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxyl phosphate; HET: LLP; 3.15A {Saccharomyces cerevisiae} Back     alignment and structure
>3hl2_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine, sepsecs, protein-RNA complex, alternative splicing, cytoplasm, protein biosynthesis, pyridoxal phosphate, selenium; HET: PLR SEP; 2.81A {Homo sapiens} Back     alignment and structure
>3nnk_A Ureidoglycine-glyoxylate aminotransferase; PLP-dependent; HET: LLP; 2.58A {Klebsiella pneumoniae} Back     alignment and structure
>3isl_A Purine catabolism protein PUCG; pyridoxalphosphate, PLP dependent enzymes, purine metabolism transaminases, aminotransferases; HET: PLP; 2.06A {Bacillus subtilis} Back     alignment and structure
>4hvk_A Probable cysteine desulfurase 2; transferase and ISCS, transferase; HET: PMP PG4; 1.43A {Archaeoglobus fulgidus} PDB: 4eb7_A* 4eb5_A* Back     alignment and structure
>2yrr_A Aminotransferase, class V; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; HET: PLP; 1.86A {Thermus thermophilus} PDB: 2yri_A* Back     alignment and structure
>4eb5_A Probable cysteine desulfurase 2; scaffold, transferase-metal binding protein complex; HET: PLP EPE; 2.53A {Archaeoglobus fulgidus} PDB: 4eb7_A* Back     alignment and structure
>2dr1_A PH1308 protein, 386AA long hypothetical serine aminotransferase; PLP, structural genomics, NPPSFA; HET: PLP; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>3lvm_A Cysteine desulfurase; structural genomics, montreal-kingston bacterial structural genomics initiative, BSGI, transferase; HET: PLP; 2.05A {Escherichia coli} PDB: 3lvk_A* 3lvl_B* 3lvj_A* 1p3w_B* Back     alignment and structure
>2z9v_A Aspartate aminotransferase; pyridoxamine, pyruvate; HET: PXM; 1.70A {Mesorhizobium loti} PDB: 2z9u_A* 2z9w_A* 2z9x_A* Back     alignment and structure
>3vax_A Putative uncharacterized protein DNDA; desulfurase, transferase; HET: PLP; 2.40A {Streptomyces lividans} Back     alignment and structure
>2bkw_A Alanine-glyoxylate aminotransferase 1; analine-glyoxylate aminotransferase, pyridoxal-5-phosphate, SAD, glycolate pathway; HET: LLP; 2.57A {Saccharomyces cerevisiae} SCOP: c.67.1.3 Back     alignment and structure
>3bc8_A O-phosphoseryl-tRNA(SEC) selenium transferase; disorder-order transition, phosphate-loop, pyridoxal phospha selenocysteine synthase (SECS, sepsecs); HET: LLP; 1.65A {Mus musculus} SCOP: c.67.1.9 PDB: 3bca_A* 3bcb_A* Back     alignment and structure
>3a9z_A Selenocysteine lyase; PLP, cytoplasm, pyridoxal phosphate, transferase; HET: PLP SLP; 1.55A {Rattus norvegicus} PDB: 3a9x_A* 3a9y_A* 3gzd_A* 3gzc_A* 2hdy_A* Back     alignment and structure
>1vjo_A Alanine--glyoxylate aminotransferase; 17130350, ALR1004, STR genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: PLP; 1.70A {Nostoc SP} SCOP: c.67.1.3 Back     alignment and structure
>1eg5_A Aminotransferase; PLP-dependent enzymes, iron-sulfur-cluster synthesis, C-S BE transferase; HET: PLP; 2.00A {Thermotoga maritima} SCOP: c.67.1.3 PDB: 1ecx_A* Back     alignment and structure
>3kgw_A Alanine-glyoxylate aminotransferase; AAH25799.1, putative aminotransferase, structural genomics, center for structural genomics, JCSG; HET: PLP; 1.65A {Mus musculus} SCOP: c.67.1.3 PDB: 3kgx_A 3imz_A* 3r9a_A* 1h0c_A* 1j04_A* Back     alignment and structure
>3zrp_A Serine-pyruvate aminotransferase (AGXT); HET: PLP; 1.75A {Sulfolobus solfataricus} PDB: 3zrq_A* 3zrr_A* Back     alignment and structure
>2huf_A Alanine glyoxylate aminotransferase; alpha and beta protein, PLP-dependent transferase; HET: LLP; 1.75A {Aedes aegypti} PDB: 2hui_A* 2huu_A* Back     alignment and structure
>1svv_A Threonine aldolase; structural genomics, structural genomics of pathogenic proto SGPP, protein structure initiative, PSI; 2.10A {Leishmania major} SCOP: c.67.1.1 Back     alignment and structure
>2e7j_A SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-strand, lyase, structural genomics; HET: PLP; 2.40A {Archaeoglobus fulgidus} SCOP: c.67.1.9 PDB: 2e7i_A* Back     alignment and structure
>1iug_A Putative aspartate aminotransferase; wild type, pyridoxal-5'-phosphate form, riken structural genomics/proteomics initiative, RSGI; HET: LLP; 2.20A {Thermus thermophilus} SCOP: c.67.1.3 Back     alignment and structure
>3ffr_A Phosphoserine aminotransferase SERC; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP MSE P33; 1.75A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>2ch1_A 3-hydroxykynurenine transaminase; PLP-enzyme, kynurenine pathway, transferase; HET: LLP; 2.4A {Anopheles gambiae} SCOP: c.67.1.3 PDB: 2ch2_A* Back     alignment and structure
>1wyu_A Glycine dehydrogenase (decarboxylating) subunit 1; alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_A* 1wyv_A* Back     alignment and structure
>1t3i_A Probable cysteine desulfurase; PLP-binding enzyme, transferase; HET: 2OS PLP; 1.80A {Synechocystis SP} SCOP: c.67.1.3 Back     alignment and structure
>1v72_A Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2.05A {Pseudomonas putida} SCOP: c.67.1.1 Back     alignment and structure
>3cai_A Possible aminotransferase; RV3778C; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>1m32_A 2-aminoethylphosphonate-pyruvate aminotransferase; PLP-dependent aminotransferase fold; HET: PLP; 2.20A {Salmonella typhimurium} SCOP: c.67.1.3 Back     alignment and structure
>3e9k_A Kynureninase; kynurenine-L-hydrolase, kynurenine hydrolase, pyridoxal-5'-phosphate, inhibitor complex, 3-hydroxy hippur hydroxyhippuric acid, PLP; HET: PLP 3XH; 1.70A {Homo sapiens} PDB: 2hzp_A* Back     alignment and structure
>1kmj_A Selenocysteine lyase; persulfide perselenide NIFS pyridoxal phosphate, structural PSI, protein structure initiative; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.3 PDB: 1i29_A* 1jf9_A* 1kmk_A* 1c0n_A* Back     alignment and structure
>3f0h_A Aminotransferase; RER070207000802, structural genomics, JOIN for structural genomics, JCSG; HET: MSE LLP; 1.70A {Eubacterium rectale} Back     alignment and structure
>2vyc_A Biodegradative arginine decarboxylase; pyridoxal phosphate, PLP-dependent E lyase, acid resistance; HET: LLP; 2.4A {Escherichia coli} Back     alignment and structure
>2x3l_A ORN/Lys/Arg decarboxylase family protein; lyase; HET: LLP; 2.00A {Staphylococcus aureus} Back     alignment and structure
>1elu_A L-cysteine/L-cystine C-S lyase; FES cluster biosynthesis, pyridoxal 5'-phosphate, thiocystei aminoacrylate, enzyme-product complex; HET: PDA; 1.55A {Synechocystis SP} SCOP: c.67.1.3 PDB: 1elq_A* 1n2t_A* 1n31_A* Back     alignment and structure
>2z67_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine biosynthesis, seven-stranded BETE-strand, PYR 5'-phosphate; HET: PLP; 2.50A {Methanococcus maripaludis} SCOP: c.67.1.9 Back     alignment and structure
>1j32_A Aspartate aminotransferase; HET: PLP; 2.10A {Phormidium lapideum} SCOP: c.67.1.1 Back     alignment and structure
>2w8t_A SPT, serine palmitoyltransferase; HET: LLP; 1.25A {Sphingomonas paucimobilis} PDB: 2w8u_A* 2w8w_A* 2xbn_A* 2w8j_A* 2w8v_A* 2jg2_A* 2jgt_A 2x8u_A* Back     alignment and structure
>2fnu_A Aminotransferase; protein-product complex, structural genomics, montreal-kings bacterial structural genomics initiative, BSGI; HET: PMP UD1; 1.50A {Helicobacter pylori} SCOP: c.67.1.4 PDB: 2fni_A* 2fn6_A* Back     alignment and structure
>1qz9_A Kynureninase; kynurenine, tryptophan, PLP, vitamin B6, pyridoxal-5'-phosph hydrolase; HET: PLP P3G; 1.85A {Pseudomonas fluorescens} SCOP: c.67.1.3 Back     alignment and structure
>3dzz_A Putative pyridoxal 5'-phosphate-dependent C-S LYA; putative PLP-dependent aminotransferase; HET: MSE LLP PG4; 1.61A {Lactobacillus delbrueckii subsp} SCOP: c.67.1.0 Back     alignment and structure
>1gd9_A Aspartate aminotransferase; pyridoxal enzyme, temperature dependence O substrate recognition; HET: PLP; 1.80A {Pyrococcus horikoshii} SCOP: c.67.1.1 PDB: 1gde_A* 1dju_A* Back     alignment and structure
>3frk_A QDTB; aminotransferase, sugar-modification, natural porduct; HET: TQP; 2.15A {Thermoanaerobacteriumthermosaccharolyticum} Back     alignment and structure
>1ax4_A Tryptophanase; tryptophan biosynthesis, tryptophan indole-lyase, pyridoxal 5'-phosphate, monovalent cation binding site; HET: LLP; 2.10A {Proteus vulgaris} SCOP: c.67.1.2 Back     alignment and structure
>1b9h_A AHBA synthase, protein (3-amino-5-hydroxybenzoic acid synthase); rifamycin biosynthesis (RIFD gene); HET: PLP; 2.00A {Amycolatopsis mediterranei} SCOP: c.67.1.4 PDB: 1b9i_A* Back     alignment and structure
>3ke3_A Putative serine-pyruvate aminotransferase; structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP; 2.20A {Psychrobacter arcticus 273-4} Back     alignment and structure
>1o4s_A Aspartate aminotransferase; TM1255, structural genomics, JCS protein structure initiative, joint center for structural G transferase; HET: PLP; 1.90A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>3f9t_A TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L-tyrosine decarboxylase MFNA (EC 4.1.1.25), ST genomics; HET: PLP; 2.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3tqx_A 2-amino-3-ketobutyrate coenzyme A ligase; energy metabolism, transferase; HET: PLP; 2.30A {Coxiella burnetii} Back     alignment and structure
>2c81_A Glutamine-2-deoxy-scyllo-inosose aminotransferase; SMAT, butirosin, aminoglycoside antibiotics; HET: PMP; 1.7A {Bacillus circulans} PDB: 2c7t_A* Back     alignment and structure
>3nyt_A Aminotransferase WBPE; PLP binding, nucleotide-sugar binding; HET: ULP; 1.30A {Pseudomonas aeruginosa} PDB: 3nys_A* 3nyu_A* 3nu8_A* 3nu7_A* 3nub_A* Back     alignment and structure
>3uwc_A Nucleotide-sugar aminotransferase; lipopolysaccharide biosynthesis; HET: MSE PMP; 1.80A {Coxiella burnetii} Back     alignment and structure
>1rv3_A Serine hydroxymethyltransferase, cytosolic; one-carbon metabolism; HET: GLY PLP; 2.40A {Oryctolagus cuniculus} SCOP: c.67.1.4 PDB: 1rv4_A* 1rvu_A* 1rvy_A* 1ls3_A* 1cj0_A* 1bj4_A* 1eji_A* Back     alignment and structure
>2rfv_A Methionine gamma-lyase; pyridoxal-5'-phosphate, PLP-dependent enzyme; HET: LLP; 1.35A {Citrobacter freundii} PDB: 1y4i_A* 3jwa_A* 3jw9_A* 3jwb_A* 3mkj_A* Back     alignment and structure
>3nra_A Aspartate aminotransferase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: LLP; 2.15A {Rhodobacter sphaeroides} Back     alignment and structure
>1c4k_A Protein (ornithine decarboxylase); lyase; HET: PLP GTP; 2.70A {Lactobacillus SP} SCOP: c.23.1.4 c.67.1.5 d.125.1.1 PDB: 1ord_A* Back     alignment and structure
>3dr4_A Putative perosamine synthetase; deoxysugar, pyridoxal phosphate, aspartate aminotransferase, O-antigen; HET: G4M; 1.60A {Caulobacter crescentus} PDB: 3dr7_A* 3bn1_A* Back     alignment and structure
>2gb3_A Aspartate aminotransferase; TM1698, structural genomics, PSI structure initiative, joint center for structural genomics; HET: LLP; 2.50A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>2zc0_A Alanine glyoxylate transaminase; alanine:glyoxylate aminotransferase, archaea, thermococcus L transferase; HET: PMP; 2.30A {Thermococcus litoralis} Back     alignment and structure
>2cb1_A O-acetyl homoserine sulfhydrylase; PLP enzyme, lyase, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: LLP; 2.0A {Thermus thermophilus} Back     alignment and structure
>1o69_A Aminotransferase; structural genomics, unknown function; HET: X04; 1.84A {Campylobacter jejuni} SCOP: c.67.1.4 PDB: 1o62_A 1o61_A* Back     alignment and structure
>2o0r_A RV0858C (N-succinyldiaminopimelate aminotransfera; PLP-binding enzyme, lysine biosynthesis, aminotransferase, S genomics; HET: LLP; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1u08_A Hypothetical aminotransferase YBDL; alpha beta protein; HET: PLP; 2.35A {Escherichia coli} SCOP: c.67.1.1 Back     alignment and structure
>3a2b_A Serine palmitoyltransferase; vitamin B6-dependent enzyme fold type I, acyltransferase, PY phosphate; HET: PLP; 2.30A {Sphingobacterium multivorum} Back     alignment and structure
>2oqx_A Tryptophanase; lyase, pyridoxal phosphate, tryptophan catabolism; HET: CME EPE; 1.90A {Escherichia coli} SCOP: c.67.1.2 PDB: 2c44_A 2v1p_A* 2v0y_A* Back     alignment and structure
>1xi9_A Putative transaminase; alanine aminotransferase, southeast collaboratory for structural genomics, secsg; HET: PLP; 2.33A {Pyrococcus furiosus} SCOP: c.67.1.1 Back     alignment and structure
>1fc4_A 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino-3-ketobutyrate COA ligase, pyridoxal phosphate, COEN transferase, structural genomics; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.4 Back     alignment and structure
>3qm2_A Phosphoserine aminotransferase; structural genomics, center for structural genomics of infec diseases, csgid; 2.25A {Salmonella enterica subsp} PDB: 1bjn_A* 1bjo_A* 3qbo_A* Back     alignment and structure
>1v2d_A Glutamine aminotransferase; PLP, riken structural genomics/proteomics initi RSGI, structural genomics; HET: PLP; 1.90A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1v2e_A* 1v2f_A* Back     alignment and structure
>2a7v_A Serine hydroxymethyltransferase; structural genomics, structural genomics consortium, SGC; 2.04A {Homo sapiens} PDB: 3ou5_A Back     alignment and structure
>3m5u_A Phosphoserine aminotransferase; alpha-beta half sandwich, csgid, amino-acid biosynthesis, cytoplasm, pyridoxal phosphate; HET: MES; 2.15A {Campylobacter jejuni} SCOP: c.67.1.0 Back     alignment and structure
>3b8x_A WBDK, pyridoxamine 5-phosphate-dependent dehydrase; aspartate aminotransferase, colitose, perosamine, O-antigen, pyridoxal phosphate,; HET: G4M; 1.70A {Escherichia coli} PDB: 2gms_A* 2gmu_A* 2r0t_A* 3gr9_A* Back     alignment and structure
>3hl2_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine, sepsecs, protein-RNA complex, alternative splicing, cytoplasm, protein biosynthesis, pyridoxal phosphate, selenium; HET: PLR SEP; 2.81A {Homo sapiens} Back     alignment and structure
>1gc0_A Methionine gamma-lyase; pyridoxal-5'-phosphate; HET: LLP; 1.70A {Pseudomonas putida} SCOP: c.67.1.3 PDB: 1gc2_A* 1pg8_A* 1ukj_A* 2o7c_A* Back     alignment and structure
>4dq6_A Putative pyridoxal phosphate-dependent transferas; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: PLP; 1.50A {Clostridium difficile} PDB: 4dgt_A* Back     alignment and structure
>3e77_A Phosphoserine aminotransferase; SERC, PLP, structural genomi structural genomics consortium, SGC, amino-acid biosynthesi aminotransferase; HET: PLP; 2.50A {Homo sapiens} Back     alignment and structure
>3n0l_A Serine hydroxymethyltransferase; alpha beta class, 3-layer(ABA) sandwich, CSGI transferase, structural genomics; HET: MSE; 1.80A {Campylobacter jejuni} SCOP: c.67.1.0 Back     alignment and structure
>3cq5_A Histidinol-phosphate aminotransferase; PLP, PMP, amino-acid biosynthesis, histidine biosynthesis, pyridoxal phosphate; HET: PMP; 1.80A {Corynebacterium glutamicum} PDB: 3cq6_A* 3cq4_A Back     alignment and structure
>2vi8_A Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, enzyme memory, pyridoxal phosphate, one-carbon metabolism, PLP-dependent enzymes; HET: PLP; 1.67A {Bacillus stearothermophilus} PDB: 2vi9_A* 2via_A* 2vib_A* 1kkj_A* 1kkp_A* 1kl1_A* 1kl2_A* 1yjs_A* 2w7f_A* 2w7d_A* 2w7e_A* 2w7g_A* 2w7h_A* 1yjz_A* 1yjy_A* 2vgu_A* 2vgs_A* 2vgt_A* 2vgv_A* 2vgw_A* ... Back     alignment and structure
>3g0t_A Putative aminotransferase; NP_905498.1, putative aspartate aminotransferase, structural genomics, joint center for structural genomics; HET: MSE LLP PE4; 1.75A {Porphyromonas gingivalis} Back     alignment and structure
>3qhx_A Cystathionine gamma-synthase METB (CGS); structural genomics, seattle structural genomics center for infectious disease, ssgcid, CGS_LIKE; HET: LLP EPE; 1.65A {Mycobacterium ulcerans} SCOP: c.67.1.0 PDB: 3qi6_A* Back     alignment and structure
>3l8a_A METC, putative aminotransferase, probable beta-cystathi; beta-cystathionase, lyase; HET: PLP; 1.54A {Streptococcus mutans} Back     alignment and structure
>1bs0_A Protein (8-amino-7-oxonanoate synthase); PLP-dependent acyl-COA synthase, biotin biosynthesis, 8-AMIN oxonanoate synthase; 1.65A {Escherichia coli} SCOP: c.67.1.4 PDB: 2g6w_A* 1dje_A* 1dj9_A* Back     alignment and structure
>3acz_A Methionine gamma-lyase; L-methionine; HET: LLP; 1.97A {Entamoeba histolytica} PDB: 3aej_A* 3ael_A* 3aem_A* 3aen_A* 3aeo_A* 3aep_A* Back     alignment and structure
>3ly1_A Putative histidinol-phosphate aminotransferase; structural G joint center for structural genomics, JCSG; HET: MSE PLP CIT; 1.80A {Erwinia carotovora atroseptica} Back     alignment and structure
>2ctz_A O-acetyl-L-homoserine sulfhydrylase; crystal, O-acetyl homoserine sulfhydrase, structural genomic structural genomics/proteomics initiative; HET: PLP; 2.60A {Thermus thermophilus} SCOP: c.67.1.3 Back     alignment and structure
>3lws_A Aromatic amino acid beta-eliminating lyase/threonine aldolase; structural genomics, joint center for structural genomics, JCSG; HET: LLP MSE; 2.00A {Exiguobacterium sibiricum} Back     alignment and structure
>3euc_A Histidinol-phosphate aminotransferase 2; YP_297314.1, structur genomics, joint center for structural genomics, JCSG; HET: MSE; 2.05A {Ralstonia eutropha JMP134} SCOP: c.67.1.0 Back     alignment and structure
>3piu_A 1-aminocyclopropane-1-carboxylate synthase; fruit ripening, ethylene biosynthesis, lyase, pyridoxal 5'-P binding; HET: LLP PLR; 1.35A {Malus domestica} SCOP: c.67.1.4 PDB: 1m4n_A* 1m7y_A* 1ynu_A* 1b8g_A* Back     alignment and structure
>1yiz_A Kynurenine aminotransferase; glutamine transaminase; kynurenic acid, mosquito, PLP-enzyme, pyridoxal phosphate, PLP; HET: LLP; 1.55A {Aedes aegypti} SCOP: c.67.1.1 PDB: 1yiy_A* 2r5c_A* 2r5e_A* Back     alignment and structure
>1c7n_A Cystalysin; transferase, aminotransferase, pyridoxal phosphate; HET: PLP; 1.90A {Treponema denticola} SCOP: c.67.1.3 PDB: 1c7o_A* Back     alignment and structure
>1jg8_A L-ALLO-threonine aldolase; glycine biosynthesis, pyridoxal-5'- phosphate, calcium binding site, structural genomics, PSI; HET: LLP; 1.80A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1lw4_A* 1lw5_A* 1m6s_A* 2fm1_A* Back     alignment and structure
>2z61_A Probable aspartate aminotransferase 2; amino acid aminotransferase, kynurenine aminotransferase, MJ0684, cytoplasm; HET: LLP; 2.20A {Methanococcus jannaschii} Back     alignment and structure
>1vp4_A Aminotransferase, putative; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE PLP; 1.82A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>3h14_A Aminotransferase, classes I and II; YP_167802.1, SPO258 structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.90A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>2dkj_A Serine hydroxymethyltransferase; PLP dependent enzyme, structural genomics; HET: PLP; 1.15A {Thermus thermophilus} Back     alignment and structure
>2oga_A Transaminase; PLP-dependent enzyme, desosamine, deoxysugars, antibiotics, hydrolase; HET: PGU; 2.05A {Streptomyces venezuelae} PDB: 2oge_A* Back     alignment and structure
>1iay_A ACC synthase 2, 1-aminocyclopropane-1-carboxylate synthase 2; protein-cofactor-inhibitor complex, V6-dependent enzyme, LYA; HET: PLP AVG; 2.70A {Solanum lycopersicum} SCOP: c.67.1.4 PDB: 1iax_A* Back     alignment and structure
>2ez2_A Beta-tyrosinase, tyrosine phenol-lyase; PLP-dependent enzyme, pyridoxal-5'-phosphate, domain lyase; 1.85A {Citrobacter freundii} PDB: 2ez1_A 2vlf_A* 2vlh_A* 2yct_A* 1tpl_A 2tpl_A* 2ycn_A* 2yhk_A* 2ycp_A* 1c7g_A* Back     alignment and structure
>3ele_A Amino transferase; RER070207001803, structural genomics, JOI for structural genomics, JCSG; HET: MSE PLP; 2.10A {Eubacterium rectale} Back     alignment and structure
>1mdo_A ARNB aminotransferase; type 1 aminotransferase fold; HET: MSE PMP; 1.70A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1mdx_A* 1mdz_A* Back     alignment and structure
>1d2f_A MALY protein; aminotransferase fold, large PLP-binding domain, small C-TER domain, open alpha-beta structure., transferase; HET: PLP; 2.50A {Escherichia coli} SCOP: c.67.1.3 Back     alignment and structure
>3pj0_A LMO0305 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology, lyase; HET: LLP MSE; 1.80A {Listeria monocytogenes} Back     alignment and structure
>1e5e_A MGL, methionine gamma-lyase; methionine biosynthesis, PLP-dependent enzymes, C-S gamma lyase; HET: PPJ; 2.18A {Trichomonas vaginalis} SCOP: c.67.1.3 PDB: 1e5f_A* Back     alignment and structure
>1cs1_A CGS, protein (cystathionine gamma-synthase); lyase, LLP-dependent enzymes, methionine biosynthesis; HET: LLP DHD; 1.50A {Escherichia coli} SCOP: c.67.1.3 Back     alignment and structure
>3ju7_A Putative PLP-dependent aminotransferase; NP_978343.1, struct genomics, joint center for structural genomics, JCSG; HET: LLP PGE; 2.19A {Bacillus cereus atcc 10987} Back     alignment and structure
>3gbx_A Serine hydroxymethyltransferase; structural genomics, IDP01011, serine hydroxymethyltransfera salmonella typhimurium.; HET: MSE; 1.80A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1dfo_A* 3g8m_A* 1eqb_A* Back     alignment and structure
>1w23_A Phosphoserine aminotransferase; pyridoxal-5'-phosphate; HET: PGE PLP EPE; 1.08A {Bacillus alcalophilus} SCOP: c.67.1.4 PDB: 2bhx_A* 2bi1_A* 2bi2_A* 2bi3_A* 2bi5_A* 2bi9_A* 2bia_A* 2bie_A* 2big_A* Back     alignment and structure
>3ffh_A Histidinol-phosphate aminotransferase; APC88260, listeria in CLIP11262, structural genomics, PSI-2; 2.31A {Listeria innocua} SCOP: c.67.1.0 Back     alignment and structure
>3tcm_A Alanine aminotransferase 2; pyridoxal phosphate (PLP)-binding; HET: DCS; 2.71A {Hordeum vulgare} Back     alignment and structure
>2zyj_A Alpha-aminodipate aminotransferase; alpha-aminoadipate aminotransferase; HET: PGU; 1.67A {Thermus thermophilus} PDB: 2egy_A* 2dtv_A* 2zg5_A* 2zp7_A* 2z1y_A* 3cbf_A* Back     alignment and structure
>3n75_A LDC, lysine decarboxylase, inducible; pyridoxal-5'-phosphate dependent decarboxylase, acid stress stringent response; HET: LLP G4P P6G; 2.00A {Escherichia coli} PDB: 3q16_A* Back     alignment and structure
>2x5d_A Probable aminotransferase; HET: LLP PLP; 2.25A {Pseudomonas aeruginosa} Back     alignment and structure
>1qgn_A Protein (cystathionine gamma-synthase); methionine biosynthesis, pyridoxal 5'-phosphate, gamma-famil; HET: PLP; 2.90A {Nicotiana tabacum} SCOP: c.67.1.3 PDB: 1i41_A* 1i48_A* 1i43_A* Back     alignment and structure
>1pff_A Methionine gamma-lyase; homocysteine; 2.50A {Trichomonas vaginalis} SCOP: c.67.1.3 Back     alignment and structure
>1b5p_A Protein (aspartate aminotransferase); pyridoxal enzyme; HET: PLP; 1.80A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1gck_A* 1b5o_A* 5bj4_A* 1gc4_A* 1gc3_A* 1bkg_A* 5bj3_A* 1bjw_A* Back     alignment and structure
>3fsl_A Aromatic-amino-acid aminotransferase; tyrosine aminotransferase, pyridoxal phosphate, internal ALD schiff base, amino-acid biosynthesis; HET: PLR; 2.35A {Escherichia coli k-12} SCOP: c.67.1.1 PDB: 3tat_A* Back     alignment and structure
>2po3_A 4-dehydrase; external aldimine, PLP, aminotransferase, TDP-sugar; HET: T4K; 2.10A {Streptomyces venezuelae} Back     alignment and structure
>2dou_A Probable N-succinyldiaminopimelate aminotransfera; PLP-dependent enzyme, structural genomics, NPPSFA; HET: EPE; 2.30A {Thermus thermophilus} Back     alignment and structure
>1vef_A Acetylornithine/acetyl-lysine aminotransferase; PLP, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: PLP; 1.35A {Thermus thermophilus} SCOP: c.67.1.4 PDB: 1wkg_A* 1wkh_A* Back     alignment and structure
>3ndn_A O-succinylhomoserine sulfhydrylase; seattle structural genomics center for infectious disease, S mycobacterium, PLP, schiff base; HET: LLP; 1.85A {Mycobacterium tuberculosis} Back     alignment and structure
>3kki_A CAI-1 autoinducer synthase; quorum sensing, CQSA, P virulence, acyltransferase, aminotransferase, pyridoxal PHO transferase; HET: PLP; 1.80A {Vibrio cholerae} PDB: 3hqt_A* 2wk9_A* 2wk8_A* 2wka_A* 2wk7_A Back     alignment and structure
>3aow_A Putative uncharacterized protein PH0207; protein-PLP-AKG triple complex, schiff-base linkage, kynuren aminotransferase; HET: PLP AKG; 1.56A {Pyrococcus horikoshii} PDB: 3aov_A* 3ath_A* 3av7_A* 1x0m_A 1wst_A* Back     alignment and structure
>3ri6_A O-acetylhomoserine sulfhydrylase; PYR 5'-phosphate, gamma-elimination, direct sulfhydrylation, CY metabolism, protein thiocarboxylate, TR; 2.20A {Wolinella succinogenes} Back     alignment and structure
>2fyf_A PSAT, phosphoserine aminotransferase; PLP-dependent enzyme, dimer, structural genomics; HET: PLP; 1.50A {Mycobacterium tuberculosis} PDB: 3vom_A* Back     alignment and structure
>3fdb_A Beta C-S lyase, putative PLP-dependent beta-cystathionase; PLP-dependent transferase-like fold, structural genomics; HET: LLP; 1.99A {Corynebacterium diphtheriae} Back     alignment and structure
>3ezs_A Aminotransferase ASPB; NP_207418.1, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 2.19A {Helicobacter pylori 26695} SCOP: c.67.1.0 Back     alignment and structure
>3get_A Histidinol-phosphate aminotransferase; NP_281508.1, structural genomics, joint center for structural genomics; HET: LLP MSE; 2.01A {Campylobacter jejuni subsp} Back     alignment and structure
>3b46_A Aminotransferase BNA3; kynurenine aminotransferase, LLP, PLP, cytoplasm, mitochondrion, pyridoxal phosphate; HET: LLP; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3op7_A Aminotransferase class I and II; PLP-dependent transferase, structural genomics, joint center structural genomics, JCSG; HET: LLP UNL; 1.70A {Streptococcus suis 89} PDB: 3p6k_A* Back     alignment and structure
>3ftb_A Histidinol-phosphate aminotransferase; structural genomics, PSI, MCSG, protein structure initiative; 2.00A {Clostridium acetobutylicum} SCOP: c.67.1.0 Back     alignment and structure
>3i16_A Aluminum resistance protein; YP_878183.1, carbon-sulfur lyase involved in aluminum resist structural genomics; HET: MSE TLA PLP; 2.00A {Clostridium novyi} PDB: 3gwp_A* Back     alignment and structure
>1bw0_A TAT, protein (tyrosine aminotransferase); tyrosine catabolism, pyridoxal-5'-phosphate, PLP; HET: LLP; 2.50A {Trypanosoma cruzi} SCOP: c.67.1.1 Back     alignment and structure
>2o1b_A Aminotransferase, class I; aminotrasferase; HET: PLP; 1.95A {Staphylococcus aureus} Back     alignment and structure
>2c0r_A PSAT, phosphoserine aminotransferase; pyridoxal-5'-phosphate, pyridine serine biosynthesis, amino-acid biosynthesis, pyridoxal phosphate; HET: PLP; 1.2A {Bacillus circulans} SCOP: c.67.1.4 PDB: 1bt4_A* 1w3u_A* Back     alignment and structure
>3ecd_A Serine hydroxymethyltransferase 2; ssgcid, decode, bupsa00008A, one-carbon metabolism, pyridoxa phosphate, structural genomics; 1.60A {Burkholderia pseudomallei} Back     alignment and structure
>3jtx_A Aminotransferase; NP_283882.1, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; HET: LLP MES; 1.91A {Neisseria meningitidis Z2491} Back     alignment and structure
>2bwn_A 5-aminolevulinate synthase; tetrapyrrole biosynthesis, heme biosynthesis, pyridoxal PHOS dependent, transferase, acyltransferase; HET: LLP; 2.1A {Rhodobacter capsulatus} SCOP: c.67.1.4 PDB: 2bwo_A* 2bwp_A* Back     alignment and structure
>3e2y_A Kynurenine-oxoglutarate transaminase 3; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: GLN PMP; 2.26A {Mus musculus} SCOP: c.67.1.0 PDB: 2zjg_A* 3e2f_A* 3e2z_A* Back     alignment and structure
>4f4e_A Aromatic-amino-acid aminotransferase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: LLP; 1.80A {Burkholderia pseudomallei} PDB: 4eff_A* Back     alignment and structure
>1ibj_A CBL, cystathionine beta-lyase; PLP-dependent enzyme, methionine biosynthesis, transsulfurat lyase; HET: PLP; 2.30A {Arabidopsis thaliana} SCOP: c.67.1.3 Back     alignment and structure
>2fq6_A Cystathionine beta-lyase; protein-inhibitor complex, PLP cofactor covalently bound to inhibitor; HET: P3F; 1.78A {Escherichia coli} SCOP: c.67.1.3 PDB: 2gqn_A* 1cl1_A* 1cl2_A* Back     alignment and structure
>3fvs_A Kynurenine--oxoglutarate transaminase 1; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: LLP; 1.50A {Homo sapiens} SCOP: c.67.1.1 PDB: 3fvu_A* 3fvx_A* 1w7l_A* 1w7m_A* 1w7n_A* Back     alignment and structure
>3jzl_A Putative cystathionine beta-lyase involved in ALU resistance; putative cystathionine beta-lyase involved in aluminum resis structural genomics; HET: LLP; 1.91A {Listeria monocytogenes str} PDB: 3fd0_A* Back     alignment and structure
>3dyd_A Tyrosine aminotransferase; PLP, SGC, structural genomics, structural genomics consortium, disease mutation, phenylalani catabolism; HET: PLP; 2.30A {Homo sapiens} PDB: 3pdx_A* Back     alignment and structure
>3ht4_A Aluminum resistance protein; lyase, putative cystathionine BEAT-lyase, aluminium resistance protein, Q81A77_baccr, NESG, BCR213; 2.90A {Bacillus cereus atcc 14579} Back     alignment and structure
>2ord_A Acoat, acetylornithine aminotransferase; TM1785, acetylornithine aminotransferase (EC 2.6.1.11) (ACOA structural genomics; HET: MSE PLP; 1.40A {Thermotoga maritima MSB8} PDB: 2e54_A* Back     alignment and structure
>3h7f_A Serine hydroxymethyltransferase 1; cytoplasm, one-carbon metabolism, pyridoxal phosphate, structural genomics; HET: LLP; 1.50A {Mycobacterium tuberculosis} Back     alignment and structure
>1ajs_A Aspartate aminotransferase; PIG, in the presence of ligand 2-methylaspartate; HET: LLP PLA; 1.60A {Sus scrofa} SCOP: c.67.1.1 PDB: 1ajr_A* 3ii0_A* 1aat_A 2cst_A* Back     alignment and structure
>7aat_A Aspartate aminotransferase; transferase(aminotransferase); HET: PLP; 1.90A {Gallus gallus} SCOP: c.67.1.1 PDB: 1ivr_A* 1map_A* 1maq_A* 1oxo_A* 1oxp_A* 1ama_A* 1tas_A* 1tat_A* 1tar_A* 8aat_A* 9aat_A* 1aka_A* 1akb_A* 1akc_A* 3pd6_A* 3hlm_A* 3pdb_A* Back     alignment and structure
>2ay1_A Aroat, aromatic amino acid aminotransferase; HET: PLP AHC; 2.20A {Paracoccus denitrificans} SCOP: c.67.1.1 PDB: 1ay5_A* 1ay4_A* 1ay8_A* 2ay2_A* 2ay3_A* 2ay4_A* 2ay5_A* 2ay6_A* 2ay7_A* 2ay8_A* 2ay9_A* Back     alignment and structure
>2eh6_A Acoat, acetylornithine aminotransferase; ARGD, structural genomics, NPPSFA, national project on prote structural and functional analyses; HET: PLP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>1yaa_A Aspartate aminotransferase; HET: PLP; 2.05A {Saccharomyces cerevisiae} SCOP: c.67.1.1 Back     alignment and structure
>1wyu_B Glycine dehydrogenase subunit 2 (P-protein); alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_B* 1wyv_B* Back     alignment and structure
>3hvy_A Cystathionine beta-lyase family protein, YNBB B.S ortholog; NP_348457.1, putative cystathionine beta-lyase involved in A resistance; HET: LLP MSE; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>4adb_A Succinylornithine transaminase; transferase, PLP enzymes, aminotransferase; HET: PLP; 2.20A {Escherichia coli} PDB: 4adc_A* 4add_A* 4ade_A Back     alignment and structure
>1s0a_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; fold type I, subclass II, homodimer; HET: LLP; 1.71A {Escherichia coli} SCOP: c.67.1.4 PDB: 1qj5_A* 1mlz_A* 1qj3_A* 1mly_A* 1s06_A* 1s08_A* 1s09_A* 1s07_A* 1mgv_A* 1dty_A* Back     alignment and structure
>1n8p_A Cystathionine gamma-lyase; three open alpha/beta structures; HET: PLP; 2.60A {Saccharomyces cerevisiae} SCOP: c.67.1.3 Back     alignment and structure
>3if2_A Aminotransferase; YP_265399.1, structura genomics, joint center for structural genomics, JCSG, prote structure initiative, PSI-2; HET: PLP; 2.50A {Psychrobacter arcticus 273-4} Back     alignment and structure
>3ihj_A Alanine aminotransferase 2; helix, structural genomics, structural genomics consortium, pyridoxal phosphate; HET: PLP; 2.30A {Homo sapiens} Back     alignment and structure
>3nnk_A Ureidoglycine-glyoxylate aminotransferase; PLP-dependent; HET: LLP; 2.58A {Klebsiella pneumoniae} Back     alignment and structure
>3cog_A Cystathionine gamma-lyase; CTH, PLP, propargylglycine, SGC, inhibitor, structural genom stockholm, structural genomics consortium; HET: PLP; 2.00A {Homo sapiens} PDB: 2nmp_A* 3elp_B Back     alignment and structure
>2q7w_A Aspartate aminotransferase; mechanism-based inhibitor, PLP, sadta, PH dependence; HET: KST PSZ PMP GOL; 1.40A {Escherichia coli} SCOP: c.67.1.1 PDB: 2qa3_A* 2qb2_A* 2qb3_A* 2qbt_A* 3qn6_A* 3pa9_A* 1aaw_A* 1amq_A* 1ams_A* 1arg_A* 1amr_A* 1art_A* 1asa_A* 1asd_A* 1ase_A* 1asl_A* 1asm_A* 1asn_A* 1c9c_A* 1cq6_A* ... Back     alignment and structure
>3rq1_A Aminotransferase class I and II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta structure, cytosol; HET: AKG GOL; 2.20A {Veillonella parvula} Back     alignment and structure
>3nmy_A Xometc, cystathionine gamma-lyase-like protein; Cys-Met metabolism PLP-dependent enzyme family, CYST gamma lyase, pyridoxal-phosphate; HET: PLP; 2.07A {Xanthomonas oryzae PV} SCOP: c.67.1.0 PDB: 3e6g_A* 3nnp_A* Back     alignment and structure
>1lc5_A COBD, L-threonine-O-3-phosphate decarboxylase; PLP-dependent decarboxylase cobalamin, lyase; 1.46A {Salmonella enterica} SCOP: c.67.1.1 PDB: 1lc7_A* 1lc8_A* 1lkc_A* Back     alignment and structure
>3hdo_A Histidinol-phosphate aminotransferase; PSI-II, histidinol-phosphate aminotrans structural genomics, protein structure initiative; 1.61A {Geobacter metallireducens gs-15} Back     alignment and structure
>3p1t_A Putative histidinol-phosphate aminotransferase; PLP-dependent transferase-like, structural genomics, joint C structural genomics, JCSG; HET: TLA; 2.60A {Burkholderia pseudomallei} Back     alignment and structure
>3e9k_A Kynureninase; kynurenine-L-hydrolase, kynurenine hydrolase, pyridoxal-5'-phosphate, inhibitor complex, 3-hydroxy hippur hydroxyhippuric acid, PLP; HET: PLP 3XH; 1.70A {Homo sapiens} PDB: 2hzp_A* Back     alignment and structure
>4hvk_A Probable cysteine desulfurase 2; transferase and ISCS, transferase; HET: PMP PG4; 1.43A {Archaeoglobus fulgidus} PDB: 4eb7_A* 4eb5_A* Back     alignment and structure
>3meb_A Aspartate aminotransferase; pyridoxal PHOS transferase, structural genomics, seattle structural genomi for infectious disease, ssgcid; HET: PLP; 1.90A {Giardia lamblia} Back     alignment and structure
>3isl_A Purine catabolism protein PUCG; pyridoxalphosphate, PLP dependent enzymes, purine metabolism transaminases, aminotransferases; HET: PLP; 2.06A {Bacillus subtilis} Back     alignment and structure
>2aeu_A Hypothetical protein MJ0158; selenocysteine synthase, PLP, pyridoxal phosphate, HOMO- oligomerization, unknown function; 1.70A {Methanocaldococcus jannaschii} SCOP: c.67.1.8 PDB: 2aev_A* Back     alignment and structure
>1fg7_A Histidinol phosphate aminotransferase; HISC, histidine biosynthesis, pyridoxal PH montreal-kingston bacterial structural genomics initiative; HET: PMP; 1.50A {Escherichia coli} SCOP: c.67.1.1 PDB: 1fg3_A* 1gew_A* 1gex_A* 1gey_A* 1iji_A* Back     alignment and structure
>2pb2_A Acetylornithine/succinyldiaminopimelate aminotran; ARGD, pyridoxal 5'-phosphate, arginine metabolism, lysine biosynthesis, gabaculine; HET: PLP; 1.91A {Salmonella typhimurium} PDB: 2pb0_A* Back     alignment and structure
>3ruy_A Ornithine aminotransferase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha and beta protein; HET: LLP; 2.65A {Bacillus anthracis} SCOP: c.67.1.0 Back     alignment and structure
>2x5f_A Aspartate_tyrosine_phenylalanine pyridoxal-5' phosphate-dependent aminotransferase...; HET: PLP EPE; 1.80A {Staphylococcus aureus} Back     alignment and structure
>1sff_A 4-aminobutyrate aminotransferase; enzyme complexes; HET: IK2; 1.90A {Escherichia coli} SCOP: c.67.1.4 PDB: 1sf2_A* 1szk_A* 1szu_A* 1szs_A* Back     alignment and structure
>1wyu_A Glycine dehydrogenase (decarboxylating) subunit 1; alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_A* 1wyv_A* Back     alignment and structure
>3dxv_A Alpha-amino-epsilon-caprolactam racemase; fold-TYPE1, pyridoxal-5'-phosphate dependent racemase, pyrid phosphate, isomerase; HET: PLP; 2.21A {Achromobacter obae} PDB: 2zuk_A* 3dxw_A* Back     alignment and structure
>3nx3_A Acoat, acetylornithine aminotransferase; csgid, structural genomics, center for structural genomics O infectious diseases; 1.80A {Campylobacter jejuni subsp} Back     alignment and structure
>2yrr_A Aminotransferase, class V; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; HET: PLP; 1.86A {Thermus thermophilus} PDB: 2yri_A* Back     alignment and structure
>2r2n_A Kynurenine/alpha-aminoadipate aminotransferase mitochondrial; alpha & beta protein, PLP-dependent transferase, aminotransf mitochondrion; HET: PMP KYN; 1.95A {Homo sapiens} PDB: 2qlr_A* 3dc1_A* 3ue8_A* 2vgz_A* 2xh1_A* Back     alignment and structure
>3ppl_A Aspartate aminotransferase; dimer, PLP-dependent transferase-like fold structural genomics, joint center for structural genomics; HET: MSE PLP UNL; 1.25A {Corynebacterium glutamicum} Back     alignment and structure
>3kgw_A Alanine-glyoxylate aminotransferase; AAH25799.1, putative aminotransferase, structural genomics, center for structural genomics, JCSG; HET: PLP; 1.65A {Mus musculus} SCOP: c.67.1.3 PDB: 3kgx_A 3imz_A* 3r9a_A* 1h0c_A* 1j04_A* Back     alignment and structure
>3ez1_A Aminotransferase MOCR family; YP_604413.1, struct genomics, joint center for structural genomics, JCSG; 2.60A {Deinococcus geothermalis dsm 11300} Back     alignment and structure
>3zrp_A Serine-pyruvate aminotransferase (AGXT); HET: PLP; 1.75A {Sulfolobus solfataricus} PDB: 3zrq_A* 3zrr_A* Back     alignment and structure
>2eo5_A 419AA long hypothetical aminotransferase; PLP enzyme, structural genomics, NPPSFA, N project on protein structural and functional analyses; HET: PLP; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>1t3i_A Probable cysteine desulfurase; PLP-binding enzyme, transferase; HET: 2OS PLP; 1.80A {Synechocystis SP} SCOP: c.67.1.3 Back     alignment and structure
>2dr1_A PH1308 protein, 386AA long hypothetical serine aminotransferase; PLP, structural genomics, NPPSFA; HET: PLP; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>3i4j_A Aminotransferase, class III; structural GENOMICS,NYSGXRC, target 11246C, deino radiodurans, pyridoxal phosphate, transfe PSI-2; 1.70A {Deinococcus radiodurans} Back     alignment and structure
>4eb5_A Probable cysteine desulfurase 2; scaffold, transferase-metal binding protein complex; HET: PLP EPE; 2.53A {Archaeoglobus fulgidus} PDB: 4eb7_A* Back     alignment and structure
>3b1d_A Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococcus anginosus} PDB: 3b1c_A* 3b1e_A* Back     alignment and structure
>3f6t_A Aspartate aminotransferase; YP_194538.1, STRU genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: LLP; 2.15A {Lactobacillus acidophilus ncfm} Back     alignment and structure
>1vjo_A Alanine--glyoxylate aminotransferase; 17130350, ALR1004, STR genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: PLP; 1.70A {Nostoc SP} SCOP: c.67.1.3 Back     alignment and structure
>1z7d_A Ornithine aminotransferase; structural genomics consortium, SGC, malaria; 2.10A {Plasmodium yoelii yoelii} SCOP: c.67.1.4 PDB: 3lg0_A 3ntj_A Back     alignment and structure
>4e77_A Glutamate-1-semialdehyde 2,1-aminomutase; structural genomics, center for structural genomics of infec diseases, csgid, porphyrin biosynthesis; 2.00A {Yersinia pestis} Back     alignment and structure
>3fq8_A Glutamate-1-semialdehyde 2,1-aminomutase; drug resistance, microev0lution, integrated approach, chlorophyll biosynthesis; HET: PMP; 2.00A {Synechococcus elongatus pcc 6301} SCOP: c.67.1.4 PDB: 2hp1_A* 2hoz_A* 2hoy_A* 2hp2_A* 3fq7_A* 3usf_A* 2gsa_A* 3gsb_A* 4gsa_A* 3fqa_A* 2cfb_A* Back     alignment and structure
>3a8u_X Omega-amino acid--pyruvate aminotransferase; large pleated sheet, transaminase, pyridox phosphate; HET: PLP; 1.40A {Pseudomonas putida} Back     alignment and structure
>1kmj_A Selenocysteine lyase; persulfide perselenide NIFS pyridoxal phosphate, structural PSI, protein structure initiative; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.3 PDB: 1i29_A* 1jf9_A* 1kmk_A* 1c0n_A* Back     alignment and structure
>3ffr_A Phosphoserine aminotransferase SERC; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP MSE P33; 1.75A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>4eu1_A Mitochondrial aspartate aminotransferase; ssgcid, structural genomics, SEA structural genomics center for infectious disease; HET: LLP; 2.30A {Trypanosoma brucei} Back     alignment and structure
>2oat_A Ornithine aminotransferase; 5-fluoromethylornithine, PLP-dependent ENZ pyridoxal phosphate; HET: PFM; 1.95A {Homo sapiens} SCOP: c.67.1.4 PDB: 1oat_A* 2byj_A* 2byl_A* 1gbn_A* 2can_A* Back     alignment and structure
>2z9v_A Aspartate aminotransferase; pyridoxamine, pyruvate; HET: PXM; 1.70A {Mesorhizobium loti} PDB: 2z9u_A* 2z9w_A* 2z9x_A* Back     alignment and structure
>3l44_A Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha beta class, PLP-dependent transferase-like, bacillus A csgid, porphyrin biosynthesis; HET: LLP; 2.05A {Bacillus anthracis} SCOP: c.67.1.0 Back     alignment and structure
>3k28_A Glutamate-1-semialdehyde 2,1-aminomutase 2; biosynthesis of cofactors, prosthetic groups, and carriers, csgid, cytoplasm, isomerase; HET: MSE PLP; 1.95A {Bacillus anthracis str} SCOP: c.67.1.4 PDB: 3bs8_A* Back     alignment and structure
>2huf_A Alanine glyoxylate aminotransferase; alpha and beta protein, PLP-dependent transferase; HET: LLP; 1.75A {Aedes aegypti} PDB: 2hui_A* 2huu_A* Back     alignment and structure
>1uu1_A Histidinol-phosphate aminotransferase; histidine biosynthesis, pyridoxal phosphate, complete proteome; HET: PMP HSA; 2.38A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1uu0_A 1h1c_A* 1uu2_A* 2f8j_A* Back     alignment and structure
>1eg5_A Aminotransferase; PLP-dependent enzymes, iron-sulfur-cluster synthesis, C-S BE transferase; HET: PLP; 2.00A {Thermotoga maritima} SCOP: c.67.1.3 PDB: 1ecx_A* Back     alignment and structure
>3lvm_A Cysteine desulfurase; structural genomics, montreal-kingston bacterial structural genomics initiative, BSGI, transferase; HET: PLP; 2.05A {Escherichia coli} PDB: 3lvk_A* 3lvl_B* 3lvj_A* 1p3w_B* Back     alignment and structure
>3g7q_A Valine-pyruvate aminotransferase; NP_462565.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 1.80A {Salmonella typhimurium} Back     alignment and structure
>2cy8_A D-phgat, D-phenylglycine aminotransferase; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; 2.30A {Pseudomonas stutzeri} Back     alignment and structure
>3fkd_A L-threonine-O-3-phosphate decarboxylase; structural genomic, , structural genomics, PSI-2, protein structure initiative; 2.50A {Porphyromonas gingivalis} Back     alignment and structure
>3n5m_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, csgid; 2.05A {Bacillus anthracis} Back     alignment and structure
>3qgu_A LL-diaminopimelate aminotransferase; L-lysine, pyridoxal-5' phosphate, chamydomonas reinhardtii; HET: GOL; 1.55A {Chlamydomonas reinhardtii} Back     alignment and structure
>3dod_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, biotin biosynthesis, pyridoxal phosphate, adenosyl-L-methionine; HET: PLP; 1.90A {Bacillus subtilis} SCOP: c.67.1.0 PDB: 3drd_A 3du4_A* Back     alignment and structure
>2ch1_A 3-hydroxykynurenine transaminase; PLP-enzyme, kynurenine pathway, transferase; HET: LLP; 2.4A {Anopheles gambiae} SCOP: c.67.1.3 PDB: 2ch2_A* Back     alignment and structure
>1zod_A DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, cesium, lyase; HET: MES PLP; 1.80A {Burkholderia cepacia} SCOP: c.67.1.4 PDB: 1dka_A* 1m0o_A* 1m0p_A* 1m0n_A* 1zc9_A* 1zob_A* 1m0q_A* 2dkb_A* 1dgd_A* 1dge_A* 1d7u_A* 1d7s_A* 1d7r_A* 1d7v_A* 1z3z_A* Back     alignment and structure
>3ei9_A LL-diaminopimelate aminotransferase; lysine biosynthesis, pyridoxal 5' phosphat external aldimine, chloroplast, pyridox phosphate; HET: PL6; 1.55A {Arabidopsis thaliana} PDB: 3ei8_A* 3eib_A* 3ei6_A* 2z1z_A* 3ei5_A* 2z20_A* 3ei7_A 3eia_A* Back     alignment and structure
>2epj_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.70A {Aeropyrum pernix} PDB: 2zsl_A* 2zsm_A* Back     alignment and structure
>3d6k_A Putative aminotransferase; APC82464, corynebacterium diphthe structural genomics, PSI-2, protein structure initiative; 2.00A {Corynebacterium diphtheriae} Back     alignment and structure
>3asa_A LL-diaminopimelate aminotransferase; PLP dependent aminotransferase; 2.05A {Chlamydia trachomatis} PDB: 3asb_A* Back     alignment and structure
>1m32_A 2-aminoethylphosphonate-pyruvate aminotransferase; PLP-dependent aminotransferase fold; HET: PLP; 2.20A {Salmonella typhimurium} SCOP: c.67.1.3 Back     alignment and structure
>2bkw_A Alanine-glyoxylate aminotransferase 1; analine-glyoxylate aminotransferase, pyridoxal-5-phosphate, SAD, glycolate pathway; HET: LLP; 2.57A {Saccharomyces cerevisiae} SCOP: c.67.1.3 Back     alignment and structure
>3tfu_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; transferase, transferase-transferase inhibitor complex; HET: PL8; 1.94A {Mycobacterium tuberculosis} PDB: 3tft_A* 3bv0_A* 3lv2_A* Back     alignment and structure
>4a6r_A Omega transaminase; transferase, PLP-binding enzyme, transaminase fold type I; HET: TA8; 1.35A {Chromobacterium violaceum} PDB: 4a6t_A* 4a6u_A 4a72_A* 4ah3_A* Back     alignment and structure
>3gju_A Putative aminotransferase; pyridoxal phosphate, PLP-dependent transferase-like fold, ST genomics, joint center for structural genomics, JCSG; HET: MSE LLP PLP; 1.55A {Mesorhizobium loti} PDB: 3fcr_A* Back     alignment and structure
>3oks_A 4-aminobutyrate transaminase; ssgcid, transferase, seattle structural genomics center for infectious disease; HET: LLP; 1.80A {Mycobacterium smegmatis} PDB: 3r4t_A* 3q8n_A Back     alignment and structure
>3hmu_A Aminotransferase, class III; structural genomics, pyridoxal phosphate, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi} Back     alignment and structure
>2cjg_A L-lysine-epsilon aminotransferase; internal aldimine, pyridoxal phosphate, PLP, RV3290C, lysine amino transferase; HET: PMP; 1.95A {Mycobacterium tuberculosis} PDB: 2cjd_A* 2cin_A* 2cjh_A* 2jjg_A* 2jje_A* 2jjh_A* 2jjf_A Back     alignment and structure
>1elu_A L-cysteine/L-cystine C-S lyase; FES cluster biosynthesis, pyridoxal 5'-phosphate, thiocystei aminoacrylate, enzyme-product complex; HET: PDA; 1.55A {Synechocystis SP} SCOP: c.67.1.3 PDB: 1elq_A* 1n2t_A* 1n31_A* Back     alignment and structure
>1ohv_A 4-aminobutyrate aminotransferase; PLP-dependent enzyme, 4- AMIN acid, antiepileptic drug target; HET: PLP; 2.3A {Sus scrofa} SCOP: c.67.1.4 PDB: 1ohw_A* 1ohy_A* Back     alignment and structure
>2e7j_A SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-strand, lyase, structural genomics; HET: PLP; 2.40A {Archaeoglobus fulgidus} SCOP: c.67.1.9 PDB: 2e7i_A* Back     alignment and structure
>1iug_A Putative aspartate aminotransferase; wild type, pyridoxal-5'-phosphate form, riken structural genomics/proteomics initiative, RSGI; HET: LLP; 2.20A {Thermus thermophilus} SCOP: c.67.1.3 Back     alignment and structure
>4ffc_A 4-aminobutyrate aminotransferase (GABT); structural genomics, niaid, national institute of allergy AN infectious diseases; HET: LLP; 1.80A {Mycobacterium abscessus} Back     alignment and structure
>1b9h_A AHBA synthase, protein (3-amino-5-hydroxybenzoic acid synthase); rifamycin biosynthesis (RIFD gene); HET: PLP; 2.00A {Amycolatopsis mediterranei} SCOP: c.67.1.4 PDB: 1b9i_A* Back     alignment and structure
>3i5t_A Aminotransferase; pyridoxal 5'-phosphate, PSI-2, NYSGXRC, ST genomics, protein structure initiative; HET: PLP; 2.00A {Rhodobacter sphaeroides 2} Back     alignment and structure
>3cai_A Possible aminotransferase; RV3778C; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3vax_A Putative uncharacterized protein DNDA; desulfurase, transferase; HET: PLP; 2.40A {Streptomyces lividans} Back     alignment and structure
>1v72_A Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2.05A {Pseudomonas putida} SCOP: c.67.1.1 Back     alignment and structure
>1qz9_A Kynureninase; kynurenine, tryptophan, PLP, vitamin B6, pyridoxal-5'-phosph hydrolase; HET: PLP P3G; 1.85A {Pseudomonas fluorescens} SCOP: c.67.1.3 Back     alignment and structure
>3f0h_A Aminotransferase; RER070207000802, structural genomics, JOIN for structural genomics, JCSG; HET: MSE LLP; 1.70A {Eubacterium rectale} Back     alignment and structure
>2e7u_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.90A {Thermus thermophilus} Back     alignment and structure
>3qm2_A Phosphoserine aminotransferase; structural genomics, center for structural genomics of infec diseases, csgid; 2.25A {Salmonella enterica subsp} PDB: 1bjn_A* 1bjo_A* 3qbo_A* Back     alignment and structure
>3e77_A Phosphoserine aminotransferase; SERC, PLP, structural genomi structural genomics consortium, SGC, amino-acid biosynthesi aminotransferase; HET: PLP; 2.50A {Homo sapiens} Back     alignment and structure
>1svv_A Threonine aldolase; structural genomics, structural genomics of pathogenic proto SGPP, protein structure initiative, PSI; 2.10A {Leishmania major} SCOP: c.67.1.1 Back     alignment and structure
>1j32_A Aspartate aminotransferase; HET: PLP; 2.10A {Phormidium lapideum} SCOP: c.67.1.1 Back     alignment and structure
>3a9z_A Selenocysteine lyase; PLP, cytoplasm, pyridoxal phosphate, transferase; HET: PLP SLP; 1.55A {Rattus norvegicus} PDB: 3a9x_A* 3a9y_A* 3gzd_A* 3gzc_A* 2hdy_A* Back     alignment and structure
>3dzz_A Putative pyridoxal 5'-phosphate-dependent C-S LYA; putative PLP-dependent aminotransferase; HET: MSE LLP PG4; 1.61A {Lactobacillus delbrueckii subsp} SCOP: c.67.1.0 Back     alignment and structure
>3euc_A Histidinol-phosphate aminotransferase 2; YP_297314.1, structur genomics, joint center for structural genomics, JCSG; HET: MSE; 2.05A {Ralstonia eutropha JMP134} SCOP: c.67.1.0 Back     alignment and structure
>2c0r_A PSAT, phosphoserine aminotransferase; pyridoxal-5'-phosphate, pyridine serine biosynthesis, amino-acid biosynthesis, pyridoxal phosphate; HET: PLP; 1.2A {Bacillus circulans} SCOP: c.67.1.4 PDB: 1bt4_A* 1w3u_A* Back     alignment and structure
>3tqx_A 2-amino-3-ketobutyrate coenzyme A ligase; energy metabolism, transferase; HET: PLP; 2.30A {Coxiella burnetii} Back     alignment and structure
>3ffh_A Histidinol-phosphate aminotransferase; APC88260, listeria in CLIP11262, structural genomics, PSI-2; 2.31A {Listeria innocua} SCOP: c.67.1.0 Back     alignment and structure
>3nra_A Aspartate aminotransferase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: LLP; 2.15A {Rhodobacter sphaeroides} Back     alignment and structure
>2fnu_A Aminotransferase; protein-product complex, structural genomics, montreal-kings bacterial structural genomics initiative, BSGI; HET: PMP UD1; 1.50A {Helicobacter pylori} SCOP: c.67.1.4 PDB: 2fni_A* 2fn6_A* Back     alignment and structure
>3dr4_A Putative perosamine synthetase; deoxysugar, pyridoxal phosphate, aspartate aminotransferase, O-antigen; HET: G4M; 1.60A {Caulobacter crescentus} PDB: 3dr7_A* 3bn1_A* Back     alignment and structure
>3ou5_A Serine hydroxymethyltransferase, mitochondrial; structural genomics, STRU genomics consortium, SGC; 2.04A {Homo sapiens} Back     alignment and structure
>2bwn_A 5-aminolevulinate synthase; tetrapyrrole biosynthesis, heme biosynthesis, pyridoxal PHOS dependent, transferase, acyltransferase; HET: LLP; 2.1A {Rhodobacter capsulatus} SCOP: c.67.1.4 PDB: 2bwo_A* 2bwp_A* Back     alignment and structure
>2zc0_A Alanine glyoxylate transaminase; alanine:glyoxylate aminotransferase, archaea, thermococcus L transferase; HET: PMP; 2.30A {Thermococcus litoralis} Back     alignment and structure
>3uwc_A Nucleotide-sugar aminotransferase; lipopolysaccharide biosynthesis; HET: MSE PMP; 1.80A {Coxiella burnetii} Back     alignment and structure
>3m5u_A Phosphoserine aminotransferase; alpha-beta half sandwich, csgid, amino-acid biosynthesis, cytoplasm, pyridoxal phosphate; HET: MES; 2.15A {Campylobacter jejuni} SCOP: c.67.1.0 Back     alignment and structure
>2zy4_A L-aspartate beta-decarboxylase; pyridoxal 5'-phosphate, aminotransferase, lyase; HET: PLP; 2.00A {Alcaligenes faecalis subsp} PDB: 2zy3_A* 2zy5_A* 3fdd_A* 2zy2_A* Back     alignment and structure
>1w23_A Phosphoserine aminotransferase; pyridoxal-5'-phosphate; HET: PGE PLP EPE; 1.08A {Bacillus alcalophilus} SCOP: c.67.1.4 PDB: 2bhx_A* 2bi1_A* 2bi2_A* 2bi3_A* 2bi5_A* 2bi9_A* 2bia_A* 2bie_A* 2big_A* Back     alignment and structure
>3b8x_A WBDK, pyridoxamine 5-phosphate-dependent dehydrase; aspartate aminotransferase, colitose, perosamine, O-antigen, pyridoxal phosphate,; HET: G4M; 1.70A {Escherichia coli} PDB: 2gms_A* 2gmu_A* 2r0t_A* 3gr9_A* Back     alignment and structure
>4dq6_A Putative pyridoxal phosphate-dependent transferas; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: PLP; 1.50A {Clostridium difficile} PDB: 4dgt_A* Back     alignment and structure
>2oga_A Transaminase; PLP-dependent enzyme, desosamine, deoxysugars, antibiotics, hydrolase; HET: PGU; 2.05A {Streptomyces venezuelae} PDB: 2oge_A* Back     alignment and structure
>1o69_A Aminotransferase; structural genomics, unknown function; HET: X04; 1.84A {Campylobacter jejuni} SCOP: c.67.1.4 PDB: 1o62_A 1o61_A* Back     alignment and structure
>2fyf_A PSAT, phosphoserine aminotransferase; PLP-dependent enzyme, dimer, structural genomics; HET: PLP; 1.50A {Mycobacterium tuberculosis} PDB: 3vom_A* Back     alignment and structure
>2w8t_A SPT, serine palmitoyltransferase; HET: LLP; 1.25A {Sphingomonas paucimobilis} PDB: 2w8u_A* 2w8w_A* 2xbn_A* 2w8j_A* 2w8v_A* 2jg2_A* 2jgt_A 2x8u_A* Back     alignment and structure
>3dyd_A Tyrosine aminotransferase; PLP, SGC, structural genomics, structural genomics consortium, disease mutation, phenylalani catabolism; HET: PLP; 2.30A {Homo sapiens} PDB: 3pdx_A* Back     alignment and structure
>3ke3_A Putative serine-pyruvate aminotransferase; structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP; 2.20A {Psychrobacter arcticus 273-4} Back     alignment and structure
>2vyc_A Biodegradative arginine decarboxylase; pyridoxal phosphate, PLP-dependent E lyase, acid resistance; HET: LLP; 2.4A {Escherichia coli} Back     alignment and structure
>3ly1_A Putative histidinol-phosphate aminotransferase; structural G joint center for structural genomics, JCSG; HET: MSE PLP CIT; 1.80A {Erwinia carotovora atroseptica} Back     alignment and structure
>3op7_A Aminotransferase class I and II; PLP-dependent transferase, structural genomics, joint center structural genomics, JCSG; HET: LLP UNL; 1.70A {Streptococcus suis 89} PDB: 3p6k_A* Back     alignment and structure
>1v2d_A Glutamine aminotransferase; PLP, riken structural genomics/proteomics initi RSGI, structural genomics; HET: PLP; 1.90A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1v2e_A* 1v2f_A* Back     alignment and structure
>1bw0_A TAT, protein (tyrosine aminotransferase); tyrosine catabolism, pyridoxal-5'-phosphate, PLP; HET: LLP; 2.50A {Trypanosoma cruzi} SCOP: c.67.1.1 Back     alignment and structure
>3l8a_A METC, putative aminotransferase, probable beta-cystathi; beta-cystathionase, lyase; HET: PLP; 1.54A {Streptococcus mutans} Back     alignment and structure
>2c81_A Glutamine-2-deoxy-scyllo-inosose aminotransferase; SMAT, butirosin, aminoglycoside antibiotics; HET: PMP; 1.7A {Bacillus circulans} PDB: 2c7t_A* Back     alignment and structure
>3frk_A QDTB; aminotransferase, sugar-modification, natural porduct; HET: TQP; 2.15A {Thermoanaerobacteriumthermosaccharolyticum} Back     alignment and structure
>2po3_A 4-dehydrase; external aldimine, PLP, aminotransferase, TDP-sugar; HET: T4K; 2.10A {Streptomyces venezuelae} Back     alignment and structure
>3ftb_A Histidinol-phosphate aminotransferase; structural genomics, PSI, MCSG, protein structure initiative; 2.00A {Clostridium acetobutylicum} SCOP: c.67.1.0 Back     alignment and structure
>1xi9_A Putative transaminase; alanine aminotransferase, southeast collaboratory for structural genomics, secsg; HET: PLP; 2.33A {Pyrococcus furiosus} SCOP: c.67.1.1 Back     alignment and structure
>2zyj_A Alpha-aminodipate aminotransferase; alpha-aminoadipate aminotransferase; HET: PGU; 1.67A {Thermus thermophilus} PDB: 2egy_A* 2dtv_A* 2zg5_A* 2zp7_A* 2z1y_A* 3cbf_A* Back     alignment and structure
>3piu_A 1-aminocyclopropane-1-carboxylate synthase; fruit ripening, ethylene biosynthesis, lyase, pyridoxal 5'-P binding; HET: LLP PLR; 1.35A {Malus domestica} SCOP: c.67.1.4 PDB: 1m4n_A* 1m7y_A* 1ynu_A* 1b8g_A* Back     alignment and structure
>3cq5_A Histidinol-phosphate aminotransferase; PLP, PMP, amino-acid biosynthesis, histidine biosynthesis, pyridoxal phosphate; HET: PMP; 1.80A {Corynebacterium glutamicum} PDB: 3cq6_A* 3cq4_A Back     alignment and structure
>3k7y_A Aspartate aminotransferase; aminotrans pyridoxal phosphate; HET: PLP; 2.80A {Plasmodium falciparum} SCOP: c.67.1.0 Back     alignment and structure
>1gd9_A Aspartate aminotransferase; pyridoxal enzyme, temperature dependence O substrate recognition; HET: PLP; 1.80A {Pyrococcus horikoshii} SCOP: c.67.1.1 PDB: 1gde_A* 1dju_A* Back     alignment and structure
>2dkj_A Serine hydroxymethyltransferase; PLP dependent enzyme, structural genomics; HET: PLP; 1.15A {Thermus thermophilus} Back     alignment and structure
>1vp4_A Aminotransferase, putative; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE PLP; 1.82A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>1mdo_A ARNB aminotransferase; type 1 aminotransferase fold; HET: MSE PMP; 1.70A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1mdx_A* 1mdz_A* Back     alignment and structure
>2gb3_A Aspartate aminotransferase; TM1698, structural genomics, PSI structure initiative, joint center for structural genomics; HET: LLP; 2.50A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>3g0t_A Putative aminotransferase; NP_905498.1, putative aspartate aminotransferase, structural genomics, joint center for structural genomics; HET: MSE LLP PE4; 1.75A {Porphyromonas gingivalis} Back     alignment and structure
>1fc4_A 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino-3-ketobutyrate COA ligase, pyridoxal phosphate, COEN transferase, structural genomics; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.4 Back     alignment and structure
>3fdb_A Beta C-S lyase, putative PLP-dependent beta-cystathionase; PLP-dependent transferase-like fold, structural genomics; HET: LLP; 1.99A {Corynebacterium diphtheriae} Back     alignment and structure
>1iay_A ACC synthase 2, 1-aminocyclopropane-1-carboxylate synthase 2; protein-cofactor-inhibitor complex, V6-dependent enzyme, LYA; HET: PLP AVG; 2.70A {Solanum lycopersicum} SCOP: c.67.1.4 PDB: 1iax_A* Back     alignment and structure
>1c7n_A Cystalysin; transferase, aminotransferase, pyridoxal phosphate; HET: PLP; 1.90A {Treponema denticola} SCOP: c.67.1.3 PDB: 1c7o_A* Back     alignment and structure
>3get_A Histidinol-phosphate aminotransferase; NP_281508.1, structural genomics, joint center for structural genomics; HET: LLP MSE; 2.01A {Campylobacter jejuni subsp} Back     alignment and structure
>3aow_A Putative uncharacterized protein PH0207; protein-PLP-AKG triple complex, schiff-base linkage, kynuren aminotransferase; HET: PLP AKG; 1.56A {Pyrococcus horikoshii} PDB: 3aov_A* 3ath_A* 3av7_A* 1x0m_A 1wst_A* Back     alignment and structure
>1rv3_A Serine hydroxymethyltransferase, cytosolic; one-carbon metabolism; HET: GLY PLP; 2.40A {Oryctolagus cuniculus} SCOP: c.67.1.4 PDB: 1rv4_A* 1rvu_A* 1rvy_A* 1ls3_A* 1cj0_A* 1bj4_A* 1eji_A* Back     alignment and structure
>2vi8_A Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, enzyme memory, pyridoxal phosphate, one-carbon metabolism, PLP-dependent enzymes; HET: PLP; 1.67A {Bacillus stearothermophilus} PDB: 2vi9_A* 2via_A* 2vib_A* 1kkj_A* 1kkp_A* 1kl1_A* 1kl2_A* 1yjs_A* 2w7f_A* 2w7d_A* 2w7e_A* 2w7g_A* 2w7h_A* 1yjz_A* 1yjy_A* 2vgu_A* 2vgs_A* 2vgt_A* 2vgv_A* 2vgw_A* ... Back     alignment and structure
>3gbx_A Serine hydroxymethyltransferase; structural genomics, IDP01011, serine hydroxymethyltransfera salmonella typhimurium.; HET: MSE; 1.80A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1dfo_A* 3g8m_A* 1eqb_A* Back     alignment and structure
>2yky_A Beta-transaminase; transferase; HET: PLP SFE; 1.69A {Mesorhizobium SP} PDB: 2ykv_A* 2yku_A* 2ykx_A* Back     alignment and structure
>1o4s_A Aspartate aminotransferase; TM1255, structural genomics, JCS protein structure initiative, joint center for structural G transferase; HET: PLP; 1.90A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>3a2b_A Serine palmitoyltransferase; vitamin B6-dependent enzyme fold type I, acyltransferase, PY phosphate; HET: PLP; 2.30A {Sphingobacterium multivorum} Back     alignment and structure
>1fg7_A Histidinol phosphate aminotransferase; HISC, histidine biosynthesis, pyridoxal PH montreal-kingston bacterial structural genomics initiative; HET: PMP; 1.50A {Escherichia coli} SCOP: c.67.1.1 PDB: 1fg3_A* 1gew_A* 1gex_A* 1gey_A* 1iji_A* Back     alignment and structure
>3tcm_A Alanine aminotransferase 2; pyridoxal phosphate (PLP)-binding; HET: DCS; 2.71A {Hordeum vulgare} Back     alignment and structure
>3n0l_A Serine hydroxymethyltransferase; alpha beta class, 3-layer(ABA) sandwich, CSGI transferase, structural genomics; HET: MSE; 1.80A {Campylobacter jejuni} SCOP: c.67.1.0 Back     alignment and structure
>4ao9_A Beta-phenylalanine aminotransferase; HET: PLP; 1.50A {Variovorax paradoxus} PDB: 4aoa_A* Back     alignment and structure
>2a7v_A Serine hydroxymethyltransferase; structural genomics, structural genomics consortium, SGC; 2.04A {Homo sapiens} PDB: 3ou5_A Back     alignment and structure
>1u08_A Hypothetical aminotransferase YBDL; alpha beta protein; HET: PLP; 2.35A {Escherichia coli} SCOP: c.67.1.1 Back     alignment and structure
>1c4k_A Protein (ornithine decarboxylase); lyase; HET: PLP GTP; 2.70A {Lactobacillus SP} SCOP: c.23.1.4 c.67.1.5 d.125.1.1 PDB: 1ord_A* Back     alignment and structure
>1bs0_A Protein (8-amino-7-oxonanoate synthase); PLP-dependent acyl-COA synthase, biotin biosynthesis, 8-AMIN oxonanoate synthase; 1.65A {Escherichia coli} SCOP: c.67.1.4 PDB: 2g6w_A* 1dje_A* 1dj9_A* Back     alignment and structure
>3p1t_A Putative histidinol-phosphate aminotransferase; PLP-dependent transferase-like, structural genomics, joint C structural genomics, JCSG; HET: TLA; 2.60A {Burkholderia pseudomallei} Back     alignment and structure
>2o0r_A RV0858C (N-succinyldiaminopimelate aminotransfera; PLP-binding enzyme, lysine biosynthesis, aminotransferase, S genomics; HET: LLP; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3h14_A Aminotransferase, classes I and II; YP_167802.1, SPO258 structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.90A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3kki_A CAI-1 autoinducer synthase; quorum sensing, CQSA, P virulence, acyltransferase, aminotransferase, pyridoxal PHO transferase; HET: PLP; 1.80A {Vibrio cholerae} PDB: 3hqt_A* 2wk9_A* 2wk8_A* 2wka_A* 2wk7_A Back     alignment and structure
>2x3l_A ORN/Lys/Arg decarboxylase family protein; lyase; HET: LLP; 2.00A {Staphylococcus aureus} Back     alignment and structure
>3nyt_A Aminotransferase WBPE; PLP binding, nucleotide-sugar binding; HET: ULP; 1.30A {Pseudomonas aeruginosa} PDB: 3nys_A* 3nyu_A* 3nu8_A* 3nu7_A* 3nub_A* Back     alignment and structure
>3ecd_A Serine hydroxymethyltransferase 2; ssgcid, decode, bupsa00008A, one-carbon metabolism, pyridoxa phosphate, structural genomics; 1.60A {Burkholderia pseudomallei} Back     alignment and structure
>1d2f_A MALY protein; aminotransferase fold, large PLP-binding domain, small C-TER domain, open alpha-beta structure., transferase; HET: PLP; 2.50A {Escherichia coli} SCOP: c.67.1.3 Back     alignment and structure
>1b5p_A Protein (aspartate aminotransferase); pyridoxal enzyme; HET: PLP; 1.80A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1gck_A* 1b5o_A* 5bj4_A* 1gc4_A* 1gc3_A* 1bkg_A* 5bj3_A* 1bjw_A* Back     alignment and structure
>2cb1_A O-acetyl homoserine sulfhydrylase; PLP enzyme, lyase, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: LLP; 2.0A {Thermus thermophilus} Back     alignment and structure
>3ri6_A O-acetylhomoserine sulfhydrylase; PYR 5'-phosphate, gamma-elimination, direct sulfhydrylation, CY metabolism, protein thiocarboxylate, TR; 2.20A {Wolinella succinogenes} Back     alignment and structure
>3lws_A Aromatic amino acid beta-eliminating lyase/threonine aldolase; structural genomics, joint center for structural genomics, JCSG; HET: LLP MSE; 2.00A {Exiguobacterium sibiricum} Back     alignment and structure
>2ez2_A Beta-tyrosinase, tyrosine phenol-lyase; PLP-dependent enzyme, pyridoxal-5'-phosphate, domain lyase; 1.85A {Citrobacter freundii} PDB: 2ez1_A 2vlf_A* 2vlh_A* 2yct_A* 1tpl_A 2tpl_A* 2ycn_A* 2yhk_A* 2ycp_A* 1c7g_A* Back     alignment and structure
>3bwn_A AT1G70560, L-tryptophan aminotransferase; auxin synthesis, pyridoxal-5'- phosphate, indole-3-pyruvate; HET: LLP PMP PHE; 2.25A {Arabidopsis thaliana} PDB: 3bwo_A* Back     alignment and structure
>3ele_A Amino transferase; RER070207001803, structural genomics, JOI for structural genomics, JCSG; HET: MSE PLP; 2.10A {Eubacterium rectale} Back     alignment and structure
>2dou_A Probable N-succinyldiaminopimelate aminotransfera; PLP-dependent enzyme, structural genomics, NPPSFA; HET: EPE; 2.30A {Thermus thermophilus} Back     alignment and structure
>3fvs_A Kynurenine--oxoglutarate transaminase 1; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: LLP; 1.50A {Homo sapiens} SCOP: c.67.1.1 PDB: 3fvu_A* 3fvx_A* 1w7l_A* 1w7m_A* 1w7n_A* Back     alignment and structure
>1gc0_A Methionine gamma-lyase; pyridoxal-5'-phosphate; HET: LLP; 1.70A {Pseudomonas putida} SCOP: c.67.1.3 PDB: 1gc2_A* 1pg8_A* 1ukj_A* 2o7c_A* Back     alignment and structure
>3pj0_A LMO0305 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology, lyase; HET: LLP MSE; 1.80A {Listeria monocytogenes} Back     alignment and structure
>1cs1_A CGS, protein (cystathionine gamma-synthase); lyase, LLP-dependent enzymes, methionine biosynthesis; HET: LLP DHD; 1.50A {Escherichia coli} SCOP: c.67.1.3 Back     alignment and structure
>3ju7_A Putative PLP-dependent aminotransferase; NP_978343.1, struct genomics, joint center for structural genomics, JCSG; HET: LLP PGE; 2.19A {Bacillus cereus atcc 10987} Back     alignment and structure
>1yiz_A Kynurenine aminotransferase; glutamine transaminase; kynurenic acid, mosquito, PLP-enzyme, pyridoxal phosphate, PLP; HET: LLP; 1.55A {Aedes aegypti} SCOP: c.67.1.1 PDB: 1yiy_A* 2r5c_A* 2r5e_A* Back     alignment and structure
>1ax4_A Tryptophanase; tryptophan biosynthesis, tryptophan indole-lyase, pyridoxal 5'-phosphate, monovalent cation binding site; HET: LLP; 2.10A {Proteus vulgaris} SCOP: c.67.1.2 Back     alignment and structure
>1e5e_A MGL, methionine gamma-lyase; methionine biosynthesis, PLP-dependent enzymes, C-S gamma lyase; HET: PPJ; 2.18A {Trichomonas vaginalis} SCOP: c.67.1.3 PDB: 1e5f_A* Back     alignment and structure
>2rfv_A Methionine gamma-lyase; pyridoxal-5'-phosphate, PLP-dependent enzyme; HET: LLP; 1.35A {Citrobacter freundii} PDB: 1y4i_A* 3jwa_A* 3jw9_A* 3jwb_A* 3mkj_A* Back     alignment and structure
>3ihj_A Alanine aminotransferase 2; helix, structural genomics, structural genomics consortium, pyridoxal phosphate; HET: PLP; 2.30A {Homo sapiens} Back     alignment and structure
>2z61_A Probable aspartate aminotransferase 2; amino acid aminotransferase, kynurenine aminotransferase, MJ0684, cytoplasm; HET: LLP; 2.20A {Methanococcus jannaschii} Back     alignment and structure
>3hdo_A Histidinol-phosphate aminotransferase; PSI-II, histidinol-phosphate aminotrans structural genomics, protein structure initiative; 1.61A {Geobacter metallireducens gs-15} Back     alignment and structure
>1qgn_A Protein (cystathionine gamma-synthase); methionine biosynthesis, pyridoxal 5'-phosphate, gamma-famil; HET: PLP; 2.90A {Nicotiana tabacum} SCOP: c.67.1.3 PDB: 1i41_A* 1i48_A* 1i43_A* Back     alignment and structure
>1jg8_A L-ALLO-threonine aldolase; glycine biosynthesis, pyridoxal-5'- phosphate, calcium binding site, structural genomics, PSI; HET: LLP; 1.80A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1lw4_A* 1lw5_A* 1m6s_A* 2fm1_A* Back     alignment and structure
>2r2n_A Kynurenine/alpha-aminoadipate aminotransferase mitochondrial; alpha & beta protein, PLP-dependent transferase, aminotransf mitochondrion; HET: PMP KYN; 1.95A {Homo sapiens} PDB: 2qlr_A* 3dc1_A* 3ue8_A* 2vgz_A* 2xh1_A* Back     alignment and structure
>3ez1_A Aminotransferase MOCR family; YP_604413.1, struct genomics, joint center for structural genomics, JCSG; 2.60A {Deinococcus geothermalis dsm 11300} Back     alignment and structure
>3qhx_A Cystathionine gamma-synthase METB (CGS); structural genomics, seattle structural genomics center for infectious disease, ssgcid, CGS_LIKE; HET: LLP EPE; 1.65A {Mycobacterium ulcerans} SCOP: c.67.1.0 PDB: 3qi6_A* Back     alignment and structure
>4atq_A 4-aminobutyrate transaminase; transferase; HET: PLP; 2.75A {Arthrobacter aurescens} PDB: 4atp_A* Back     alignment and structure
>1lc5_A COBD, L-threonine-O-3-phosphate decarboxylase; PLP-dependent decarboxylase cobalamin, lyase; 1.46A {Salmonella enterica} SCOP: c.67.1.1 PDB: 1lc7_A* 1lc8_A* 1lkc_A* Back     alignment and structure
>3h7f_A Serine hydroxymethyltransferase 1; cytoplasm, one-carbon metabolism, pyridoxal phosphate, structural genomics; HET: LLP; 1.50A {Mycobacterium tuberculosis} Back     alignment and structure
>3e2y_A Kynurenine-oxoglutarate transaminase 3; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: GLN PMP; 2.26A {Mus musculus} SCOP: c.67.1.0 PDB: 2zjg_A* 3e2f_A* 3e2z_A* Back     alignment and structure
>2x5d_A Probable aminotransferase; HET: LLP PLP; 2.25A {Pseudomonas aeruginosa} Back     alignment and structure
>2o1b_A Aminotransferase, class I; aminotrasferase; HET: PLP; 1.95A {Staphylococcus aureus} Back     alignment and structure
>4e3q_A Pyruvate transaminase; aminotransferase, transferase; HET: PMP; 1.90A {Vibrio fluvialis} PDB: 4e3r_A* 3nui_A Back     alignment and structure
>3ndn_A O-succinylhomoserine sulfhydrylase; seattle structural genomics center for infectious disease, S mycobacterium, PLP, schiff base; HET: LLP; 1.85A {Mycobacterium tuberculosis} Back     alignment and structure
>2oqx_A Tryptophanase; lyase, pyridoxal phosphate, tryptophan catabolism; HET: CME EPE; 1.90A {Escherichia coli} SCOP: c.67.1.2 PDB: 2c44_A 2v1p_A* 2v0y_A* Back     alignment and structure
>3ppl_A Aspartate aminotransferase; dimer, PLP-dependent transferase-like fold structural genomics, joint center for structural genomics; HET: MSE PLP UNL; 1.25A {Corynebacterium glutamicum} Back     alignment and structure
>2ctz_A O-acetyl-L-homoserine sulfhydrylase; crystal, O-acetyl homoserine sulfhydrase, structural genomic structural genomics/proteomics initiative; HET: PLP; 2.60A {Thermus thermophilus} SCOP: c.67.1.3 Back     alignment and structure
>3if2_A Aminotransferase; YP_265399.1, structura genomics, joint center for structural genomics, JCSG, prote structure initiative, PSI-2; HET: PLP; 2.50A {Psychrobacter arcticus 273-4} Back     alignment and structure
>3rq1_A Aminotransferase class I and II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta structure, cytosol; HET: AKG GOL; 2.20A {Veillonella parvula} Back     alignment and structure
>2ord_A Acoat, acetylornithine aminotransferase; TM1785, acetylornithine aminotransferase (EC 2.6.1.11) (ACOA structural genomics; HET: MSE PLP; 1.40A {Thermotoga maritima MSB8} PDB: 2e54_A* Back     alignment and structure
>4a0g_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; BIO3-BIO1, biotin synthesis; HET: PLP; 2.50A {Arabidopsis thaliana} PDB: 4a0h_A* 4a0r_A* 4a0f_A* Back     alignment and structure
>1sff_A 4-aminobutyrate aminotransferase; enzyme complexes; HET: IK2; 1.90A {Escherichia coli} SCOP: c.67.1.4 PDB: 1sf2_A* 1szk_A* 1szu_A* 1szs_A* Back     alignment and structure
>2x5f_A Aspartate_tyrosine_phenylalanine pyridoxal-5' phosphate-dependent aminotransferase...; HET: PLP EPE; 1.80A {Staphylococcus aureus} Back     alignment and structure
>3fkd_A L-threonine-O-3-phosphate decarboxylase; structural genomic, , structural genomics, PSI-2, protein structure initiative; 2.50A {Porphyromonas gingivalis} Back     alignment and structure
>3ezs_A Aminotransferase ASPB; NP_207418.1, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 2.19A {Helicobacter pylori 26695} SCOP: c.67.1.0 Back     alignment and structure
>3d6k_A Putative aminotransferase; APC82464, corynebacterium diphthe structural genomics, PSI-2, protein structure initiative; 2.00A {Corynebacterium diphtheriae} Back     alignment and structure
>3b46_A Aminotransferase BNA3; kynurenine aminotransferase, LLP, PLP, cytoplasm, mitochondrion, pyridoxal phosphate; HET: LLP; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3nmy_A Xometc, cystathionine gamma-lyase-like protein; Cys-Met metabolism PLP-dependent enzyme family, CYST gamma lyase, pyridoxal-phosphate; HET: PLP; 2.07A {Xanthomonas oryzae PV} SCOP: c.67.1.0 PDB: 3e6g_A* 3nnp_A* Back     alignment and structure
>1uu1_A Histidinol-phosphate aminotransferase; histidine biosynthesis, pyridoxal phosphate, complete proteome; HET: PMP HSA; 2.38A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1uu0_A 1h1c_A* 1uu2_A* 2f8j_A* Back     alignment and structure
>3jtx_A Aminotransferase; NP_283882.1, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; HET: LLP MES; 1.91A {Neisseria meningitidis Z2491} Back     alignment and structure
>3b1d_A Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococcus anginosus} PDB: 3b1c_A* 3b1e_A* Back     alignment and structure
>1vef_A Acetylornithine/acetyl-lysine aminotransferase; PLP, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: PLP; 1.35A {Thermus thermophilus} SCOP: c.67.1.4 PDB: 1wkg_A* 1wkh_A* Back     alignment and structure
>4h51_A Aspartate aminotransferase; ssgcid, structural genomics, seattle struc genomics center for infectious disease, aspartate aminotran transferase; HET: LLP; 1.85A {Leishmania major} Back     alignment and structure
>1ajs_A Aspartate aminotransferase; PIG, in the presence of ligand 2-methylaspartate; HET: LLP PLA; 1.60A {Sus scrofa} SCOP: c.67.1.1 PDB: 1ajr_A* 3ii0_A* 1aat_A 2cst_A* Back     alignment and structure
>3fsl_A Aromatic-amino-acid aminotransferase; tyrosine aminotransferase, pyridoxal phosphate, internal ALD schiff base, amino-acid biosynthesis; HET: PLR; 2.35A {Escherichia coli k-12} SCOP: c.67.1.1 PDB: 3tat_A* Back     alignment and structure
>3i16_A Aluminum resistance protein; YP_878183.1, carbon-sulfur lyase involved in aluminum resist structural genomics; HET: MSE TLA PLP; 2.00A {Clostridium novyi} PDB: 3gwp_A* Back     alignment and structure
>2hox_A ALLIIN lyase 1; cysteine sulphoxide lyase, ALLIINASE; HET: NAG FUC BMA P1T; 1.40A {Allium sativum} SCOP: c.67.1.1 PDB: 2hor_A* 1lk9_A* Back     alignment and structure
>3ruy_A Ornithine aminotransferase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha and beta protein; HET: LLP; 2.65A {Bacillus anthracis} SCOP: c.67.1.0 Back     alignment and structure
>3acz_A Methionine gamma-lyase; L-methionine; HET: LLP; 1.97A {Entamoeba histolytica} PDB: 3aej_A* 3ael_A* 3aem_A* 3aen_A* 3aeo_A* 3aep_A* Back     alignment and structure
>2eh6_A Acoat, acetylornithine aminotransferase; ARGD, structural genomics, NPPSFA, national project on prote structural and functional analyses; HET: PLP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3cog_A Cystathionine gamma-lyase; CTH, PLP, propargylglycine, SGC, inhibitor, structural genom stockholm, structural genomics consortium; HET: PLP; 2.00A {Homo sapiens} PDB: 2nmp_A* 3elp_B Back     alignment and structure
>4f4e_A Aromatic-amino-acid aminotransferase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: LLP; 1.80A {Burkholderia pseudomallei} PDB: 4eff_A* Back     alignment and structure
>3g7q_A Valine-pyruvate aminotransferase; NP_462565.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 1.80A {Salmonella typhimurium} Back     alignment and structure
>1ibj_A CBL, cystathionine beta-lyase; PLP-dependent enzyme, methionine biosynthesis, transsulfurat lyase; HET: PLP; 2.30A {Arabidopsis thaliana} SCOP: c.67.1.3 Back     alignment and structure
>3jzl_A Putative cystathionine beta-lyase involved in ALU resistance; putative cystathionine beta-lyase involved in aluminum resis structural genomics; HET: LLP; 1.91A {Listeria monocytogenes str} PDB: 3fd0_A* Back     alignment and structure
>4adb_A Succinylornithine transaminase; transferase, PLP enzymes, aminotransferase; HET: PLP; 2.20A {Escherichia coli} PDB: 4adc_A* 4add_A* 4ade_A Back     alignment and structure
>3ei9_A LL-diaminopimelate aminotransferase; lysine biosynthesis, pyridoxal 5' phosphat external aldimine, chloroplast, pyridox phosphate; HET: PL6; 1.55A {Arabidopsis thaliana} PDB: 3ei8_A* 3eib_A* 3ei6_A* 2z1z_A* 3ei5_A* 2z20_A* 3ei7_A 3eia_A* Back     alignment and structure
>2eo5_A 419AA long hypothetical aminotransferase; PLP enzyme, structural genomics, NPPSFA, N project on protein structural and functional analyses; HET: PLP; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>1pff_A Methionine gamma-lyase; homocysteine; 2.50A {Trichomonas vaginalis} SCOP: c.67.1.3 Back     alignment and structure
>3qgu_A LL-diaminopimelate aminotransferase; L-lysine, pyridoxal-5' phosphate, chamydomonas reinhardtii; HET: GOL; 1.55A {Chlamydomonas reinhardtii} Back     alignment and structure
>2pb2_A Acetylornithine/succinyldiaminopimelate aminotran; ARGD, pyridoxal 5'-phosphate, arginine metabolism, lysine biosynthesis, gabaculine; HET: PLP; 1.91A {Salmonella typhimurium} PDB: 2pb0_A* Back     alignment and structure
>2ay1_A Aroat, aromatic amino acid aminotransferase; HET: PLP AHC; 2.20A {Paracoccus denitrificans} SCOP: c.67.1.1 PDB: 1ay5_A* 1ay4_A* 1ay8_A* 2ay2_A* 2ay3_A* 2ay4_A* 2ay5_A* 2ay6_A* 2ay7_A* 2ay8_A* 2ay9_A* Back     alignment and structure
>2aeu_A Hypothetical protein MJ0158; selenocysteine synthase, PLP, pyridoxal phosphate, HOMO- oligomerization, unknown function; 1.70A {Methanocaldococcus jannaschii} SCOP: c.67.1.8 PDB: 2aev_A* Back     alignment and structure
>3f6t_A Aspartate aminotransferase; YP_194538.1, STRU genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: LLP; 2.15A {Lactobacillus acidophilus ncfm} Back     alignment and structure
>3dxv_A Alpha-amino-epsilon-caprolactam racemase; fold-TYPE1, pyridoxal-5'-phosphate dependent racemase, pyrid phosphate, isomerase; HET: PLP; 2.21A {Achromobacter obae} PDB: 2zuk_A* 3dxw_A* Back     alignment and structure
>1yaa_A Aspartate aminotransferase; HET: PLP; 2.05A {Saccharomyces cerevisiae} SCOP: c.67.1.1 Back     alignment and structure
>1n8p_A Cystathionine gamma-lyase; three open alpha/beta structures; HET: PLP; 2.60A {Saccharomyces cerevisiae} SCOP: c.67.1.3 Back     alignment and structure
>3ht4_A Aluminum resistance protein; lyase, putative cystathionine BEAT-lyase, aluminium resistance protein, Q81A77_baccr, NESG, BCR213; 2.90A {Bacillus cereus atcc 14579} Back     alignment and structure
>3hvy_A Cystathionine beta-lyase family protein, YNBB B.S ortholog; NP_348457.1, putative cystathionine beta-lyase involved in A resistance; HET: LLP MSE; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>3nx3_A Acoat, acetylornithine aminotransferase; csgid, structural genomics, center for structural genomics O infectious diseases; 1.80A {Campylobacter jejuni subsp} Back     alignment and structure
>3n75_A LDC, lysine decarboxylase, inducible; pyridoxal-5'-phosphate dependent decarboxylase, acid stress stringent response; HET: LLP G4P P6G; 2.00A {Escherichia coli} PDB: 3q16_A* Back     alignment and structure
>2oat_A Ornithine aminotransferase; 5-fluoromethylornithine, PLP-dependent ENZ pyridoxal phosphate; HET: PFM; 1.95A {Homo sapiens} SCOP: c.67.1.4 PDB: 1oat_A* 2byj_A* 2byl_A* 1gbn_A* 2can_A* Back     alignment and structure
>2q7w_A Aspartate aminotransferase; mechanism-based inhibitor, PLP, sadta, PH dependence; HET: KST PSZ PMP GOL; 1.40A {Escherichia coli} SCOP: c.67.1.1 PDB: 2qa3_A* 2qb2_A* 2qb3_A* 2qbt_A* 3qn6_A* 3pa9_A* 1aaw_A* 1amq_A* 1ams_A* 1arg_A* 1amr_A* 1art_A* 1asa_A* 1asd_A* 1ase_A* 1asl_A* 1asm_A* 1asn_A* 1c9c_A* 1cq6_A* ... Back     alignment and structure
>1z7d_A Ornithine aminotransferase; structural genomics consortium, SGC, malaria; 2.10A {Plasmodium yoelii yoelii} SCOP: c.67.1.4 PDB: 3lg0_A 3ntj_A Back     alignment and structure
>2cjg_A L-lysine-epsilon aminotransferase; internal aldimine, pyridoxal phosphate, PLP, RV3290C, lysine amino transferase; HET: PMP; 1.95A {Mycobacterium tuberculosis} PDB: 2cjd_A* 2cin_A* 2cjh_A* 2jjg_A* 2jje_A* 2jjh_A* 2jjf_A Back     alignment and structure
>3a8u_X Omega-amino acid--pyruvate aminotransferase; large pleated sheet, transaminase, pyridox phosphate; HET: PLP; 1.40A {Pseudomonas putida} Back     alignment and structure
>1zod_A DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, cesium, lyase; HET: MES PLP; 1.80A {Burkholderia cepacia} SCOP: c.67.1.4 PDB: 1dka_A* 1m0o_A* 1m0p_A* 1m0n_A* 1zc9_A* 1zob_A* 1m0q_A* 2dkb_A* 1dgd_A* 1dge_A* 1d7u_A* 1d7s_A* 1d7r_A* 1d7v_A* 1z3z_A* Back     alignment and structure
>3meb_A Aspartate aminotransferase; pyridoxal PHOS transferase, structural genomics, seattle structural genomi for infectious disease, ssgcid; HET: PLP; 1.90A {Giardia lamblia} Back     alignment and structure
>3l44_A Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha beta class, PLP-dependent transferase-like, bacillus A csgid, porphyrin biosynthesis; HET: LLP; 2.05A {Bacillus anthracis} SCOP: c.67.1.0 Back     alignment and structure
>1s0a_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; fold type I, subclass II, homodimer; HET: LLP; 1.71A {Escherichia coli} SCOP: c.67.1.4 PDB: 1qj5_A* 1mlz_A* 1qj3_A* 1mly_A* 1s06_A* 1s08_A* 1s09_A* 1s07_A* 1mgv_A* 1dty_A* Back     alignment and structure
>4eu1_A Mitochondrial aspartate aminotransferase; ssgcid, structural genomics, SEA structural genomics center for infectious disease; HET: LLP; 2.30A {Trypanosoma brucei} Back     alignment and structure
>3asa_A LL-diaminopimelate aminotransferase; PLP dependent aminotransferase; 2.05A {Chlamydia trachomatis} PDB: 3asb_A* Back     alignment and structure
>2fq6_A Cystathionine beta-lyase; protein-inhibitor complex, PLP cofactor covalently bound to inhibitor; HET: P3F; 1.78A {Escherichia coli} SCOP: c.67.1.3 PDB: 2gqn_A* 1cl1_A* 1cl2_A* Back     alignment and structure
>1ohv_A 4-aminobutyrate aminotransferase; PLP-dependent enzyme, 4- AMIN acid, antiepileptic drug target; HET: PLP; 2.3A {Sus scrofa} SCOP: c.67.1.4 PDB: 1ohw_A* 1ohy_A* Back     alignment and structure
>7aat_A Aspartate aminotransferase; transferase(aminotransferase); HET: PLP; 1.90A {Gallus gallus} SCOP: c.67.1.1 PDB: 1ivr_A* 1map_A* 1maq_A* 1oxo_A* 1oxp_A* 1ama_A* 1tas_A* 1tat_A* 1tar_A* 8aat_A* 9aat_A* 1aka_A* 1akb_A* 1akc_A* 3pd6_A* 3hlm_A* 3pdb_A* Back     alignment and structure
>3gju_A Putative aminotransferase; pyridoxal phosphate, PLP-dependent transferase-like fold, ST genomics, joint center for structural genomics, JCSG; HET: MSE LLP PLP; 1.55A {Mesorhizobium loti} PDB: 3fcr_A* Back     alignment and structure
>3hmu_A Aminotransferase, class III; structural genomics, pyridoxal phosphate, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi} Back     alignment and structure
>3dod_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, biotin biosynthesis, pyridoxal phosphate, adenosyl-L-methionine; HET: PLP; 1.90A {Bacillus subtilis} SCOP: c.67.1.0 PDB: 3drd_A 3du4_A* Back     alignment and structure
>3i4j_A Aminotransferase, class III; structural GENOMICS,NYSGXRC, target 11246C, deino radiodurans, pyridoxal phosphate, transfe PSI-2; 1.70A {Deinococcus radiodurans} Back     alignment and structure
>3n5m_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, csgid; 2.05A {Bacillus anthracis} Back     alignment and structure
>3ou5_A Serine hydroxymethyltransferase, mitochondrial; structural genomics, STRU genomics consortium, SGC; 2.04A {Homo sapiens} Back     alignment and structure
>3tfu_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; transferase, transferase-transferase inhibitor complex; HET: PL8; 1.94A {Mycobacterium tuberculosis} PDB: 3tft_A* 3bv0_A* 3lv2_A* Back     alignment and structure
>3oks_A 4-aminobutyrate transaminase; ssgcid, transferase, seattle structural genomics center for infectious disease; HET: LLP; 1.80A {Mycobacterium smegmatis} PDB: 3r4t_A* 3q8n_A Back     alignment and structure
>3k28_A Glutamate-1-semialdehyde 2,1-aminomutase 2; biosynthesis of cofactors, prosthetic groups, and carriers, csgid, cytoplasm, isomerase; HET: MSE PLP; 1.95A {Bacillus anthracis str} SCOP: c.67.1.4 PDB: 3bs8_A* Back     alignment and structure
>2epj_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.70A {Aeropyrum pernix} PDB: 2zsl_A* 2zsm_A* Back     alignment and structure
>2hox_A ALLIIN lyase 1; cysteine sulphoxide lyase, ALLIINASE; HET: NAG FUC BMA P1T; 1.40A {Allium sativum} SCOP: c.67.1.1 PDB: 2hor_A* 1lk9_A* Back     alignment and structure
>4ffc_A 4-aminobutyrate aminotransferase (GABT); structural genomics, niaid, national institute of allergy AN infectious diseases; HET: LLP; 1.80A {Mycobacterium abscessus} Back     alignment and structure
>3fq8_A Glutamate-1-semialdehyde 2,1-aminomutase; drug resistance, microev0lution, integrated approach, chlorophyll biosynthesis; HET: PMP; 2.00A {Synechococcus elongatus pcc 6301} SCOP: c.67.1.4 PDB: 2hp1_A* 2hoz_A* 2hoy_A* 2hp2_A* 3fq7_A* 3usf_A* 2gsa_A* 3gsb_A* 4gsa_A* 3fqa_A* 2cfb_A* Back     alignment and structure
>2cy8_A D-phgat, D-phenylglycine aminotransferase; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; 2.30A {Pseudomonas stutzeri} Back     alignment and structure
>4a6r_A Omega transaminase; transferase, PLP-binding enzyme, transaminase fold type I; HET: TA8; 1.35A {Chromobacterium violaceum} PDB: 4a6t_A* 4a6u_A 4a72_A* 4ah3_A* Back     alignment and structure
>4e77_A Glutamate-1-semialdehyde 2,1-aminomutase; structural genomics, center for structural genomics of infec diseases, csgid, porphyrin biosynthesis; 2.00A {Yersinia pestis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 764
d1js3a_ 476 c.67.1.6 (A:) DOPA decarboxylase {Pig (Sus scrofa) 1e-97
d1js3a_476 c.67.1.6 (A:) DOPA decarboxylase {Pig (Sus scrofa) 3e-33
d1pmma_ 450 c.67.1.6 (A:) Glutamate decarboxylase beta, GadB { 5e-33
d2z67a1 434 c.67.1.9 (A:1-434) Selenocysteinyl-tRNA synthase ( 2e-25
d3bc8a1 445 c.67.1.9 (A:23-467) Selenocysteinyl-tRNA synthase 3e-24
>d1js3a_ c.67.1.6 (A:) DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823]} Length = 476 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: PLP-dependent transferase-like
superfamily: PLP-dependent transferases
family: Pyridoxal-dependent decarboxylase
domain: DOPA decarboxylase
species: Pig (Sus scrofa) [TaxId: 9823]

 Score =  309 bits (791), Expect = 1e-97
 Identities = 174/312 (55%), Positives = 229/312 (73%)

Query: 453 EEFREFGKAAIDFIADYVDNIRERPVLPSVEPGYLASLVPGEMPEEGEDWRHIMRDMNTV 512
            +FR  GK  +D++ADY++ I  R V P V+PGYL  L+P   P+E + +  I++D+  +
Sbjct: 4   SDFRRRGKEMVDYMADYLEGIEGRQVYPDVQPGYLRPLIPATAPQEPDTFEDILQDVEKI 63

Query: 513 IMPGITHWQSPQFNAYFPTGSSYPSIVGDMLSGAFGLIGFSWLSSPACTELEVLVMNWLG 572
           IMPG+THW SP F AYFPT SSYP+++ DML GA G IGFSW +SPACTELE ++M+WLG
Sbjct: 64  IMPGVTHWHSPYFFAYFPTASSYPAMLADMLCGAIGCIGFSWAASPACTELETVMMDWLG 123

Query: 573 KALGLPEEFLNCSPGPGGGIIQSTASEATLVSILVAKRKMINHWQSKNPSLTENDIRNKL 632
           K L LPE FL    G GGG+IQ +ASEATLV++L A+ K++   Q+ +P LT+  +  KL
Sbjct: 124 KMLQLPEAFLAGEAGEGGGVIQGSASEATLVALLAARTKVVRRLQAASPGLTQGAVLEKL 183

Query: 633 VAYTSDQSNSSVEKSAIIGDVPVRQLRSDDNGVLRGDALLTAVKEDLAKGLIPCCLIATL 692
           VAY SDQ++SSVE++ +IG V ++ + SD    +R  AL  A++ D A GLIP  ++ATL
Sbjct: 184 VAYASDQAHSSVERAGLIGGVKLKAIPSDGKFAMRASALQEALERDKAAGLIPFFVVATL 243

Query: 693 GTTGTCAFDNLEELGPICQEYNIWLHVDAAYAGSALLLPEYAHLKRGLEYVDSFDFNTHK 752
           GTT  C+FDNL E+GPIC E +IWLHVDAAYAGSA + PE+ HL  G+E+ DSF+FN HK
Sbjct: 244 GTTSCCSFDNLLEVGPICHEEDIWLHVDAAYAGSAFICPEFRHLLNGVEFADSFNFNPHK 303

Query: 753 WLLVNFDCSAMW 764
           WLLVNFDCSAMW
Sbjct: 304 WLLVNFDCSAMW 315
>d1js3a_ c.67.1.6 (A:) DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823]} Length = 476 Back     information, alignment and structure
>d1pmma_ c.67.1.6 (A:) Glutamate decarboxylase beta, GadB {Escherichia coli [TaxId: 562]} Length = 450 Back     information, alignment and structure
>d2z67a1 c.67.1.9 (A:1-434) Selenocysteinyl-tRNA synthase (SepSecS) {Methanococcus maripaludis [TaxId: 39152]} Length = 434 Back     information, alignment and structure
>d3bc8a1 c.67.1.9 (A:23-467) Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mus musculus) [TaxId: 10090]} Length = 445 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query764
d1js3a_ 476 DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823] 100.0
d1js3a_476 DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823] 100.0
d1pmma_ 450 Glutamate decarboxylase beta, GadB {Escherichia co 100.0
d1pmma_450 Glutamate decarboxylase beta, GadB {Escherichia co 99.98
d3bc8a1 445 Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mu 99.96
d2z67a1 434 Selenocysteinyl-tRNA synthase (SepSecS) {Methanoco 99.93
d2e7ja1 364 Selenocysteinyl-tRNA synthase (SepSecS) {Archaeogl 99.77
d1jf9a_ 405 NifS-like protein/selenocysteine lyase {Escherichi 99.77
d1p3wa_ 391 Cysteine desulfurase IscS {Escherichia coli [TaxId 99.74
d2z67a1434 Selenocysteinyl-tRNA synthase (SepSecS) {Methanoco 99.74
d1elua_ 381 Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 99.72
d3bc8a1445 Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mu 99.71
d1t3ia_ 408 Probable cysteine desulfurase SufS {Synechocystis 99.71
d1eg5a_ 376 NifS-like protein/selenocysteine lyase {Thermotoga 99.66
d1c4ka2 462 Ornithine decarboxylase major domain {Lactobacillu 99.6
d1qz9a_ 404 Kynureninase {Pseudomonas fluorescens [TaxId: 294] 99.52
d1h0ca_ 388 Alanine-glyoxylate aminotransferase {Human (Homo s 99.51
d1m32a_ 361 2-aminoethylphosphonate transaminase {Salmonella t 99.42
d1v72a1 345 Phenylserine aldolase PSALD {Pseudomonas putida [T 99.3
d2v1pa1 467 Tryptophan indol-lyase (tryptophanase) {Escherichi 99.28
d2bkwa1 382 Alanine-glyoxylate aminotransferase {Baker's yeast 99.27
d1vjoa_ 377 Alanine-glyoxylate aminotransferase {Cyanobacteria 99.26
d2ch1a1 388 3-hydroxykynurenine transaminase {Malaria mosquito 99.23
d1mdoa_ 376 Aminotransferase ArnB {Salmonella typhimurium [Tax 99.17
d1ax4a_ 465 Tryptophan indol-lyase (tryptophanase) {Proteus vu 99.15
d1m6sa_ 343 Low-specificity threonine aldolase {Thermotoga mar 99.06
d1c7ga_ 456 Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 5 99.05
d1b9ha_ 384 3-amino-5-hydroxybenzoic acid synthase (AHBA synth 99.01
d1svva_ 340 Low-specificity threonine aldolase {Leishmania maj 99.0
d1elua_381 Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 98.97
d2e7ja1364 Selenocysteinyl-tRNA synthase (SepSecS) {Archaeogl 98.97
d2aeua1 366 Hypothetical protein MJ0158 {Archaeon Methanococcu 98.96
d1fc4a_ 401 2-amino-3-ketobutyrate CoA ligase {Escherichia col 98.95
d1v72a1345 Phenylserine aldolase PSALD {Pseudomonas putida [T 98.92
d1gdea_ 388 Aromatic aminoacid aminotransferase, AroAT {Archae 98.91
d1iuga_ 348 Subgroup IV putative aspartate aminotransferase {T 98.84
d1jf9a_405 NifS-like protein/selenocysteine lyase {Escherichi 98.78
d1j32a_ 388 Aspartate aminotransferase, AAT {Phormidium lapide 98.77
d1iaya_ 428 1-aminocyclopropane-1-carboxylate synthase (ACC sy 98.76
d1bs0a_ 383 PLP-dependent acyl-CoA synthase (8-amino-7-oxonano 98.74
d1b5pa_ 382 Aspartate aminotransferase, AAT {Thermus thermophi 98.74
d2c0ra1 361 Phosphoserine aminotransferase, PSAT {Bacillus cir 98.72
d2fnua1 371 Spore coat polysaccharide biosynthesis protein C { 98.71
d1m7ya_ 431 1-aminocyclopropane-1-carboxylate synthase (ACC sy 98.69
d1v2da_ 368 Glutamine aminotransferase {Thermus thermophilus [ 98.69
d1d2fa_ 361 Modulator in mal gene expression, MalY {Escherichi 98.67
d1wsta1 403 Multiple substrate aminotransferase, MSAT {Thermoc 98.67
d1t3ia_408 Probable cysteine desulfurase SufS {Synechocystis 98.61
d2bwna1 396 5-aminolevulinate synthase {Rhodobacter capsulatus 98.6
d1dfoa_ 416 Serine hydroxymethyltransferase {Escherichia coli 98.59
d1p3wa_391 Cysteine desulfurase IscS {Escherichia coli [TaxId 98.59
d1o69a_ 374 Aminotransferase homolog WlaK (PglE, Cj1121c) {Cam 98.58
d1wyub1 471 Glycine dehydrogenase subunit 2 (P-protein) {Therm 98.54
d1wyua1 437 Glycine dehydrogenase (decarboxylating) subunit 1 98.53
d1bjna_ 360 Phosphoserine aminotransferase, PSAT {Escherichia 98.53
d1w23a_ 360 Phosphoserine aminotransferase, PSAT {Bacillus alc 98.51
d1vp4a_ 420 Putative aminotransferase TM1131 {Thermotoga marit 98.5
d1qz9a_404 Kynureninase {Pseudomonas fluorescens [TaxId: 294] 98.5
d1kl1a_ 405 Serine hydroxymethyltransferase {Bacillus stearoth 98.49
d1xi9a_ 395 Putative alanine aminotransferase {Pyrococcus furi 98.47
d1bw0a_ 412 Tyrosine aminotransferase (TAT) {Trypanosoma cruzi 98.43
d1h0ca_388 Alanine-glyoxylate aminotransferase {Human (Homo s 98.41
d1eg5a_376 NifS-like protein/selenocysteine lyase {Thermotoga 98.34
d1rv3a_ 470 Serine hydroxymethyltransferase {Rabbit (Oryctolag 98.31
d1c7na_ 394 Cystalysin {Treponema denticola [TaxId: 158]} 98.3
d2a7va1 463 Serine hydroxymethyltransferase {Human (Homo sapie 98.25
d2r5ea1 418 Kynurenine--oxoglutarate transaminase I {Yellowfev 98.23
d1o4sa_ 375 Aspartate aminotransferase, AAT {Thermotoga mariti 98.18
d1u08a_ 382 Putative methionine aminotransferase YdbL {Escheri 98.13
d1w7la_ 418 Kynurenine--oxoglutarate transaminase I {Human (Ho 98.13
d1lc5a_ 355 L-threonine-O-3-phosphate decarboxylase CobD {Salm 98.12
d1svva_340 Low-specificity threonine aldolase {Leishmania maj 98.06
d1fg7a_ 354 Histidinol-phosphate aminotransferase HisC {Escher 98.03
d2gb3a1 389 AAT homologue TM1698 {Thermotoga maritima [TaxId: 98.02
d1gc0a_ 392 Methionine gamma-lyase, MGL {Pseudomonas putida [T 97.93
d2ay1a_ 394 Aromatic aminoacid aminotransferase, AroAT {Paraco 97.87
d1wyua1437 Glycine dehydrogenase (decarboxylating) subunit 1 97.86
d1y4ia1 397 Methionine gamma-lyase, MGL {Citrobacter freundii 97.86
d1m6sa_343 Low-specificity threonine aldolase {Thermotoga mar 97.86
d1c4ka2462 Ornithine decarboxylase major domain {Lactobacillu 97.82
d7aata_ 401 Aspartate aminotransferase, AAT {Chicken (Gallus g 97.72
d2q7wa1 396 Aspartate aminotransferase, AAT {Escherichia coli 97.66
d1fc4a_401 2-amino-3-ketobutyrate CoA ligase {Escherichia col 97.66
d1ajsa_ 412 Aspartate aminotransferase, AAT {Pig (Sus scrofa), 97.66
d1wyub1471 Glycine dehydrogenase subunit 2 (P-protein) {Therm 97.63
d1ibja_ 380 Cystathionine beta-lyase, CBL {Thale cress (Arabid 97.63
d1m32a_361 2-aminoethylphosphonate transaminase {Salmonella t 97.6
d2ch1a1388 3-hydroxykynurenine transaminase {Malaria mosquito 97.6
d1vjoa_377 Alanine-glyoxylate aminotransferase {Cyanobacteria 97.57
d1yaaa_ 412 Aspartate aminotransferase, AAT {Baker's yeast (Sa 97.46
d2f8ja1 334 Histidinol-phosphate aminotransferase HisC {Thermo 97.46
d1qgna_ 398 Cystathionine gamma-synthase, CGS {Common tobacco 97.45
d1cs1a_ 384 Cystathionine gamma-synthase, CGS {Escherichia col 97.45
d2bkwa1382 Alanine-glyoxylate aminotransferase {Baker's yeast 97.41
d1bs0a_383 PLP-dependent acyl-CoA synthase (8-amino-7-oxonano 97.38
d2ctza1 421 O-acetyl-L-homoserine sulfhydrylase {Thermus therm 97.36
d1vefa1 387 Acetylornithine/acetyl-lysine aminotransferase Arg 97.16
d2bwna1396 5-aminolevulinate synthase {Rhodobacter capsulatus 97.13
d2byla1 404 Ornithine aminotransferase {Human (Homo sapiens) [ 97.11
d3tata_ 397 Aromatic aminoacid aminotransferase, AroAT {Escher 97.08
d1pffa_ 331 Methionine gamma-lyase, MGL {Trichomonas vaginalis 97.06
d2v1pa1467 Tryptophan indol-lyase (tryptophanase) {Escherichi 96.94
d2gsaa_ 427 Glutamate-1-semialdehyde aminomutase (aminotransfe 96.92
d1cl1a_ 391 Cystathionine beta-lyase, CBL {Escherichia coli [T 96.83
d1e5ea_ 394 Methionine gamma-lyase, MGL {Trichomonas vaginalis 96.74
d1n8pa_ 393 Cystathionine gamma-lyase (CYS3) {Baker's yeast (S 96.73
d1j32a_388 Aspartate aminotransferase, AAT {Phormidium lapide 96.67
d1s0aa_ 429 Adenosylmethionine-8-amino-7-oxononanoate aminotra 96.63
d1zoda1 431 Dialkylglycine decarboxylase {Pseudomonas cepacia 96.62
d1bw0a_412 Tyrosine aminotransferase (TAT) {Trypanosoma cruzi 96.61
d1bjna_360 Phosphoserine aminotransferase, PSAT {Escherichia 96.47
d1fg7a_354 Histidinol-phosphate aminotransferase HisC {Escher 96.37
d1z7da1 404 Ornithine aminotransferase {Plasmodium yoelii yoel 96.3
d1sffa_ 425 4-aminobutyrate aminotransferase, GABA-aminotransf 96.3
d1d2fa_361 Modulator in mal gene expression, MalY {Escherichi 96.18
d1lc5a_355 L-threonine-O-3-phosphate decarboxylase CobD {Salm 96.04
d1dfoa_416 Serine hydroxymethyltransferase {Escherichia coli 96.01
d1iaya_428 1-aminocyclopropane-1-carboxylate synthase (ACC sy 95.85
d1ohwa_ 461 4-aminobutyrate aminotransferase, GABA-aminotransf 95.85
d1v2da_368 Glutamine aminotransferase {Thermus thermophilus [ 95.77
d1m7ya_431 1-aminocyclopropane-1-carboxylate synthase (ACC sy 95.48
d1vp4a_420 Putative aminotransferase TM1131 {Thermotoga marit 95.47
d1kl1a_405 Serine hydroxymethyltransferase {Bacillus stearoth 95.45
d1mdoa_376 Aminotransferase ArnB {Salmonella typhimurium [Tax 95.37
d1gdea_388 Aromatic aminoacid aminotransferase, AroAT {Archae 95.36
d1c7ga_456 Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 5 95.36
d2c0ra1361 Phosphoserine aminotransferase, PSAT {Bacillus cir 95.25
d1b9ha_384 3-amino-5-hydroxybenzoic acid synthase (AHBA synth 95.23
d1iuga_348 Subgroup IV putative aspartate aminotransferase {T 95.16
d1wsta1403 Multiple substrate aminotransferase, MSAT {Thermoc 95.02
d1xi9a_395 Putative alanine aminotransferase {Pyrococcus furi 94.66
d1ax4a_465 Tryptophan indol-lyase (tryptophanase) {Proteus vu 94.58
d2f8ja1334 Histidinol-phosphate aminotransferase HisC {Thermo 94.21
d1rv3a_470 Serine hydroxymethyltransferase {Rabbit (Oryctolag 94.05
d2a7va1463 Serine hydroxymethyltransferase {Human (Homo sapie 93.8
d1b5pa_382 Aspartate aminotransferase, AAT {Thermus thermophi 92.97
d2aeua1366 Hypothetical protein MJ0158 {Archaeon Methanococcu 92.05
d1w23a_360 Phosphoserine aminotransferase, PSAT {Bacillus alc 91.98
d1y4ia1397 Methionine gamma-lyase, MGL {Citrobacter freundii 90.43
d1c7na_394 Cystalysin {Treponema denticola [TaxId: 158]} 90.22
d1u08a_382 Putative methionine aminotransferase YdbL {Escheri 89.8
d1cs1a_384 Cystathionine gamma-synthase, CGS {Escherichia col 89.2
d2hoxa1 425 Alliinase {Garlic (Allium sativum) [TaxId: 4682]} 88.22
d1e5ea_394 Methionine gamma-lyase, MGL {Trichomonas vaginalis 87.58
d2fnua1371 Spore coat polysaccharide biosynthesis protein C { 86.07
d1o4sa_375 Aspartate aminotransferase, AAT {Thermotoga mariti 80.71
>d1js3a_ c.67.1.6 (A:) DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: PLP-dependent transferase-like
superfamily: PLP-dependent transferases
family: Pyridoxal-dependent decarboxylase
domain: DOPA decarboxylase
species: Pig (Sus scrofa) [TaxId: 9823]

Probab=100.00  E-value=6.7e-67  Score=592.24  Aligned_cols=315  Identities=55%  Similarity=1.022  Sum_probs=300.1

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHhcCCCCCCCCCChhhHhhcCCCCCCCCCCCHHHHHHHHHHHHcCCCCCCCCCcccccc
Q psy13453        450 PPNEEFREFGKAAIDFIADYVDNIRERPVLPSVEPGYLASLVPGEMPEEGEDWRHIMRDMNTVIMPGITHWQSPQFNAYF  529 (764)
Q Consensus       450 ~~~~~~~~~~~~~v~~i~~y~~~~~~~~v~~~~~p~~l~~~l~~~lP~~g~~~~~il~~l~~~i~~~~~~~~~P~~~~~~  529 (764)
                      ||+|+||+.+++++|.+.+|+++++++||.|...|+++++.++..+|++|++++++++++.+.+.+++++|+||+||+|+
T Consensus         1 m~~~~fr~~~~~~~d~i~d~~~~~~~~~v~~~~~p~~l~~~~~~~~P~~g~~~~~~l~~~~~~i~~~~~~~~~P~f~~~~   80 (476)
T d1js3a_           1 MNASDFRRRGKEMVDYMADYLEGIEGRQVYPDVQPGYLRPLIPATAPQEPDTFEDILQDVEKIIMPGVTHWHSPYFFAYF   80 (476)
T ss_dssp             CCHHHHHHHHHHHHHHHHHHHHTGGGSCSSCCCCTTCSGGGSCSSCCSSCCCHHHHHHHHHHTTGGGCCCTTSTTBCSSS
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHhhccCCCCCCCChHHHHHhcCcccCcCCCCHHHHHHHHHHHHhCCCCCCCCCCeeEeC
Confidence            79999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCChHHHHHHHHHHhhcccCccccCCchHHHHHHHHHHHHHHHcCCCccccCCCCCCCcEEEeCChHHHHHHHHHHHH
Q psy13453        530 PTGSSYPSIVGDMLSGAFGLIGFSWLSSPACTELEVLVMNWLGKALGLPEEFLNCSPGPGGGIIQSTASEATLVSILVAK  609 (764)
Q Consensus       530 ~~~~~~~~~lad~l~~~lN~n~~~~~~sp~~t~lE~~v~~~la~llG~p~~~~~~~~~~~~GvfTsGgTeANl~Al~aAR  609 (764)
                      ++++++++++|+++++.+|+|+..|+.||++++||+++++||++++|+|++|.......++|+||+|||+||++|+++||
T Consensus        81 ~~~~~~~~~l~~~~~~~~n~n~~~~~~sp~~t~iE~~v~~wl~~l~g~p~~~~~~~~~~~~G~~~~Ggs~anl~al~~AR  160 (476)
T d1js3a_          81 PTASSYPAMLADMLCGAIGCIGFSWAASPACTELETVMMDWLGKMLQLPEAFLAGEAGEGGGVIQGSASEATLVALLAAR  160 (476)
T ss_dssp             CCCCCHHHHHHHHHHHHHCCCCSSGGGCHHHHHHHHHHHHHHHHHTTCCGGGCCTTTCSCEEEEESCHHHHHHHHHHHHH
T ss_pred             CCCCCHHHHHHHHHHHhhcccccchhhhhhHHHHHHHHHHHHHHHhCCCcccccCCCCCCCceECCcHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999877656667899999999999999999999


Q ss_pred             HHHhhhhccCCCCCccccccCceEEEecCCcchhHHHHHHhCCCceEEEecCCCCcccHHHHHHHHHHhhhcCCCceEEE
Q psy13453        610 RKMINHWQSKNPSLTENDIRNKLVAYTSDQSNSSVEKSAIIGDVPVRQLRSDDNGVLRGDALLTAVKEDLAKGLIPCCLI  689 (764)
Q Consensus       610 ~~~~~~~~~~~~~~~~~~~~~~~vi~~S~~aH~Sv~kAa~~lGl~v~~Vp~d~~g~md~~~Le~~I~~~~~~G~~p~~Vv  689 (764)
                      ++++++.+..+.++.+.+..+++++|+|+++|||+.|||.++|++++.||+|++|+||+++|+++|++++++|..|++||
T Consensus       161 ~~~~~~~~~~~~g~~~~~~~~~~vv~~s~~~H~Si~ka~~~lGl~~~~v~~d~~~~md~~~L~~~i~~~~~~g~~p~~Vv  240 (476)
T d1js3a_         161 TKVVRRLQAASPGLTQGAVLEKLVAYASDQAHSSVERAGLIGGVKLKAIPSDGKFAMRASALQEALERDKAAGLIPFFVV  240 (476)
T ss_dssp             HHHHHHHHHHSTTCCHHHHHHHEEEEEETTCCHHHHHHHHHHTCEEEEECCCTTSCCCHHHHHHHHHHHHHTTCEEEEEE
T ss_pred             HHHHHhhcccccCcccccccCceEEEecccccHHHHHHHHhcCceEEEeccCCCCCcCHHHHHHHHHHHHhcCCCcEEEe
Confidence            99887755444444444455789999999999999999999999999999999999999999999999999999999999


Q ss_pred             EeeccCCccccccHHHHHHHHHhcCCEEEEeccccccccccchhhhhhcCCCcccEEEEcCCccCCCCcCceeeC
Q psy13453        690 ATLGTTGTCAFDNLEELGPICQEYNIWLHVDAAYAGSALLLPEYAHLKRGLEYVDSFDFNTHKWLLVNFDCSAMW  764 (764)
Q Consensus       690 ataGTT~~GaiDpl~eIa~i~~~~glwLHVDaA~Gg~~l~~~~~r~~l~gie~aDSit~d~HK~l~~P~~~g~l~  764 (764)
                      +|+|||.+|+||||++|++||++||+||||||||||+++++++++++++|+++||||++|+|||+++|++||+++
T Consensus       241 ataGtt~~G~iDpl~~I~~i~~~~~~wlHVDAA~Gg~~~~~~~~~~~~~gi~~aDSit~d~HK~l~~P~~~g~~l  315 (476)
T d1js3a_         241 ATLGTTSCCSFDNLLEVGPICHEEDIWLHVDAAYAGSAFICPEFRHLLNGVEFADSFNFNPHKWLLVNFDCSAMW  315 (476)
T ss_dssp             EEBSCTTTCCBCCHHHHHHHHHHTTCEEEEECTTGGGGGGSTTTGGGGTTGGGCSEEEECHHHHSSCCSSCEEEE
T ss_pred             ecCCCccceeeccHHHHHHHHHhcCcEEEEecccchhhhhhcchhhhhcCCcccceeeecCccccccCCcceeec
Confidence            999999999999999999999999999999999999999999999999999999999999999999999999985
>d1js3a_ c.67.1.6 (A:) DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1pmma_ c.67.1.6 (A:) Glutamate decarboxylase beta, GadB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pmma_ c.67.1.6 (A:) Glutamate decarboxylase beta, GadB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3bc8a1 c.67.1.9 (A:23-467) Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2z67a1 c.67.1.9 (A:1-434) Selenocysteinyl-tRNA synthase (SepSecS) {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d2e7ja1 c.67.1.9 (A:8-371) Selenocysteinyl-tRNA synthase (SepSecS) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1jf9a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p3wa_ c.67.1.3 (A:) Cysteine desulfurase IscS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2z67a1 c.67.1.9 (A:1-434) Selenocysteinyl-tRNA synthase (SepSecS) {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1elua_ c.67.1.3 (A:) Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 1143]} Back     information, alignment and structure
>d3bc8a1 c.67.1.9 (A:23-467) Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t3ia_ c.67.1.3 (A:) Probable cysteine desulfurase SufS {Synechocystis sp. PCC 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1eg5a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1c4ka2 c.67.1.5 (A:108-569) Ornithine decarboxylase major domain {Lactobacillus sp., strain 30a [TaxId: 1591]} Back     information, alignment and structure
>d1qz9a_ c.67.1.3 (A:) Kynureninase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1h0ca_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m32a_ c.67.1.3 (A:) 2-aminoethylphosphonate transaminase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1v72a1 c.67.1.1 (A:6-350) Phenylserine aldolase PSALD {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2v1pa1 c.67.1.2 (A:5-471) Tryptophan indol-lyase (tryptophanase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bkwa1 c.67.1.3 (A:3-384) Alanine-glyoxylate aminotransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vjoa_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Cyanobacteria (Nostoc sp. pcc 7120) [TaxId: 103690]} Back     information, alignment and structure
>d2ch1a1 c.67.1.3 (A:2-389) 3-hydroxykynurenine transaminase {Malaria mosquito (Anopheles gambiae) [TaxId: 7165]} Back     information, alignment and structure
>d1mdoa_ c.67.1.4 (A:) Aminotransferase ArnB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ax4a_ c.67.1.2 (A:) Tryptophan indol-lyase (tryptophanase) {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d1m6sa_ c.67.1.1 (A:) Low-specificity threonine aldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1c7ga_ c.67.1.2 (A:) Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 549]} Back     information, alignment and structure
>d1b9ha_ c.67.1.4 (A:) 3-amino-5-hydroxybenzoic acid synthase (AHBA synthase) {Amycolatopsis mediterranei [TaxId: 33910]} Back     information, alignment and structure
>d1svva_ c.67.1.1 (A:) Low-specificity threonine aldolase {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1elua_ c.67.1.3 (A:) Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 1143]} Back     information, alignment and structure
>d2e7ja1 c.67.1.9 (A:8-371) Selenocysteinyl-tRNA synthase (SepSecS) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2aeua1 c.67.1.8 (A:9-374) Hypothetical protein MJ0158 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1fc4a_ c.67.1.4 (A:) 2-amino-3-ketobutyrate CoA ligase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v72a1 c.67.1.1 (A:6-350) Phenylserine aldolase PSALD {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1gdea_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1iuga_ c.67.1.3 (A:) Subgroup IV putative aspartate aminotransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jf9a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j32a_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1iaya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Tomato (Lycopersicon esculentum) [TaxId: 4081]} Back     information, alignment and structure
>d1bs0a_ c.67.1.4 (A:) PLP-dependent acyl-CoA synthase (8-amino-7-oxonanoate synthase, AONS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b5pa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2c0ra1 c.67.1.4 (A:2-362) Phosphoserine aminotransferase, PSAT {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]} Back     information, alignment and structure
>d2fnua1 c.67.1.4 (A:2-372) Spore coat polysaccharide biosynthesis protein C {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1m7ya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Apple (Malus domestica) [TaxId: 3750]} Back     information, alignment and structure
>d1v2da_ c.67.1.1 (A:) Glutamine aminotransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1d2fa_ c.67.1.3 (A:) Modulator in mal gene expression, MalY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wsta1 c.67.1.1 (A:13-415) Multiple substrate aminotransferase, MSAT {Thermococcus profundus [TaxId: 49899]} Back     information, alignment and structure
>d1t3ia_ c.67.1.3 (A:) Probable cysteine desulfurase SufS {Synechocystis sp. PCC 6803 [TaxId: 1148]} Back     information, alignment and structure
>d2bwna1 c.67.1.4 (A:2-397) 5-aminolevulinate synthase {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1dfoa_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p3wa_ c.67.1.3 (A:) Cysteine desulfurase IscS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o69a_ c.67.1.4 (A:) Aminotransferase homolog WlaK (PglE, Cj1121c) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1wyub1 c.67.1.7 (B:2-472) Glycine dehydrogenase subunit 2 (P-protein) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wyua1 c.67.1.7 (A:1-437) Glycine dehydrogenase (decarboxylating) subunit 1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1bjna_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w23a_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Bacillus alcalophilus [TaxId: 1445]} Back     information, alignment and structure
>d1vp4a_ c.67.1.1 (A:) Putative aminotransferase TM1131 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qz9a_ c.67.1.3 (A:) Kynureninase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1kl1a_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1xi9a_ c.67.1.1 (A:) Putative alanine aminotransferase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1bw0a_ c.67.1.1 (A:) Tyrosine aminotransferase (TAT) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1h0ca_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eg5a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1rv3a_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1c7na_ c.67.1.3 (A:) Cystalysin {Treponema denticola [TaxId: 158]} Back     information, alignment and structure
>d2a7va1 c.67.1.4 (A:26-488) Serine hydroxymethyltransferase {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
>d2r5ea1 c.67.1.1 (A:12-429) Kynurenine--oxoglutarate transaminase I {Yellowfever mosquito (Aedes aegypti) [TaxId: 7159]} Back     information, alignment and structure
>d1o4sa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1u08a_ c.67.1.1 (A:) Putative methionine aminotransferase YdbL {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w7la_ c.67.1.1 (A:) Kynurenine--oxoglutarate transaminase I {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lc5a_ c.67.1.1 (A:) L-threonine-O-3-phosphate decarboxylase CobD {Salmonella enterica [TaxId: 28901]} Back     information, alignment and structure
>d1svva_ c.67.1.1 (A:) Low-specificity threonine aldolase {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1fg7a_ c.67.1.1 (A:) Histidinol-phosphate aminotransferase HisC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gb3a1 c.67.1.1 (A:4-392) AAT homologue TM1698 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gc0a_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2ay1a_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1wyua1 c.67.1.7 (A:1-437) Glycine dehydrogenase (decarboxylating) subunit 1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1y4ia1 c.67.1.3 (A:2-398) Methionine gamma-lyase, MGL {Citrobacter freundii [TaxId: 546]} Back     information, alignment and structure
>d1m6sa_ c.67.1.1 (A:) Low-specificity threonine aldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1c4ka2 c.67.1.5 (A:108-569) Ornithine decarboxylase major domain {Lactobacillus sp., strain 30a [TaxId: 1591]} Back     information, alignment and structure
>d7aata_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Chicken (Gallus gallus), mitochondria [TaxId: 9031]} Back     information, alignment and structure
>d2q7wa1 c.67.1.1 (A:1-396) Aspartate aminotransferase, AAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fc4a_ c.67.1.4 (A:) 2-amino-3-ketobutyrate CoA ligase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ajsa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Pig (Sus scrofa), cytosolic form [TaxId: 9823]} Back     information, alignment and structure
>d1wyub1 c.67.1.7 (B:2-472) Glycine dehydrogenase subunit 2 (P-protein) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ibja_ c.67.1.3 (A:) Cystathionine beta-lyase, CBL {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1m32a_ c.67.1.3 (A:) 2-aminoethylphosphonate transaminase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2ch1a1 c.67.1.3 (A:2-389) 3-hydroxykynurenine transaminase {Malaria mosquito (Anopheles gambiae) [TaxId: 7165]} Back     information, alignment and structure
>d1vjoa_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Cyanobacteria (Nostoc sp. pcc 7120) [TaxId: 103690]} Back     information, alignment and structure
>d1yaaa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Baker's yeast (Saccharomyces cerevisiae), cytosolic form [TaxId: 4932]} Back     information, alignment and structure
>d2f8ja1 c.67.1.1 (A:1-334) Histidinol-phosphate aminotransferase HisC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qgna_ c.67.1.3 (A:) Cystathionine gamma-synthase, CGS {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1cs1a_ c.67.1.3 (A:) Cystathionine gamma-synthase, CGS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bkwa1 c.67.1.3 (A:3-384) Alanine-glyoxylate aminotransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bs0a_ c.67.1.4 (A:) PLP-dependent acyl-CoA synthase (8-amino-7-oxonanoate synthase, AONS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ctza1 c.67.1.3 (A:1-421) O-acetyl-L-homoserine sulfhydrylase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vefa1 c.67.1.4 (A:9-395) Acetylornithine/acetyl-lysine aminotransferase ArgD {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2bwna1 c.67.1.4 (A:2-397) 5-aminolevulinate synthase {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d2byla1 c.67.1.4 (A:36-439) Ornithine aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3tata_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pffa_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Trichomonas vaginalis, MGL2 [TaxId: 5722]} Back     information, alignment and structure
>d2v1pa1 c.67.1.2 (A:5-471) Tryptophan indol-lyase (tryptophanase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gsaa_ c.67.1.4 (A:) Glutamate-1-semialdehyde aminomutase (aminotransferase) {Synechococcus sp., strain GR6 [TaxId: 1131]} Back     information, alignment and structure
>d1cl1a_ c.67.1.3 (A:) Cystathionine beta-lyase, CBL {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e5ea_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Trichomonas vaginalis, MGL1 [TaxId: 5722]} Back     information, alignment and structure
>d1n8pa_ c.67.1.3 (A:) Cystathionine gamma-lyase (CYS3) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1j32a_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1s0aa_ c.67.1.4 (A:) Adenosylmethionine-8-amino-7-oxononanoate aminotransferase, BioA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zoda1 c.67.1.4 (A:3-433) Dialkylglycine decarboxylase {Pseudomonas cepacia [TaxId: 292]} Back     information, alignment and structure
>d1bw0a_ c.67.1.1 (A:) Tyrosine aminotransferase (TAT) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1bjna_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fg7a_ c.67.1.1 (A:) Histidinol-phosphate aminotransferase HisC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z7da1 c.67.1.4 (A:7-410) Ornithine aminotransferase {Plasmodium yoelii yoelii [TaxId: 73239]} Back     information, alignment and structure
>d1sffa_ c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GABA-aminotransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d2fa_ c.67.1.3 (A:) Modulator in mal gene expression, MalY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lc5a_ c.67.1.1 (A:) L-threonine-O-3-phosphate decarboxylase CobD {Salmonella enterica [TaxId: 28901]} Back     information, alignment and structure
>d1dfoa_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iaya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Tomato (Lycopersicon esculentum) [TaxId: 4081]} Back     information, alignment and structure
>d1ohwa_ c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GABA-aminotransferase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1v2da_ c.67.1.1 (A:) Glutamine aminotransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1m7ya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Apple (Malus domestica) [TaxId: 3750]} Back     information, alignment and structure
>d1vp4a_ c.67.1.1 (A:) Putative aminotransferase TM1131 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1kl1a_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1mdoa_ c.67.1.4 (A:) Aminotransferase ArnB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1gdea_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1c7ga_ c.67.1.2 (A:) Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 549]} Back     information, alignment and structure
>d2c0ra1 c.67.1.4 (A:2-362) Phosphoserine aminotransferase, PSAT {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]} Back     information, alignment and structure
>d1b9ha_ c.67.1.4 (A:) 3-amino-5-hydroxybenzoic acid synthase (AHBA synthase) {Amycolatopsis mediterranei [TaxId: 33910]} Back     information, alignment and structure
>d1iuga_ c.67.1.3 (A:) Subgroup IV putative aspartate aminotransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wsta1 c.67.1.1 (A:13-415) Multiple substrate aminotransferase, MSAT {Thermococcus profundus [TaxId: 49899]} Back     information, alignment and structure
>d1xi9a_ c.67.1.1 (A:) Putative alanine aminotransferase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ax4a_ c.67.1.2 (A:) Tryptophan indol-lyase (tryptophanase) {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d2f8ja1 c.67.1.1 (A:1-334) Histidinol-phosphate aminotransferase HisC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1rv3a_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2a7va1 c.67.1.4 (A:26-488) Serine hydroxymethyltransferase {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
>d1b5pa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2aeua1 c.67.1.8 (A:9-374) Hypothetical protein MJ0158 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1w23a_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Bacillus alcalophilus [TaxId: 1445]} Back     information, alignment and structure
>d1y4ia1 c.67.1.3 (A:2-398) Methionine gamma-lyase, MGL {Citrobacter freundii [TaxId: 546]} Back     information, alignment and structure
>d1c7na_ c.67.1.3 (A:) Cystalysin {Treponema denticola [TaxId: 158]} Back     information, alignment and structure
>d1u08a_ c.67.1.1 (A:) Putative methionine aminotransferase YdbL {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cs1a_ c.67.1.3 (A:) Cystathionine gamma-synthase, CGS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hoxa1 c.67.1.1 (A:1-425) Alliinase {Garlic (Allium sativum) [TaxId: 4682]} Back     information, alignment and structure
>d1e5ea_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Trichomonas vaginalis, MGL1 [TaxId: 5722]} Back     information, alignment and structure
>d2fnua1 c.67.1.4 (A:2-372) Spore coat polysaccharide biosynthesis protein C {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1o4sa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure