Psyllid ID: psy13471
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 249 | ||||||
| 91094683 | 305 | PREDICTED: similar to AGAP002108-PA [Tri | 0.899 | 0.734 | 0.432 | 6e-51 | |
| 307177270 | 674 | Dual specificity protein phosphatase 12 | 0.983 | 0.363 | 0.411 | 5e-50 | |
| 322795350 | 413 | hypothetical protein SINV_16127 [Solenop | 0.983 | 0.593 | 0.409 | 5e-50 | |
| 328702253 | 321 | PREDICTED: dual specificity protein phos | 0.963 | 0.747 | 0.395 | 2e-49 | |
| 239789543 | 321 | ACYPI001406 [Acyrthosiphon pisum] | 0.963 | 0.747 | 0.395 | 2e-49 | |
| 332022453 | 344 | Dual specificity protein phosphatase 12 | 0.983 | 0.712 | 0.398 | 8e-49 | |
| 307215495 | 352 | Dual specificity protein phosphatase 12 | 0.983 | 0.696 | 0.382 | 4e-48 | |
| 383865415 | 347 | PREDICTED: dual specificity protein phos | 0.971 | 0.697 | 0.381 | 1e-47 | |
| 340711217 | 341 | PREDICTED: dual specificity protein phos | 0.967 | 0.706 | 0.387 | 3e-47 | |
| 350411808 | 341 | PREDICTED: dual specificity protein phos | 0.967 | 0.706 | 0.379 | 2e-46 |
| >gi|91094683|ref|XP_967470.1| PREDICTED: similar to AGAP002108-PA [Tribolium castaneum] gi|270016501|gb|EFA12947.1| hypothetical protein TcasGA2_TC005067 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
Score = 206 bits (525), Expect = 6e-51, Method: Compositional matrix adjust.
Identities = 105/243 (43%), Positives = 151/243 (62%), Gaps = 19/243 (7%)
Query: 5 VEENLYLGDLNDAMGLKSSNEANIKFVFSIGIFPTLGKISSL---TYRHIEVADLPSEDL 61
+E NL+LG L+ A + + I + +I P KI L T ++I+++D P EDL
Sbjct: 19 IEPNLFLGSLSAAKDVDTLARYKITHILTIDTCPLPRKILELKHITTKYIQLSDQPKEDL 78
Query: 62 LSHFDSAYEFIRESQSEGAILVHCYHGVSRSATIVIAYLMKRDDLGVQTAFDRVKSARDV 121
LSHFD A FI E ++GA+LVHCY GVSRSA++VIAY+MK+ +L + AF++VK+ R +
Sbjct: 79 LSHFDDAGAFILEGVTKGAVLVHCYFGVSRSASVVIAYVMKKYELSYKEAFEKVKAKRGL 138
Query: 122 ISPNEGFMHQLALYQRMRMTLDLNFTPYKLYKLKRLSQIVKDVRLVPSSYGELIKADPGL 181
+ PN GF+ QL LY+ M +D N YKL++L + VK V+++P ++ +LIK DPGL
Sbjct: 139 VYPNHGFVSQLHLYKEMGYKIDPNNMKYKLFRLNVAANHVKKVKILPQNFMDLIKFDPGL 198
Query: 182 TSNRPNPNVYKCKKCRRVLFTLNNIFAHNRGVKFTWKCQEDGVPPSDSELCKEKIFIEPL 241
T +P PNVY+CKKCRRVL + +N+ H G E+C + F+EPL
Sbjct: 199 TQTQPEPNVYRCKKCRRVLASESNLMTHKVG----------------GEVCTKTYFLEPL 242
Query: 242 VWM 244
WM
Sbjct: 243 AWM 245
|
Source: Tribolium castaneum Species: Tribolium castaneum Genus: Tribolium Family: Tenebrionidae Order: Coleoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|307177270|gb|EFN66448.1| Dual specificity protein phosphatase 12 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|322795350|gb|EFZ18155.1| hypothetical protein SINV_16127 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|328702253|ref|XP_001945515.2| PREDICTED: dual specificity protein phosphatase 12-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|239789543|dbj|BAH71388.1| ACYPI001406 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|332022453|gb|EGI62761.1| Dual specificity protein phosphatase 12 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|307215495|gb|EFN90147.1| Dual specificity protein phosphatase 12 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|383865415|ref|XP_003708169.1| PREDICTED: dual specificity protein phosphatase 12-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|340711217|ref|XP_003394175.1| PREDICTED: dual specificity protein phosphatase 12-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|350411808|ref|XP_003489460.1| PREDICTED: dual specificity protein phosphatase 12-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 249 | ||||||
| FB|FBgn0031044 | 387 | MKP-4 "MAPK Phosphatase 4" [Dr | 0.823 | 0.529 | 0.354 | 3.6e-40 | |
| UNIPROTKB|Q2QY35 | 356 | LOC_Os12g03990 "Os12g0133700 p | 0.799 | 0.558 | 0.351 | 5.7e-36 | |
| UNIPROTKB|Q2RAU9 | 356 | Os11g0136800 "Os11g0136800 pro | 0.795 | 0.556 | 0.354 | 7.2e-36 | |
| UNIPROTKB|F1MW70 | 345 | DUSP12 "Uncharacterized protei | 0.967 | 0.698 | 0.318 | 2.3e-30 | |
| MGI|MGI:1890614 | 339 | Dusp12 "dual specificity phosp | 0.967 | 0.710 | 0.335 | 6.2e-30 | |
| UNIPROTKB|F1S1C7 | 340 | LOC100626531 "Uncharacterized | 0.967 | 0.708 | 0.326 | 7.9e-30 | |
| RGD|68375 | 339 | Dusp12 "dual specificity phosp | 0.967 | 0.710 | 0.332 | 1e-29 | |
| UNIPROTKB|I3LL40 | 327 | I3LL40 "Uncharacterized protei | 0.843 | 0.642 | 0.345 | 2.1e-29 | |
| ZFIN|ZDB-GENE-050626-91 | 305 | dusp12 "dual specificity phosp | 0.951 | 0.777 | 0.316 | 1.5e-28 | |
| UNIPROTKB|Q9UNI6 | 340 | DUSP12 "Dual specificity prote | 0.967 | 0.708 | 0.322 | 3.9e-28 |
| FB|FBgn0031044 MKP-4 "MAPK Phosphatase 4" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 392 (143.0 bits), Expect = 3.6e-40, Sum P(2) = 3.6e-40
Identities = 74/209 (35%), Positives = 130/209 (62%)
Query: 5 VEENLYLGDLNDAMGLKSSNEANIKFVFSIGIFPTLGKI---SSLTYRHIEVADLPSEDL 61
V+ L+LG+L A +++ I + ++ P I S LT ++I++AD+P ED+
Sbjct: 42 VDTGLFLGNLTAATHMETLRSFKITHILTLDSVPLPQHILEASFLTTKYIQIADMPREDI 101
Query: 62 LSHFDSAYEFIRESQSE-GAILVHCYHGVSRSATIVIAYLMKRDDLGVQTAFDRVKSARD 120
L H + +FI + ++ G +LVHCY GVSRS++ VIAY+MKR +L A++ VK+ R
Sbjct: 102 LQHLEGCVDFISSALAQQGNVLVHCYFGVSRSSSTVIAYMMKRHNLDFLPAYELVKAKRR 161
Query: 121 VISPNEGFMHQLALYQRMRMTLDLNFTPYKLYKLKRLSQIVKDVRLVPSSYGELIKADPG 180
+ PN GF+ QL L++RM +D N YK+++L+ + ++ +++P S+ +++ DP
Sbjct: 162 FVQPNAGFVSQLKLFRRMGCKIDPNCQRYKIHRLRLAGEQMRKAKILPQSFHSVVRPDPD 221
Query: 181 LTSNRPNPNVYKCKKCRRVLFTLNNIFAH 209
+T P P V++C++CRRVL + +++ H
Sbjct: 222 ITRENPEPIVFRCRRCRRVLASKSHVLEH 250
|
|
| UNIPROTKB|Q2QY35 LOC_Os12g03990 "Os12g0133700 protein" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q2RAU9 Os11g0136800 "Os11g0136800 protein" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MW70 DUSP12 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1890614 Dusp12 "dual specificity phosphatase 12" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1S1C7 LOC100626531 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| RGD|68375 Dusp12 "dual specificity phosphatase 12" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LL40 I3LL40 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-050626-91 dusp12 "dual specificity phosphatase 12" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9UNI6 DUSP12 "Dual specificity protein phosphatase 12" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 249 | |||
| cd00127 | 139 | cd00127, DSPc, Dual specificity phosphatases (DSP) | 3e-43 | |
| smart00195 | 138 | smart00195, DSPc, Dual specificity phosphatase, ca | 2e-38 | |
| pfam00782 | 131 | pfam00782, DSPc, Dual specificity phosphatase, cat | 9e-34 | |
| COG2453 | 180 | COG2453, CDC14, Predicted protein-tyrosine phospha | 8e-11 | |
| COG5350 | 172 | COG5350, COG5350, Predicted protein tyrosine phosp | 3e-06 | |
| smart00404 | 105 | smart00404, PTPc_motif, Protein tyrosine phosphata | 1e-05 | |
| smart00012 | 105 | smart00012, PTPc_DSPc, Protein tyrosine phosphatas | 1e-05 | |
| PRK12361 | 547 | PRK12361, PRK12361, hypothetical protein; Provisio | 7e-05 | |
| pfam00102 | 233 | pfam00102, Y_phosphatase, Protein-tyrosine phospha | 5e-04 | |
| cd00047 | 231 | cd00047, PTPc, Protein tyrosine phosphatases (PTP) | 0.002 | |
| smart00194 | 259 | smart00194, PTPc, Protein tyrosine phosphatase, ca | 0.003 |
| >gnl|CDD|238073 cd00127, DSPc, Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases | Back alignment and domain information |
|---|
Score = 142 bits (361), Expect = 3e-43
Identities = 54/139 (38%), Positives = 80/139 (57%), Gaps = 3/139 (2%)
Query: 1 MPNLVEENLYLGDLNDAMGLKSSNEANIKFVFSIGIF--PTLGKISSLTYRHIEVADLPS 58
+ + LYLG A + + I V ++ +S Y ++ + DLPS
Sbjct: 1 PLSEITPGLYLGSYPAASDKELLKKLGITHVLNVAKEVPNENLFLSDFNYLYVPILDLPS 60
Query: 59 EDLLSHFDSAYEFIRESQSE-GAILVHCYHGVSRSATIVIAYLMKRDDLGVQTAFDRVKS 117
+D+ +FD A +FI +++ + G +LVHC GVSRSAT+VIAYLMK L ++ A++ VKS
Sbjct: 61 QDISKYFDEAVDFIDDAREKGGKVLVHCLAGVSRSATLVIAYLMKTLGLSLREAYEFVKS 120
Query: 118 ARDVISPNEGFMHQLALYQ 136
R +ISPN GFM QL Y+
Sbjct: 121 RRPIISPNAGFMRQLKEYE 139
|
Structurally similar to tyrosine-specific phosphatases but with a shallower active site cleft and a distinctive active site signature motif, HCxxGxxR. Characterized as VHR- or Cdc25-like. Length = 139 |
| >gnl|CDD|214551 smart00195, DSPc, Dual specificity phosphatase, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|216117 pfam00782, DSPc, Dual specificity phosphatase, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|225297 COG2453, CDC14, Predicted protein-tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|227653 COG5350, COG5350, Predicted protein tyrosine phosphatase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|214649 smart00404, PTPc_motif, Protein tyrosine phosphatase, catalytic domain motif | Back alignment and domain information |
|---|
| >gnl|CDD|214469 smart00012, PTPc_DSPc, Protein tyrosine phosphatase, catalytic domain, undefined specificity | Back alignment and domain information |
|---|
| >gnl|CDD|183473 PRK12361, PRK12361, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215717 pfam00102, Y_phosphatase, Protein-tyrosine phosphatase | Back alignment and domain information |
|---|
| >gnl|CDD|238006 cd00047, PTPc, Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways | Back alignment and domain information |
|---|
| >gnl|CDD|214550 smart00194, PTPc, Protein tyrosine phosphatase, catalytic domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 249 | |||
| smart00195 | 138 | DSPc Dual specificity phosphatase, catalytic domai | 100.0 | |
| KOG1718|consensus | 198 | 100.0 | ||
| KOG1717|consensus | 343 | 100.0 | ||
| KOG1716|consensus | 285 | 100.0 | ||
| cd00127 | 139 | DSPc Dual specificity phosphatases (DSP); Ser/Thr | 100.0 | |
| PF00782 | 133 | DSPc: Dual specificity phosphatase, catalytic doma | 99.98 | |
| PRK12361 | 547 | hypothetical protein; Provisional | 99.95 | |
| PTZ00242 | 166 | protein tyrosine phosphatase; Provisional | 99.89 | |
| KOG1719|consensus | 183 | 99.87 | ||
| PTZ00393 | 241 | protein tyrosine phosphatase; Provisional | 99.86 | |
| KOG1720|consensus | 225 | 99.71 | ||
| COG2453 | 180 | CDC14 Predicted protein-tyrosine phosphatase [Sign | 99.69 | |
| PF03162 | 164 | Y_phosphatase2: Tyrosine phosphatase family; Inter | 99.6 | |
| TIGR01244 | 135 | conserved hypothetical protein TIGR01244. No membe | 99.44 | |
| KOG2836|consensus | 173 | 99.4 | ||
| PF05706 | 168 | CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3) | 99.34 | |
| smart00012 | 105 | PTPc_DSPc Protein tyrosine phosphatase, catalytic | 99.24 | |
| smart00404 | 105 | PTPc_motif Protein tyrosine phosphatase, catalytic | 99.24 | |
| COG5350 | 172 | Predicted protein tyrosine phosphatase [General fu | 99.18 | |
| PF04273 | 110 | DUF442: Putative phosphatase (DUF442); InterPro: I | 99.17 | |
| cd00047 | 231 | PTPc Protein tyrosine phosphatases (PTP) catalyze | 99.06 | |
| PLN02727 | 986 | NAD kinase | 99.02 | |
| smart00194 | 258 | PTPc Protein tyrosine phosphatase, catalytic domai | 98.98 | |
| PF13350 | 164 | Y_phosphatase3: Tyrosine phosphatase family; PDB: | 98.94 | |
| COG3453 | 130 | Uncharacterized protein conserved in bacteria [Fun | 98.82 | |
| KOG1572|consensus | 249 | 98.8 | ||
| KOG2283|consensus | 434 | 98.75 | ||
| PRK15375 | 535 | pathogenicity island 1 effector protein StpP; Prov | 98.62 | |
| PHA02742 | 303 | protein tyrosine phosphatase; Provisional | 98.53 | |
| PF00102 | 235 | Y_phosphatase: Protein-tyrosine phosphatase; Inter | 98.52 | |
| PHA02740 | 298 | protein tyrosine phosphatase; Provisional | 98.51 | |
| PHA02747 | 312 | protein tyrosine phosphatase; Provisional | 98.47 | |
| PF14566 | 149 | PTPlike_phytase: Inositol hexakisphosphate; PDB: 1 | 98.46 | |
| PHA02746 | 323 | protein tyrosine phosphatase; Provisional | 98.45 | |
| PF04179 | 451 | Init_tRNA_PT: Initiator tRNA phosphoribosyl transf | 98.44 | |
| PHA02738 | 320 | hypothetical protein; Provisional | 98.42 | |
| COG5599 | 302 | PTP2 Protein tyrosine phosphatase [Signal transduc | 98.15 | |
| KOG0792|consensus | 1144 | 98.09 | ||
| COG2365 | 249 | Protein tyrosine/serine phosphatase [Signal transd | 98.05 | |
| KOG2386|consensus | 393 | 97.96 | ||
| KOG0790|consensus | 600 | 97.72 | ||
| KOG0789|consensus | 415 | 97.62 | ||
| KOG0791|consensus | 374 | 97.39 | ||
| PF14671 | 141 | DSPn: Dual specificity protein phosphatase, N-term | 97.15 | |
| KOG4228|consensus | 1087 | 96.68 | ||
| KOG0793|consensus | 1004 | 95.96 | ||
| KOG4228|consensus | 1087 | 95.3 | ||
| KOG4471|consensus | 717 | 94.27 | ||
| cd01518 | 101 | RHOD_YceA Member of the Rhodanese Homology Domain | 91.07 | |
| KOG1089|consensus | 573 | 88.39 | ||
| PLN02160 | 136 | thiosulfate sulfurtransferase | 86.78 | |
| COG0607 | 110 | PspE Rhodanese-related sulfurtransferase [Inorgani | 85.71 | |
| PF06602 | 353 | Myotub-related: Myotubularin-like phosphatase doma | 84.8 |
| >smart00195 DSPc Dual specificity phosphatase, catalytic domain | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.1e-35 Score=234.58 Aligned_cols=137 Identities=37% Similarity=0.578 Sum_probs=129.4
Q ss_pred CCcccCCEEEcCccccCCHhHHHhCCCcEEEEeCcCCCCCCCCCeEEEEEEeccCCCCchHHHHHHHHHHHHHh-hCCCc
Q psy13471 2 PNLVEENLYLGDLNDAMGLKSSNEANIKFVFSIGIFPTLGKISSLTYRHIEVADLPSEDLLSHFDSAYEFIRES-QSEGA 80 (249)
Q Consensus 2 P~~I~~~LylG~~~~a~~~~~L~~~gI~~Vl~l~~~~~~~~~~~~~~~~i~i~D~~~~~l~~~~~~~~~fI~~~-~~~~~ 80 (249)
|++|.|+||+|+.+++.+.+.|+++||++|||+..+.......+++|+++|+.|....++.+.|..+++||+.. ..+++
T Consensus 1 ~~~I~~~l~~G~~~~~~~~~~l~~~gi~~Vi~l~~~~~~~~~~~~~~~~ipi~D~~~~~~~~~~~~~~~~i~~~~~~~~~ 80 (138)
T smart00195 1 PSEILPHLYLGSYSSALNLALLKKLGITHVINVTNEVPNLNKKGFTYLGVPILDNTETKISPYFPEAVEFIEDAEKKGGK 80 (138)
T ss_pred CcEEeCCeEECChhHcCCHHHHHHcCCCEEEEccCCCCCCCCCCCEEEEEECCCCCCCChHHHHHHHHHHHHHHhcCCCe
Confidence 89999999999999999999999999999999998764444578999999999987888899999999999999 88999
Q ss_pred EEEEecCCCchhHHHHHHHHHHhCCCCHHHHHHHHHhhCCcccCCHHHHHHHHHHHHh
Q psy13471 81 ILVHCYHGVSRSATIVIAYLMKRDDLGVQTAFDRVKSARDVISPNEGFMHQLALYQRM 138 (249)
Q Consensus 81 VLVHC~~G~sRS~tvv~AYLm~~~~~s~~~Al~~vr~~Rp~i~pn~gf~~qL~~~e~~ 138 (249)
|||||.+|+|||+++++||||+..|+++++|+++|+++||.+.||.+|++||+.||++
T Consensus 81 VlVHC~~G~~RS~~v~~~yl~~~~~~~~~~A~~~v~~~R~~~~p~~~~~~qL~~~e~~ 138 (138)
T smart00195 81 VLVHCQAGVSRSATLIIAYLMKYRNLSLNDAYDFVKDRRPIISPNFGFLRQLIEYERK 138 (138)
T ss_pred EEEECCCCCchHHHHHHHHHHHHhCCCHHHHHHHHHHHCCccCCCHhHHHHHHHHhhC
Confidence 9999999999999999999999999999999999999999999999999999999973
|
|
| >KOG1718|consensus | Back alignment and domain information |
|---|
| >KOG1717|consensus | Back alignment and domain information |
|---|
| >KOG1716|consensus | Back alignment and domain information |
|---|
| >cd00127 DSPc Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases | Back alignment and domain information |
|---|
| >PF00782 DSPc: Dual specificity phosphatase, catalytic domain; InterPro: IPR000340 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity | Back alignment and domain information |
|---|
| >PRK12361 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00242 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG1719|consensus | Back alignment and domain information |
|---|
| >PTZ00393 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG1720|consensus | Back alignment and domain information |
|---|
| >COG2453 CDC14 Predicted protein-tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF03162 Y_phosphatase2: Tyrosine phosphatase family; InterPro: IPR004861 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity | Back alignment and domain information |
|---|
| >TIGR01244 conserved hypothetical protein TIGR01244 | Back alignment and domain information |
|---|
| >KOG2836|consensus | Back alignment and domain information |
|---|
| >PF05706 CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3); InterPro: IPR022778 This entry represents a domain found in cyclin-dependent kinase inhibitor 3 or kinase associated phosphatase proteins from several mammalian species | Back alignment and domain information |
|---|
| >smart00012 PTPc_DSPc Protein tyrosine phosphatase, catalytic domain, undefined specificity | Back alignment and domain information |
|---|
| >smart00404 PTPc_motif Protein tyrosine phosphatase, catalytic domain motif | Back alignment and domain information |
|---|
| >COG5350 Predicted protein tyrosine phosphatase [General function prediction only] | Back alignment and domain information |
|---|
| >PF04273 DUF442: Putative phosphatase (DUF442); InterPro: IPR005939 Although this domain is uncharacterised it seems likely that it performs a phosphatase function | Back alignment and domain information |
|---|
| >cd00047 PTPc Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways | Back alignment and domain information |
|---|
| >PLN02727 NAD kinase | Back alignment and domain information |
|---|
| >smart00194 PTPc Protein tyrosine phosphatase, catalytic domain | Back alignment and domain information |
|---|
| >PF13350 Y_phosphatase3: Tyrosine phosphatase family; PDB: 1YWF_A 2OZ5_B | Back alignment and domain information |
|---|
| >COG3453 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG1572|consensus | Back alignment and domain information |
|---|
| >KOG2283|consensus | Back alignment and domain information |
|---|
| >PRK15375 pathogenicity island 1 effector protein StpP; Provisional | Back alignment and domain information |
|---|
| >PHA02742 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PF00102 Y_phosphatase: Protein-tyrosine phosphatase; InterPro: IPR000242 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity | Back alignment and domain information |
|---|
| >PHA02740 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PHA02747 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PF14566 PTPlike_phytase: Inositol hexakisphosphate; PDB: 1U24_A 2PSZ_B 3MOZ_A 3D1H_B 2B4P_B 3D1Q_A 2B4O_A 3MMJ_B 1U25_A 1U26_B | Back alignment and domain information |
|---|
| >PHA02746 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PF04179 Init_tRNA_PT: Initiator tRNA phosphoribosyl transferase ; InterPro: IPR007306 This enzyme (2 | Back alignment and domain information |
|---|
| >PHA02738 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG5599 PTP2 Protein tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0792|consensus | Back alignment and domain information |
|---|
| >COG2365 Protein tyrosine/serine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2386|consensus | Back alignment and domain information |
|---|
| >KOG0790|consensus | Back alignment and domain information |
|---|
| >KOG0789|consensus | Back alignment and domain information |
|---|
| >KOG0791|consensus | Back alignment and domain information |
|---|
| >PF14671 DSPn: Dual specificity protein phosphatase, N-terminal half; PDB: 1OHD_A 1OHE_A 1OHC_A | Back alignment and domain information |
|---|
| >KOG4228|consensus | Back alignment and domain information |
|---|
| >KOG0793|consensus | Back alignment and domain information |
|---|
| >KOG4228|consensus | Back alignment and domain information |
|---|
| >KOG4471|consensus | Back alignment and domain information |
|---|
| >cd01518 RHOD_YceA Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >KOG1089|consensus | Back alignment and domain information |
|---|
| >PLN02160 thiosulfate sulfurtransferase | Back alignment and domain information |
|---|
| >COG0607 PspE Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF06602 Myotub-related: Myotubularin-like phosphatase domain; InterPro: IPR010569 This family represents a region within eukaryotic myotubularin-related proteins that is sometimes found with IPR004182 from INTERPRO | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 249 | ||||
| 3s4e_A | 144 | Crystal Structrue Of A Novel Mitogen-Activated Prot | 2e-19 | ||
| 3lj8_A | 146 | Crystal Structure Of Mkp-4 Length = 146 | 5e-18 | ||
| 2hxp_A | 155 | Crystal Structure Of The Human Phosphatase (Dusp9) | 1e-16 | ||
| 1wrm_A | 165 | Crystal Structure Of Jsp-1 Length = 165 | 1e-16 | ||
| 2nt2_A | 145 | Crystal Structure Of Slingshot Phosphatase 2 Length | 3e-16 | ||
| 1mkp_A | 144 | Crystal Structure Of Pyst1 (Mkp3) Length = 144 | 2e-15 | ||
| 2wgp_A | 190 | Crystal Structure Of Human Dual Specificity Phospha | 3e-15 | ||
| 2g6z_A | 211 | Crystal Structure Of Human Dusp5 Length = 211 | 4e-15 | ||
| 1yz4_A | 160 | Crystal Structure Of Dusp15 Length = 160 | 4e-15 | ||
| 2e0t_A | 151 | Crystal Structure Of Catalytic Domain Of Dual Speci | 5e-15 | ||
| 3f81_A | 183 | Interaction Of Vhr With Sa3 Length = 183 | 8e-14 | ||
| 1vhr_A | 184 | Human Vh1-Related Dual-Specificity Phosphatase Leng | 8e-14 | ||
| 4hrf_A | 160 | Atomic Structure Of Dusp26 Length = 160 | 8e-14 | ||
| 2esb_A | 188 | Crystal Structure Of Human Dusp18 Length = 188 | 6e-13 | ||
| 2oud_A | 177 | Crystal Structure Of The Catalytic Domain Of Human | 8e-13 | ||
| 1j4x_A | 184 | Human Vh1-Related Dual-Specificity Phosphatase C124 | 1e-12 | ||
| 1zzw_A | 149 | Crystal Structure Of Catalytic Domain Of Human Map | 2e-12 | ||
| 2r0b_A | 154 | Crystal Structure Of Human Tyrosine Phosphatase-lik | 2e-12 | ||
| 2hcm_A | 164 | Crystal Structure Of Mouse Putative Dual Specificit | 2e-12 | ||
| 2y96_A | 219 | Structure Of Human Dual-Specificity Phosphatase 27 | 7e-12 | ||
| 2pq5_A | 205 | Crystal Structure Of Dual Specificity Protein Phosp | 1e-11 | ||
| 2gwo_A | 198 | Crystal Structure Of Tmdp Length = 198 | 2e-11 | ||
| 3ezz_A | 144 | Crystal Structure Of Human Mkp-2 Length = 144 | 3e-11 | ||
| 1m3g_A | 145 | Solution Structure Of The Catalytic Domain Of Mapk | 3e-11 | ||
| 2j16_B | 182 | Apo & Sulphate Bound Forms Of Sdp-1 Length = 182 | 2e-08 | ||
| 2rf6_A | 176 | Crystal Structure Of The Vaccinia Virus Dual-Specif | 8e-08 | ||
| 2j17_A | 182 | Ptyr Bound Form Of Sdp-1 Length = 182 | 2e-07 | ||
| 2j16_A | 182 | Apo & Sulphate Bound Forms Of Sdp-1 Length = 182 | 3e-07 | ||
| 2p4d_A | 172 | Structure-Assisted Discovery Of Variola Major H1 Ph | 4e-07 | ||
| 2q05_A | 195 | Crystal Structure Of TyrSER PROTEIN PHOSPHATASE FRO | 1e-06 | ||
| 3emu_A | 161 | Crystal Structure Of A Leucine Rich Repeat And Phos | 3e-06 | ||
| 1yn9_A | 169 | Crystal Structure Of Baculovirus Rna 5'-Phosphatase | 3e-05 | ||
| 2i6i_A | 161 | Crystal Structures Of The Archaeal Sulfolobus Ptp-F | 3e-04 |
| >pdb|3S4E|A Chain A, Crystal Structrue Of A Novel Mitogen-Activated Protein Kinase Phosphatase, Skrp1 Length = 144 | Back alignment and structure |
|
| >pdb|3LJ8|A Chain A, Crystal Structure Of Mkp-4 Length = 146 | Back alignment and structure |
| >pdb|2HXP|A Chain A, Crystal Structure Of The Human Phosphatase (Dusp9) Length = 155 | Back alignment and structure |
| >pdb|1WRM|A Chain A, Crystal Structure Of Jsp-1 Length = 165 | Back alignment and structure |
| >pdb|2NT2|A Chain A, Crystal Structure Of Slingshot Phosphatase 2 Length = 145 | Back alignment and structure |
| >pdb|1MKP|A Chain A, Crystal Structure Of Pyst1 (Mkp3) Length = 144 | Back alignment and structure |
| >pdb|2WGP|A Chain A, Crystal Structure Of Human Dual Specificity Phosphatase 14 Length = 190 | Back alignment and structure |
| >pdb|2G6Z|A Chain A, Crystal Structure Of Human Dusp5 Length = 211 | Back alignment and structure |
| >pdb|1YZ4|A Chain A, Crystal Structure Of Dusp15 Length = 160 | Back alignment and structure |
| >pdb|2E0T|A Chain A, Crystal Structure Of Catalytic Domain Of Dual Specificity Phosphatase 26, Ms0830 From Homo Sapiens Length = 151 | Back alignment and structure |
| >pdb|3F81|A Chain A, Interaction Of Vhr With Sa3 Length = 183 | Back alignment and structure |
| >pdb|1VHR|A Chain A, Human Vh1-Related Dual-Specificity Phosphatase Length = 184 | Back alignment and structure |
| >pdb|4HRF|A Chain A, Atomic Structure Of Dusp26 Length = 160 | Back alignment and structure |
| >pdb|2ESB|A Chain A, Crystal Structure Of Human Dusp18 Length = 188 | Back alignment and structure |
| >pdb|2OUD|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Mkp5 Length = 177 | Back alignment and structure |
| >pdb|1J4X|A Chain A, Human Vh1-Related Dual-Specificity Phosphatase C124s Mutant- Peptide Complex Length = 184 | Back alignment and structure |
| >pdb|1ZZW|A Chain A, Crystal Structure Of Catalytic Domain Of Human Map Kinase Phosphatase 5 Length = 149 | Back alignment and structure |
| >pdb|2R0B|A Chain A, Crystal Structure Of Human Tyrosine Phosphatase-like Serine/threonine/tyrosine-interacting Protein Length = 154 | Back alignment and structure |
| >pdb|2HCM|A Chain A, Crystal Structure Of Mouse Putative Dual Specificity Phosphatase Complexed With Zinc Tungstate, New York Structural Genomics Consortium Length = 164 | Back alignment and structure |
| >pdb|2Y96|A Chain A, Structure Of Human Dual-Specificity Phosphatase 27 Length = 219 | Back alignment and structure |
| >pdb|2PQ5|A Chain A, Crystal Structure Of Dual Specificity Protein Phosphatase 13 (Dusp13) Length = 205 | Back alignment and structure |
| >pdb|2GWO|A Chain A, Crystal Structure Of Tmdp Length = 198 | Back alignment and structure |
| >pdb|3EZZ|A Chain A, Crystal Structure Of Human Mkp-2 Length = 144 | Back alignment and structure |
| >pdb|1M3G|A Chain A, Solution Structure Of The Catalytic Domain Of Mapk Phosphatase Pac-1: Insights Into Substrate-Induced Enzymatic Activation Length = 145 | Back alignment and structure |
| >pdb|2J16|B Chain B, Apo & Sulphate Bound Forms Of Sdp-1 Length = 182 | Back alignment and structure |
| >pdb|2RF6|A Chain A, Crystal Structure Of The Vaccinia Virus Dual-Specificity Phosphatase Vh1 Length = 176 | Back alignment and structure |
| >pdb|2J17|A Chain A, Ptyr Bound Form Of Sdp-1 Length = 182 | Back alignment and structure |
| >pdb|2J16|A Chain A, Apo & Sulphate Bound Forms Of Sdp-1 Length = 182 | Back alignment and structure |
| >pdb|2P4D|A Chain A, Structure-Assisted Discovery Of Variola Major H1 Phosphatase Inhibitors Length = 172 | Back alignment and structure |
| >pdb|2Q05|A Chain A, Crystal Structure Of TyrSER PROTEIN PHOSPHATASE FROM VACCINIA VIRUS Wr Length = 195 | Back alignment and structure |
| >pdb|3EMU|A Chain A, Crystal Structure Of A Leucine Rich Repeat And Phosphatase Domain Containing Protein From Entamoeba Histolytica Length = 161 | Back alignment and structure |
| >pdb|1YN9|A Chain A, Crystal Structure Of Baculovirus Rna 5'-Phosphatase Complexed With Phosphate Length = 169 | Back alignment and structure |
| >pdb|2I6I|A Chain A, Crystal Structures Of The Archaeal Sulfolobus Ptp-Fold Phosphatase Length = 161 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 249 | |||
| 1wrm_A | 165 | Dual specificity phosphatase 22; DSP, JNK, hydrola | 1e-51 | |
| 2hcm_A | 164 | Dual specificity protein phosphatase; structural g | 1e-51 | |
| 3emu_A | 161 | Leucine rich repeat and phosphatase domain contain | 5e-51 | |
| 2g6z_A | 211 | Dual specificity protein phosphatase 5; alpha/beta | 5e-51 | |
| 3s4e_A | 144 | Dual specificity protein phosphatase 19; PTP, prot | 7e-51 | |
| 1yz4_A | 160 | DUSP15, dual specificity phosphatase-like 15 isofo | 9e-51 | |
| 2esb_A | 188 | Dual specificity protein phosphatase 18; alpha/bet | 1e-50 | |
| 2nt2_A | 145 | Protein phosphatase slingshot homolog 2; alpha/bet | 2e-50 | |
| 2hxp_A | 155 | Dual specificity protein phosphatase 9; human phos | 7e-50 | |
| 1zzw_A | 149 | Dual specificity protein phosphatase 10; MKP, PTP, | 2e-49 | |
| 2oud_A | 177 | Dual specificity protein phosphatase 10; A central | 4e-49 | |
| 3ezz_A | 144 | Dual specificity protein phosphatase 4; alpha/beta | 4e-49 | |
| 2wgp_A | 190 | Dual specificity protein phosphatase 14; MKP6, DUS | 5e-49 | |
| 2e0t_A | 151 | Dual specificity phosphatase 26; conserved hypothe | 2e-48 | |
| 2r0b_A | 154 | Serine/threonine/tyrosine-interacting protein; str | 2e-48 | |
| 2y96_A | 219 | Dual specificity phosphatase DUPD1; hydrolase; 2.3 | 2e-48 | |
| 3f81_A | 183 | Dual specificity protein phosphatase 3; hydrolase, | 5e-47 | |
| 2pq5_A | 205 | Dual specificity protein phosphatase 13; hydrolase | 2e-46 | |
| 3cm3_A | 176 | Late protein H1, dual specificity protein phosphat | 3e-45 | |
| 2q05_A | 195 | Late protein H1, dual specificity protein phosphat | 8e-45 | |
| 3rgo_A | 157 | Protein-tyrosine phosphatase mitochondrial 1; phos | 3e-42 | |
| 2j16_A | 182 | SDP-1, tyrosine-protein phosphatase YIL113W; hydro | 3e-40 | |
| 3nme_A | 294 | Ptpkis1 protein, SEX4 glucan phosphatase; dual spe | 2e-23 | |
| 2img_A | 151 | Dual specificity protein phosphatase 23; DUSP23, V | 3e-16 | |
| 1ohe_A | 348 | CDC14B, CDC14B2 phosphatase; protein phosphatase, | 1e-13 | |
| 2c46_A | 241 | MRNA capping enzyme; phosphatase, transferase, hyd | 2e-10 | |
| 1yn9_A | 169 | BVP, polynucleotide 5'-phosphatase; RNA triphospha | 4e-10 | |
| 2i6j_A | 161 | Ssoptp, sulfolobus solfataricus protein tyrosine p | 2e-09 | |
| 3s4o_A | 167 | Protein tyrosine phosphatase-like protein; structu | 1e-08 | |
| 1rxd_A | 159 | Protein tyrosine phosphatase type IVA, member 1; p | 1e-06 | |
| 3rz2_A | 189 | Protein tyrosine phosphatase type IVA 1; tyrosine | 2e-06 | |
| 3mmj_A | 314 | MYO-inositol hexaphosphate phosphohydrolase; phyta | 3e-06 | |
| 3f41_A | 629 | Phytase; tandem repeat, protein tyrosine phosphata | 3e-06 | |
| 3f41_A | 629 | Phytase; tandem repeat, protein tyrosine phosphata | 1e-05 | |
| 1fpz_A | 212 | Cyclin-dependent kinase inhibitor 3; alpha-beta sa | 6e-06 | |
| 1d5r_A | 324 | Phosphoinositide phosphotase PTEN; C2 domain, phos | 8e-04 |
| >1wrm_A Dual specificity phosphatase 22; DSP, JNK, hydrolase; HET: MES; 1.50A {Homo sapiens} Length = 165 | Back alignment and structure |
|---|
Score = 164 bits (418), Expect = 1e-51
Identities = 45/140 (32%), Positives = 71/140 (50%), Gaps = 2/140 (1%)
Query: 2 PNLVEENLYLGDLNDAMGLKSSNEANIKFVFSIGIFPTLGKISSLTYRHIEVADLPSEDL 61
N + LY+G+ DA + ++ + + S+ + + Y I AD PS++L
Sbjct: 7 MNKILPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARP-MLEGVKYLCIPAADSPSQNL 65
Query: 62 LSHFDSAYEFIRES-QSEGAILVHCYHGVSRSATIVIAYLMKRDDLGVQTAFDRVKSARD 120
HF + +FI E + LVHC GVSRS T+VIAY+M D G + A V++ R
Sbjct: 66 TRHFKESIKFIHECRLRGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRS 125
Query: 121 VISPNEGFMHQLALYQRMRM 140
+PN GF QL +++ +
Sbjct: 126 CANPNVGFQRQLQEFEKHEV 145
|
| >2hcm_A Dual specificity protein phosphatase; structural genomics, PSI, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Mus musculus} Length = 164 | Back alignment and structure |
|---|
| >3emu_A Leucine rich repeat and phosphatase domain containing protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.30A {Entamoeba histolytica} Length = 161 | Back alignment and structure |
|---|
| >2g6z_A Dual specificity protein phosphatase 5; alpha/beta, hydrolase; 2.70A {Homo sapiens} Length = 211 | Back alignment and structure |
|---|
| >3s4e_A Dual specificity protein phosphatase 19; PTP, protein tyrosine phosphatase, hydrolase; 1.26A {Homo sapiens} Length = 144 | Back alignment and structure |
|---|
| >1yz4_A DUSP15, dual specificity phosphatase-like 15 isoform A; hydrolase; HET: BOG; 2.40A {Homo sapiens} Length = 160 | Back alignment and structure |
|---|
| >2esb_A Dual specificity protein phosphatase 18; alpha/beta structure, hydrolase; HET: EPE; 2.00A {Homo sapiens} Length = 188 | Back alignment and structure |
|---|
| >2nt2_A Protein phosphatase slingshot homolog 2; alpha/beta hydrolase; 2.10A {Homo sapiens} Length = 145 | Back alignment and structure |
|---|
| >2hxp_A Dual specificity protein phosphatase 9; human phosphatase, structural genomics, PSI-2, protein structure initiative; 1.83A {Homo sapiens} PDB: 3lj8_A 1mkp_A Length = 155 | Back alignment and structure |
|---|
| >1zzw_A Dual specificity protein phosphatase 10; MKP, PTP, hydrolase; 1.60A {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >2oud_A Dual specificity protein phosphatase 10; A central five-stranded B-sheet, hydrolase; 2.80A {Homo sapiens} Length = 177 | Back alignment and structure |
|---|
| >3ezz_A Dual specificity protein phosphatase 4; alpha/beta, hydrolase, nucleus; 2.90A {Homo sapiens} PDB: 1m3g_A Length = 144 | Back alignment and structure |
|---|
| >2wgp_A Dual specificity protein phosphatase 14; MKP6, DUSP14, hydrolase, dual specifici phosphatase; 1.88A {Homo sapiens} Length = 190 | Back alignment and structure |
|---|
| >2e0t_A Dual specificity phosphatase 26; conserved hypothetical protein, structural genomics, NPPSFA, project on protein structural and functional analyses; 1.67A {Homo sapiens} Length = 151 | Back alignment and structure |
|---|
| >2r0b_A Serine/threonine/tyrosine-interacting protein; structural genomics, phosphatase, PSI-2, protein structure initiative; 1.60A {Homo sapiens} Length = 154 | Back alignment and structure |
|---|
| >2y96_A Dual specificity phosphatase DUPD1; hydrolase; 2.38A {Homo sapiens} Length = 219 | Back alignment and structure |
|---|
| >3f81_A Dual specificity protein phosphatase 3; hydrolase, protein dual-specificity phosphatase, inhibitor; HET: STT; 1.90A {Homo sapiens} PDB: 1vhr_A* 1j4x_A* Length = 183 | Back alignment and structure |
|---|
| >2pq5_A Dual specificity protein phosphatase 13; hydrolase, dual specificity phosphatase, DUSP13, testis and skeletal muscle specific DSP; 2.30A {Homo sapiens} PDB: 2gwo_A Length = 205 | Back alignment and structure |
|---|
| >3cm3_A Late protein H1, dual specificity protein phosphatase; dual-specificity phosphatase, VH1, hydrolase; 1.32A {Vaccinia virus} PDB: 2rf6_A 2p4d_A Length = 176 | Back alignment and structure |
|---|
| >2q05_A Late protein H1, dual specificity protein phosphatase; structural genomics, APC7320, P protein structure initiative; HET: MSE; 2.57A {Vaccinia virus WR} Length = 195 | Back alignment and structure |
|---|
| >3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A* Length = 157 | Back alignment and structure |
|---|
| >3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} Length = 294 | Back alignment and structure |
|---|
| >2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} Length = 151 | Back alignment and structure |
|---|
| >1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A Length = 348 | Back alignment and structure |
|---|
| >2c46_A MRNA capping enzyme; phosphatase, transferase, hydrolase, mRNA processing, multifunctional enzyme, nucleotidyltransferase; 1.6A {Homo sapiens} PDB: 1i9s_A 1i9t_A Length = 241 | Back alignment and structure |
|---|
| >1yn9_A BVP, polynucleotide 5'-phosphatase; RNA triphosphatase, cysteine phosphatase, P-loop, hydrolase; HET: PO4; 1.50A {Autographa californicanucleopolyhedrovirus} Length = 169 | Back alignment and structure |
|---|
| >2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* Length = 161 | Back alignment and structure |
|---|
| >3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} Length = 167 | Back alignment and structure |
|---|
| >1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A Length = 159 | Back alignment and structure |
|---|
| >3rz2_A Protein tyrosine phosphatase type IVA 1; tyrosine phosphatase, dual specific phosphatase, COMP with peptide, hydrolase; 2.80A {Rattus norvegicus} PDB: 1x24_A 1zcl_A Length = 189 | Back alignment and structure |
|---|
| >3mmj_A MYO-inositol hexaphosphate phosphohydrolase; phytase, protein tyrosine phosphatase, inositol phosphate, I phosphatase; HET: IHP; 1.60A {Selenomonas ruminantium} PDB: 1u24_A 1u25_A* 1u26_A* 3o3l_A* 3moz_A* 2pt0_A 2psz_A 3d1h_A 3d1o_A 3d1q_A 2b4u_A 2b4p_A 2b4o_A Length = 314 | Back alignment and structure |
|---|
| >3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} Length = 629 | Back alignment and structure |
|---|
| >3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} Length = 629 | Back alignment and structure |
|---|
| >1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* Length = 212 | Back alignment and structure |
|---|
| >1d5r_A Phosphoinositide phosphotase PTEN; C2 domain, phosphotidylinositol, hydrolase; HET: TLA; 2.10A {Homo sapiens} SCOP: b.7.1.1 c.45.1.1 Length = 324 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 249 | |||
| 3emu_A | 161 | Leucine rich repeat and phosphatase domain contain | 100.0 | |
| 3ezz_A | 144 | Dual specificity protein phosphatase 4; alpha/beta | 100.0 | |
| 3s4e_A | 144 | Dual specificity protein phosphatase 19; PTP, prot | 100.0 | |
| 2nt2_A | 145 | Protein phosphatase slingshot homolog 2; alpha/bet | 100.0 | |
| 2hxp_A | 155 | Dual specificity protein phosphatase 9; human phos | 100.0 | |
| 2esb_A | 188 | Dual specificity protein phosphatase 18; alpha/bet | 100.0 | |
| 1wrm_A | 165 | Dual specificity phosphatase 22; DSP, JNK, hydrola | 100.0 | |
| 2g6z_A | 211 | Dual specificity protein phosphatase 5; alpha/beta | 100.0 | |
| 1zzw_A | 149 | Dual specificity protein phosphatase 10; MKP, PTP, | 100.0 | |
| 1yz4_A | 160 | DUSP15, dual specificity phosphatase-like 15 isofo | 100.0 | |
| 2r0b_A | 154 | Serine/threonine/tyrosine-interacting protein; str | 100.0 | |
| 2hcm_A | 164 | Dual specificity protein phosphatase; structural g | 100.0 | |
| 2oud_A | 177 | Dual specificity protein phosphatase 10; A central | 100.0 | |
| 2wgp_A | 190 | Dual specificity protein phosphatase 14; MKP6, DUS | 100.0 | |
| 2e0t_A | 151 | Dual specificity phosphatase 26; conserved hypothe | 100.0 | |
| 3f81_A | 183 | Dual specificity protein phosphatase 3; hydrolase, | 100.0 | |
| 2pq5_A | 205 | Dual specificity protein phosphatase 13; hydrolase | 100.0 | |
| 2j16_A | 182 | SDP-1, tyrosine-protein phosphatase YIL113W; hydro | 100.0 | |
| 2y96_A | 219 | Dual specificity phosphatase DUPD1; hydrolase; 2.3 | 100.0 | |
| 3cm3_A | 176 | Late protein H1, dual specificity protein phosphat | 100.0 | |
| 3rgo_A | 157 | Protein-tyrosine phosphatase mitochondrial 1; phos | 99.98 | |
| 2q05_A | 195 | Late protein H1, dual specificity protein phosphat | 99.96 | |
| 4erc_A | 150 | Dual specificity protein phosphatase 23; alpha bet | 99.96 | |
| 2img_A | 151 | Dual specificity protein phosphatase 23; DUSP23, V | 99.96 | |
| 3nme_A | 294 | Ptpkis1 protein, SEX4 glucan phosphatase; dual spe | 99.95 | |
| 2i6j_A | 161 | Ssoptp, sulfolobus solfataricus protein tyrosine p | 99.93 | |
| 1yn9_A | 169 | BVP, polynucleotide 5'-phosphatase; RNA triphospha | 99.9 | |
| 1ohe_A | 348 | CDC14B, CDC14B2 phosphatase; protein phosphatase, | 99.87 | |
| 3s4o_A | 167 | Protein tyrosine phosphatase-like protein; structu | 99.86 | |
| 1fpz_A | 212 | Cyclin-dependent kinase inhibitor 3; alpha-beta sa | 99.86 | |
| 1rxd_A | 159 | Protein tyrosine phosphatase type IVA, member 1; p | 99.86 | |
| 3rz2_A | 189 | Protein tyrosine phosphatase type IVA 1; tyrosine | 99.86 | |
| 2c46_A | 241 | MRNA capping enzyme; phosphatase, transferase, hyd | 99.85 | |
| 1xri_A | 151 | AT1G05000; structural genomics, protein structure | 99.85 | |
| 1d5r_A | 324 | Phosphoinositide phosphotase PTEN; C2 domain, phos | 99.68 | |
| 2f46_A | 156 | Hypothetical protein; structural genomics, joint c | 99.68 | |
| 3gxh_A | 157 | Putative phosphatase (DUF442); YP_001181608.1, str | 99.65 | |
| 3n0a_A | 361 | Tyrosine-protein phosphatase auxilin; phosphatase- | 99.56 | |
| 3v0d_A | 339 | Voltage-sensor containing phosphatase; PTP, hydrol | 99.53 | |
| 1ywf_A | 296 | Phosphotyrosine protein phosphatase PTPB; four str | 99.12 | |
| 3mmj_A | 314 | MYO-inositol hexaphosphate phosphohydrolase; phyta | 99.08 | |
| 1g4w_R | 383 | Protein tyrosine phosphatase SPTP; virulence facto | 98.95 | |
| 1fpr_A | 284 | Protein-tyrosine phosphatase 1C; protein tyrosine | 98.95 | |
| 2b49_A | 287 | Protein tyrosine phosphatase, non-receptor type 3; | 98.94 | |
| 2oc3_A | 303 | Tyrosine-protein phosphatase non-receptor type 18; | 98.91 | |
| 2ooq_A | 286 | Receptor-type tyrosine-protein phosphatase T; prot | 98.89 | |
| 4az1_A | 302 | Tyrosine specific protein phosphatase; hydrolase, | 98.88 | |
| 3f41_A | 629 | Phytase; tandem repeat, protein tyrosine phosphata | 98.87 | |
| 1p15_A | 253 | Protein-tyrosine phosphatase alpha; transmembrane, | 98.87 | |
| 2cjz_A | 305 | Human protein tyrosine phosphatase PTPN5; protein | 98.87 | |
| 3b7o_A | 316 | Tyrosine-protein phosphatase non-receptor type 11; | 98.86 | |
| 2cm2_A | 304 | Tyrosine-protein phosphatase non-receptor type 1; | 98.86 | |
| 2p6x_A | 309 | Tyrosine-protein phosphatase non-receptor type 22; | 98.86 | |
| 1wch_A | 315 | Protein tyrosine phosphatase, non-receptor type 13 | 98.85 | |
| 3m4u_A | 306 | Tyrosine specific protein phosphatase, putative; p | 98.85 | |
| 2gjt_A | 295 | Receptor-type tyrosine-protein phosphatase PTPro; | 98.85 | |
| 2i1y_A | 301 | Receptor-type tyrosine-protein phosphatase; recept | 98.82 | |
| 2hc1_A | 291 | Receptor-type tyrosine-protein phosphatase beta; p | 98.81 | |
| 1l8k_A | 314 | T-cell protein-tyrosine phosphatase; hydrolase; 2. | 98.81 | |
| 2i75_A | 320 | Tyrosine-protein phosphatase non-receptor type 4; | 98.81 | |
| 4grz_A | 288 | Tyrosine-protein phosphatase non-receptor type 6; | 98.8 | |
| 1zc0_A | 309 | Tyrosine-protein phosphatase, non-receptor type 7; | 98.8 | |
| 2h4v_A | 320 | Receptor-type tyrosine-protein phosphatase gamma; | 98.78 | |
| 3f41_A | 629 | Phytase; tandem repeat, protein tyrosine phosphata | 98.78 | |
| 1jln_A | 297 | STEP-like ptpase, protein tyrosine phosphatase, re | 98.77 | |
| 1yfo_A | 302 | D1, receptor protein tyrosine phosphatase alpha; h | 98.77 | |
| 2bzl_A | 325 | Tyrosine-protein phosphatase, non-receptor type 14 | 98.75 | |
| 1lyv_A | 306 | Protein-tyrosine phosphatase YOPH; toxin, hydrolas | 98.66 | |
| 2b3o_A | 532 | Tyrosine-protein phosphatase, non-receptor type 6; | 98.65 | |
| 3i36_A | 342 | Vascular protein tyrosine phosphatase 1; PTP, hydr | 98.62 | |
| 3s3e_A | 307 | Tyrosine-protein phosphatase 10D; differentiation, | 98.62 | |
| 4i8n_A | 354 | Tyrosine-protein phosphatase non-receptor type 1; | 98.61 | |
| 1ygr_A | 610 | CD45 protein tyrosine phosphatase; protein tyrosin | 98.54 | |
| 4ge6_A | 314 | Tyrosine-protein phosphatase non-receptor type 9; | 98.53 | |
| 2shp_A | 525 | SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin | 98.52 | |
| 1ygr_A | 610 | CD45 protein tyrosine phosphatase; protein tyrosin | 98.48 | |
| 2jjd_A | 599 | Receptor-type tyrosine-protein phosphatase epsilo; | 98.48 | |
| 1lar_A | 575 | Protein (LAR); tyrosine phosphatease, LAR protein, | 98.44 | |
| 2jjd_A | 599 | Receptor-type tyrosine-protein phosphatase epsilo; | 98.44 | |
| 3ps5_A | 595 | Tyrosine-protein phosphatase non-receptor type 6; | 98.44 | |
| 1lar_A | 575 | Protein (LAR); tyrosine phosphatease, LAR protein, | 98.41 | |
| 2nlk_A | 627 | Protein tyrosine phosphatase, receptor type, G VA | 98.36 | |
| 2nlk_A | 627 | Protein tyrosine phosphatase, receptor type, G VA | 98.36 | |
| 1ohe_A | 348 | CDC14B, CDC14B2 phosphatase; protein phosphatase, | 97.51 | |
| 2yf0_A | 512 | Myotubularin-related protein 6; hydrolase; 2.65A { | 87.99 | |
| 1zsq_A | 528 | Myotubularin-related protein 2; protein-phospholip | 87.79 | |
| 1lw3_A | 657 | Myotubularin-related protein 2; protein-phosphate | 85.73 |
| >3emu_A Leucine rich repeat and phosphatase domain containing protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.30A {Entamoeba histolytica} | Back alignment and structure |
|---|
Probab=100.00 E-value=7.7e-39 Score=258.30 Aligned_cols=139 Identities=24% Similarity=0.359 Sum_probs=127.3
Q ss_pred CCcccCCEEEcCccccCCHhHHHhCCCcEEEEeCcCCCCCCCCCeEEEEEEeccCCCCchHHHHHHHHHHHHHh-hCCCc
Q psy13471 2 PNLVEENLYLGDLNDAMGLKSSNEANIKFVFSIGIFPTLGKISSLTYRHIEVADLPSEDLLSHFDSAYEFIRES-QSEGA 80 (249)
Q Consensus 2 P~~I~~~LylG~~~~a~~~~~L~~~gI~~Vl~l~~~~~~~~~~~~~~~~i~i~D~~~~~l~~~~~~~~~fI~~~-~~~~~ 80 (249)
|++|.|+||+|+..++.+.+.|+++||++|||++.+.......+++|+++|+.|.+..++.++|+++++||+++ ..+++
T Consensus 10 ~~~I~~~LylG~~~~a~~~~~L~~~gIt~Vlnl~~~~~~~~~~~~~~~~ipi~D~~~~~l~~~~~~~~~fI~~~~~~~~~ 89 (161)
T 3emu_A 10 PTQIIQYIHLGSFLNAHNVDYIHNNNISSILLVGIEVPSLFKDQCDILRLDIVSEEGHQLYDSIPNAIKFIIRSIQRKEG 89 (161)
T ss_dssp CEEEETTEEEEETTGGGCHHHHHHTTEEEEEEEC-------CTTSEEEEECCCCSSTTHHHHHHHHHHHHHHHHHHTTCE
T ss_pred ceEEECCEEECChHHhhCHHHHHHCCCCEEEEeCCCCccccCCCCEEEEEeCcCCCCCcHHHHHHHHHHHHHHHHhcCCe
Confidence 78999999999999999999999999999999998654344578999999999999999999999999999998 78899
Q ss_pred EEEEecCCCchhHHHHHHHHHHhCCCCHHHHHHHHHhhCCcccCCHHHHHHHHHHHHhcC
Q psy13471 81 ILVHCYHGVSRSATIVIAYLMKRDDLGVQTAFDRVKSARDVISPNEGFMHQLALYQRMRM 140 (249)
Q Consensus 81 VLVHC~~G~sRS~tvv~AYLm~~~~~s~~~Al~~vr~~Rp~i~pn~gf~~qL~~~e~~~~ 140 (249)
|||||.+|+|||+++++||||+.++|++++|+++||++||.+.||.||++||..||+.+.
T Consensus 90 VlVHC~~G~sRS~~vv~ayLm~~~~~s~~~A~~~v~~~Rp~i~pn~~f~~qL~~~e~~L~ 149 (161)
T 3emu_A 90 VLIISGTGVNKAPAIVIAFLMYYQRLSFINAFNKVQGLYPLIDIESGFILQLKLFEKKLE 149 (161)
T ss_dssp EEEEESSSSSHHHHHHHHHHHHHTTCCHHHHHHHHHHHCTTCCCCHHHHHHHHHHHHHHH
T ss_pred EEEEcCCCCcHHHHHHHHHHHHHhCCCHHHHHHHHHHHCCCcCCCHHHHHHHHHHHHHHh
Confidence 999999999999999999999999999999999999999999999999999999998654
|
| >3ezz_A Dual specificity protein phosphatase 4; alpha/beta, hydrolase, nucleus; 2.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1m3g_A | Back alignment and structure |
|---|
| >3s4e_A Dual specificity protein phosphatase 19; PTP, protein tyrosine phosphatase, hydrolase; 1.26A {Homo sapiens} | Back alignment and structure |
|---|
| >2nt2_A Protein phosphatase slingshot homolog 2; alpha/beta hydrolase; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2hxp_A Dual specificity protein phosphatase 9; human phosphatase, structural genomics, PSI-2, protein structure initiative; 1.83A {Homo sapiens} PDB: 3lj8_A 1mkp_A | Back alignment and structure |
|---|
| >2esb_A Dual specificity protein phosphatase 18; alpha/beta structure, hydrolase; HET: EPE; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1wrm_A Dual specificity phosphatase 22; DSP, JNK, hydrolase; HET: MES; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2g6z_A Dual specificity protein phosphatase 5; alpha/beta, hydrolase; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1zzw_A Dual specificity protein phosphatase 10; MKP, PTP, hydrolase; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1yz4_A DUSP15, dual specificity phosphatase-like 15 isoform A; hydrolase; HET: BOG; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2r0b_A Serine/threonine/tyrosine-interacting protein; structural genomics, phosphatase, PSI-2, protein structure initiative; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2hcm_A Dual specificity protein phosphatase; structural genomics, PSI, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2oud_A Dual specificity protein phosphatase 10; A central five-stranded B-sheet, hydrolase; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2wgp_A Dual specificity protein phosphatase 14; MKP6, DUSP14, hydrolase, dual specifici phosphatase; 1.88A {Homo sapiens} | Back alignment and structure |
|---|
| >2e0t_A Dual specificity phosphatase 26; conserved hypothetical protein, structural genomics, NPPSFA, project on protein structural and functional analyses; 1.67A {Homo sapiens} | Back alignment and structure |
|---|
| >3f81_A Dual specificity protein phosphatase 3; hydrolase, protein dual-specificity phosphatase, inhibitor; HET: STT; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1vhr_A* 1j4x_A* | Back alignment and structure |
|---|
| >2pq5_A Dual specificity protein phosphatase 13; hydrolase, dual specificity phosphatase, DUSP13, testis and skeletal muscle specific DSP; 2.30A {Homo sapiens} PDB: 2gwo_A | Back alignment and structure |
|---|
| >2y96_A Dual specificity phosphatase DUPD1; hydrolase; 2.38A {Homo sapiens} | Back alignment and structure |
|---|
| >3cm3_A Late protein H1, dual specificity protein phosphatase; dual-specificity phosphatase, VH1, hydrolase; 1.32A {Vaccinia virus} PDB: 2rf6_A 2p4d_A | Back alignment and structure |
|---|
| >3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A* | Back alignment and structure |
|---|
| >2q05_A Late protein H1, dual specificity protein phosphatase; structural genomics, APC7320, P protein structure initiative; HET: MSE; 2.57A {Vaccinia virus WR} | Back alignment and structure |
|---|
| >4erc_A Dual specificity protein phosphatase 23; alpha beta, phosphatase(hydrolase), hydrolase; 1.15A {Homo sapiens} PDB: 2img_A | Back alignment and structure |
|---|
| >2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} | Back alignment and structure |
|---|
| >3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* | Back alignment and structure |
|---|
| >1yn9_A BVP, polynucleotide 5'-phosphatase; RNA triphosphatase, cysteine phosphatase, P-loop, hydrolase; HET: PO4; 1.50A {Autographa californicanucleopolyhedrovirus} | Back alignment and structure |
|---|
| >1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A | Back alignment and structure |
|---|
| >3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} | Back alignment and structure |
|---|
| >1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* | Back alignment and structure |
|---|
| >1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A | Back alignment and structure |
|---|
| >3rz2_A Protein tyrosine phosphatase type IVA 1; tyrosine phosphatase, dual specific phosphatase, COMP with peptide, hydrolase; 2.80A {Rattus norvegicus} PDB: 1x24_A 1zcl_A | Back alignment and structure |
|---|
| >2c46_A MRNA capping enzyme; phosphatase, transferase, hydrolase, mRNA processing, multifunctional enzyme, nucleotidyltransferase; 1.6A {Homo sapiens} PDB: 1i9s_A 1i9t_A | Back alignment and structure |
|---|
| >1xri_A AT1G05000; structural genomics, protein structure initiative, CESG for eukaryotic structural genomics, phosphoprote phosphatase; 3.30A {Arabidopsis thaliana} SCOP: c.45.1.1 PDB: 2q47_A | Back alignment and structure |
|---|
| >1d5r_A Phosphoinositide phosphotase PTEN; C2 domain, phosphotidylinositol, hydrolase; HET: TLA; 2.10A {Homo sapiens} SCOP: b.7.1.1 c.45.1.1 | Back alignment and structure |
|---|
| >2f46_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 1.41A {Neisseria meningitidis Z2491} | Back alignment and structure |
|---|
| >3gxh_A Putative phosphatase (DUF442); YP_001181608.1, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.40A {Shewanella putrefaciens cn-32} PDB: 3gxg_A* | Back alignment and structure |
|---|
| >3n0a_A Tyrosine-protein phosphatase auxilin; phosphatase-like domain, C2 domain, hydrolase; 2.20A {Bos taurus} | Back alignment and structure |
|---|
| >3v0d_A Voltage-sensor containing phosphatase; PTP, hydrolase; HET: PO4; 1.10A {Ciona intestinalis} PDB: 3v0f_A* 3v0g_A 3v0h_A* 3awf_A 3v0j_A 3awe_A 3awg_A 3v0e_A 3v0i_A | Back alignment and structure |
|---|
| >1ywf_A Phosphotyrosine protein phosphatase PTPB; four stranded parallel beta sheet with flanking helices, structural genomics, PSI; 1.71A {Mycobacterium tuberculosis} SCOP: c.45.1.5 PDB: 2oz5_A* | Back alignment and structure |
|---|
| >3mmj_A MYO-inositol hexaphosphate phosphohydrolase; phytase, protein tyrosine phosphatase, inositol phosphate, I phosphatase; HET: IHP; 1.60A {Selenomonas ruminantium} SCOP: c.45.1.4 PDB: 1u24_A 1u25_A* 1u26_A* 3o3l_A* 3moz_A* 2pt0_A 2psz_A 3d1h_A 3d1o_A 3d1q_A 2b4u_A 2b4p_A 2b4o_A | Back alignment and structure |
|---|
| >1g4w_R Protein tyrosine phosphatase SPTP; virulence factor, GTPase activating protein, 4-helix bundle, disorder, signaling protein; 2.20A {Salmonella typhimurium} SCOP: a.24.11.1 c.45.1.2 PDB: 1g4u_S | Back alignment and structure |
|---|
| >1fpr_A Protein-tyrosine phosphatase 1C; protein tyrosine phosphatase, substrate specificity, residue shift, signaling protein; HET: PTR; 2.50A {Homo sapiens} SCOP: c.45.1.2 PDB: 1gwz_A | Back alignment and structure |
|---|
| >2b49_A Protein tyrosine phosphatase, non-receptor type 3; human, STRU genomics, structural genomics consortium, SGC, hydrolase; 1.54A {Homo sapiens} | Back alignment and structure |
|---|
| >2oc3_A Tyrosine-protein phosphatase non-receptor type 18; protein tyrosine phosphatase, human, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2ooq_A Receptor-type tyrosine-protein phosphatase T; protein tyrosine phosphatase, human, structural GE structural genomics consortium, SGC, hydrolase; HET: B3P; 1.80A {Homo sapiens} PDB: 1rpm_A 2c7s_A | Back alignment and structure |
|---|
| >4az1_A Tyrosine specific protein phosphatase; hydrolase, drug design; 2.18A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} | Back alignment and structure |
|---|
| >1p15_A Protein-tyrosine phosphatase alpha; transmembrane, hydrolase, phosphorylation; 2.00A {Mus musculus} SCOP: c.45.1.2 | Back alignment and structure |
|---|
| >2cjz_A Human protein tyrosine phosphatase PTPN5; protein phosphatase, STEP, hydrolase; HET: PTR; 1.70A {Homo sapiens} PDB: 2bij_A 2bv5_A* | Back alignment and structure |
|---|
| >3b7o_A Tyrosine-protein phosphatase non-receptor type 11; SHP2, PTPN11, tyrosine phosphatase, structural genomics, STR genomics consortium, SGC, deafness; 1.60A {Homo sapiens} PDB: 3jrl_A* 3mow_A* 3o5x_A* | Back alignment and structure |
|---|
| >2cm2_A Tyrosine-protein phosphatase non-receptor type 1; polymorphism, phosphorylation, endoplasmic reticulum, oxidation, hydrolase, acetylation; 1.5A {Homo sapiens} SCOP: c.45.1.2 PDB: 2cm3_A 2cmb_A* 2cmc_A* 2cne_A* 3a5j_A 2cma_A 3a5k_A 3eu0_A 3sme_A 2azr_A* 2b07_A* 2h4g_A* 2h4k_A* 2hb1_A* 2qbp_A* 2qbq_A* 2qbr_A* 2qbs_A* 2zmm_A* 2zn7_A* ... | Back alignment and structure |
|---|
| >2p6x_A Tyrosine-protein phosphatase non-receptor type 22; tyrosine phosphatase, lymphoid phosphatase, PEP, LYP, struct genomics; 1.90A {Homo sapiens} PDB: 3h2x_A 3brh_A 2qct_A* 2qcj_A* 3olr_A* 3omh_A* | Back alignment and structure |
|---|
| >1wch_A Protein tyrosine phosphatase, non-receptor type 13; hydrolase, phosphate ION, colorectal cancer alternative splicing, coiled coil, cytoskeleton; 1.85A {Homo sapiens} SCOP: c.45.1.2 | Back alignment and structure |
|---|
| >3m4u_A Tyrosine specific protein phosphatase, putative; protein tyrosine phosphatase, hydrolase; 2.39A {Trypanosoma brucei} | Back alignment and structure |
|---|
| >2gjt_A Receptor-type tyrosine-protein phosphatase PTPro; tyrosine phosphatase, glepp1, PTPU2, structural genom structural genomics consortium, SGC; 2.15A {Homo sapiens} PDB: 2g59_A 2pi7_A | Back alignment and structure |
|---|
| >2i1y_A Receptor-type tyrosine-protein phosphatase; receptor-type protein tyrosine phosphatase precursor, phosph structural genomics, PSI; 2.23A {Homo sapiens} PDB: 2qep_A | Back alignment and structure |
|---|
| >2hc1_A Receptor-type tyrosine-protein phosphatase beta; protein tyrosine phosphatase, WPD-loop, sulfamic acid, inhibitor, drug design, hydrolase; 1.30A {Homo sapiens} PDB: 2h03_A 2hc2_A 2i4g_A* 2h04_A* 2h02_A 2i3u_A 2i3r_A 2i4e_A* 2i4h_A* 2i5x_A* 2ahs_A | Back alignment and structure |
|---|
| >1l8k_A T-cell protein-tyrosine phosphatase; hydrolase; 2.56A {Homo sapiens} SCOP: c.45.1.2 | Back alignment and structure |
|---|
| >2i75_A Tyrosine-protein phosphatase non-receptor type 4; PTPN4, PTP, tyrosine phosphatase, MEG-1, structural genomics structural genomics consortium, SGC; 2.45A {Homo sapiens} | Back alignment and structure |
|---|
| >4grz_A Tyrosine-protein phosphatase non-receptor type 6; phosphatase domain, hydrolase; 1.37A {Homo sapiens} PDB: 4gry_A 4gs0_A* 1gwz_A 1fpr_A* | Back alignment and structure |
|---|
| >1zc0_A Tyrosine-protein phosphatase, non-receptor type 7; heptp, human tyrosine phosphatase catalytic domain, LC-PTP, hydrolase; 1.85A {Homo sapiens} PDB: 2gp0_A 2qdc_A 2hvl_A 2qdp_A 2qdm_A 3o4s_A 3o4t_A* 3o4u_A* 3d44_A* 3d42_A* 2a3k_A | Back alignment and structure |
|---|
| >2h4v_A Receptor-type tyrosine-protein phosphatase gamma; tyrosine receptor phosphatase, human, structural GENO structural genomics consortium, SGC; HET: FLC; 1.55A {Homo sapiens} PDB: 3qcd_A 3qcc_A 3qcb_A 3qce_A* 3qcf_A* 3qcg_A* 3qch_A* 3qci_A* 3qcj_A* 3qck_A* 2pbn_A 2hy3_A 3qcm_A* 3qcl_A* 3qcn_A | Back alignment and structure |
|---|
| >3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} | Back alignment and structure |
|---|
| >1jln_A STEP-like ptpase, protein tyrosine phosphatase, receptor type, R; PTP-SL, PTPBR7, ERK2-MAP kinase regulation, hydrolase; 1.81A {Mus musculus} SCOP: c.45.1.2 PDB: 2a8b_A | Back alignment and structure |
|---|
| >1yfo_A D1, receptor protein tyrosine phosphatase alpha; hydrolase, signal transduction, glycoprotein, phosphorylation, signal; 2.25A {Mus musculus} SCOP: c.45.1.2 | Back alignment and structure |
|---|
| >2bzl_A Tyrosine-protein phosphatase, non-receptor type 14; PTPN14, hydrolase; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1lyv_A Protein-tyrosine phosphatase YOPH; toxin, hydrolase; 1.36A {Yersinia enterocolitica} SCOP: c.45.1.2 PDB: 1qz0_A* 1ytn_A 1ytw_A 2i42_A 2y2f_A* 2ydu_A* 1xxp_A* 3blu_A* 1ypt_A* 3blt_A* 1xxv_A* 3f9b_A 3f9a_A 3f99_A 3bm8_A* 1pa9_A* 1yts_A | Back alignment and structure |
|---|
| >2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* | Back alignment and structure |
|---|
| >3i36_A Vascular protein tyrosine phosphatase 1; PTP, hydrolase; 1.84A {Rattus norvegicus} PDB: 2nz6_A 2cfv_A | Back alignment and structure |
|---|
| >3s3e_A Tyrosine-protein phosphatase 10D; differentiation, neurogenesis, signal transduction, developm protein, hydrolase; 2.40A {Drosophila melanogaster} PDB: 3s3f_A 3s3h_A* 3s3k_A* | Back alignment and structure |
|---|
| >4i8n_A Tyrosine-protein phosphatase non-receptor type 1; PTP1B, hydrolase-hydrolase inhibitor CO; HET: 1CG; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* | Back alignment and structure |
|---|
| >4ge6_A Tyrosine-protein phosphatase non-receptor type 9; hydrolase-hydrolase inhibitor complex; HET: B26; 1.40A {Homo sapiens} PDB: 4ge2_A* 4ge5_A* 2pa5_A* | Back alignment and structure |
|---|
| >2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 | Back alignment and structure |
|---|
| >1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* | Back alignment and structure |
|---|
| >2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A | Back alignment and structure |
|---|
| >2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A | Back alignment and structure |
|---|
| >2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A | Back alignment and structure |
|---|
| >2yf0_A Myotubularin-related protein 6; hydrolase; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1zsq_A Myotubularin-related protein 2; protein-phospholipid complex, hydrolase; HET: PIB; 1.82A {Homo sapiens} SCOP: b.55.1.8 c.45.1.3 PDB: 1zvr_A* | Back alignment and structure |
|---|
| >1lw3_A Myotubularin-related protein 2; protein-phosphate complex, hydrolase; 2.30A {Homo sapiens} SCOP: b.55.1.8 c.45.1.3 PDB: 1m7r_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 249 | ||||
| d1m3ga_ | 145 | c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapien | 6e-28 | |
| d1vhra_ | 178 | c.45.1.1 (A:) VH1-related dual-specificity phospha | 3e-27 | |
| d1mkpa_ | 144 | c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapien | 7e-27 | |
| d1i9sa_ | 194 | c.45.1.1 (A:) mRNA capping enzyme, triphosphatase | 3e-18 | |
| d1ohea2 | 182 | c.45.1.1 (A:199-380) Proline directed phosphatase | 8e-12 | |
| d1d5ra2 | 174 | c.45.1.1 (A:14-187) Phoshphoinositide phosphatase | 4e-10 | |
| d1rxda_ | 152 | c.45.1.1 (A:) Protein tyrosine phosphatase type IV | 5e-10 | |
| d2pt0a1 | 313 | c.45.1.4 (A:34-346) Myo-inositol hexaphosphate pho | 9e-09 | |
| d1fpza_ | 176 | c.45.1.1 (A:) Kinase associated phosphatase (kap) | 6e-07 |
| >d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]} Length = 145 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: (Phosphotyrosine protein) phosphatases II superfamily: (Phosphotyrosine protein) phosphatases II family: Dual specificity phosphatase-like domain: Mapk phosphatase species: Human (Homo sapiens), pac-1 [TaxId: 9606]
Score = 102 bits (254), Expect = 6e-28
Identities = 46/137 (33%), Positives = 65/137 (47%), Gaps = 1/137 (0%)
Query: 2 PNLVEENLYLGDLNDAMGLKSSNEANIKFVFSIGIFPTLGKISSLTYRHIEVADLPSEDL 61
P + L+LG + + L+ I V ++ Y+ I V D ++
Sbjct: 4 PVEILPYLFLGSCSHSSDLQGLQACGITAVLNVSASCPNHFEGLFRYKSIPVEDNQMVEI 63
Query: 62 LSHFDSAYEFIRES-QSEGAILVHCYHGVSRSATIVIAYLMKRDDLGVQTAFDRVKSARD 120
+ F A FI S G +LVH G+SRSATI +AYLM+ + + AFD VK R
Sbjct: 64 SAWFQEAIGFIDWVKNSGGRVLVHSQAGISRSATICLAYLMQSRRVRLDEAFDFVKQRRG 123
Query: 121 VISPNEGFMHQLALYQR 137
VISPN FM QL ++
Sbjct: 124 VISPNFSFMGQLLQFET 140
|
| >d1vhra_ c.45.1.1 (A:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens) [TaxId: 9606]} Length = 178 | Back information, alignment and structure |
|---|
| >d1mkpa_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]} Length = 144 | Back information, alignment and structure |
|---|
| >d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 194 | Back information, alignment and structure |
|---|
| >d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} Length = 182 | Back information, alignment and structure |
|---|
| >d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 174 | Back information, alignment and structure |
|---|
| >d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} Length = 152 | Back information, alignment and structure |
|---|
| >d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} Length = 313 | Back information, alignment and structure |
|---|
| >d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} Length = 176 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 249 | |||
| d1mkpa_ | 144 | Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp | 100.0 | |
| d1m3ga_ | 145 | Mapk phosphatase {Human (Homo sapiens), pac-1 [Tax | 100.0 | |
| d1vhra_ | 178 | VH1-related dual-specificity phosphatase, VHR {Hum | 100.0 | |
| d1ohea2 | 182 | Proline directed phosphatase CDC14b2 {Human (Homo | 99.88 | |
| d1i9sa_ | 194 | mRNA capping enzyme, triphosphatase domain {Mouse | 99.86 | |
| d1fpza_ | 176 | Kinase associated phosphatase (kap) {Human (Homo s | 99.84 | |
| d1rxda_ | 152 | Protein tyrosine phosphatase type IVa {Human (Homo | 99.82 | |
| d1xria_ | 151 | Putative phosphatase At1g05000 {Thale cress (Arabi | 99.71 | |
| d1d5ra2 | 174 | Phoshphoinositide phosphatase Pten (Pten tumor sup | 99.71 | |
| d2pt0a1 | 313 | Myo-inositol hexaphosphate phosphohydrolase (phyta | 99.01 | |
| d1ywfa1 | 272 | Phosphotyrosine protein phosphatase PtpB {Mycobact | 98.87 | |
| d1g4us2 | 243 | SptP tyrosine phosphatase, catalytic domain {Salmo | 98.71 | |
| d1wcha_ | 308 | Tyrosine-protein phosphatase, non-receptor type 13 | 98.66 | |
| d1jlna_ | 297 | Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl | 98.57 | |
| d1lara1 | 317 | RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | 98.53 | |
| d2shpa1 | 307 | Tyrosine phosphatase {Human (Homo sapiens), shp-2 | 98.5 | |
| d1rpma_ | 278 | Tyrosine phosphatase {Human (Homo sapiens), mu [Ta | 98.49 | |
| d1l8ka_ | 273 | Tyrosine phosphatase {Human (Homo sapiens), T-cell | 98.48 | |
| d2f71a1 | 297 | Tyrosine phosphatase {Human (Homo sapiens), 1B [Ta | 98.46 | |
| d1yfoa_ | 288 | Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: | 98.42 | |
| d1lara2 | 249 | RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | 98.41 | |
| d1lyva_ | 283 | Protein-tyrosine phosphatase YopH, catalytic domai | 98.4 | |
| d1p15a_ | 245 | Protein-tyrosine phosphatase alpha {Mouse (Mus mus | 98.39 | |
| d1fpra_ | 284 | Tyrosine phosphatase {Human (Homo sapiens), shp-1 | 98.39 | |
| d1ohea1 | 157 | Proline directed phosphatase CDC14b2 {Human (Homo | 96.11 | |
| d2dlqa2 | 28 | GLI-Krueppel family member HKR3 {Mouse (Mus muscul | 92.1 | |
| d1zsqa2 | 387 | Myotubularin-related protein 2, C-terminal domain | 89.07 | |
| d1urha2 | 120 | 3-mercaptopyruvate sulfurtransferase {Escherichia | 82.92 |
| >d1mkpa_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: (Phosphotyrosine protein) phosphatases II superfamily: (Phosphotyrosine protein) phosphatases II family: Dual specificity phosphatase-like domain: Mapk phosphatase species: Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]
Probab=100.00 E-value=9.6e-40 Score=256.89 Aligned_cols=139 Identities=33% Similarity=0.493 Sum_probs=130.1
Q ss_pred CCCcccCCEEEcCccccCCHhHHHhCCCcEEEEeCcCCCCC--CCCCeEEEEEEeccCCCCchHHHHHHHHHHHHHh-hC
Q psy13471 1 MPNLVEENLYLGDLNDAMGLKSSNEANIKFVFSIGIFPTLG--KISSLTYRHIEVADLPSEDLLSHFDSAYEFIRES-QS 77 (249)
Q Consensus 1 ~P~~I~~~LylG~~~~a~~~~~L~~~gI~~Vl~l~~~~~~~--~~~~~~~~~i~i~D~~~~~l~~~~~~~~~fI~~~-~~ 77 (249)
||+||+|+||+|+..++.+.+.|+++||++|||++.+.... ...++.|+++|+.|.+.+++.++|+.+++||+++ .+
T Consensus 3 ~P~eI~p~lylG~~~~a~~~~~l~~~gI~~Iin~~~~~~~~~~~~~~~~y~~~~~~D~~~~~i~~~~~~~~~~i~~~~~~ 82 (144)
T d1mkpa_ 3 FPVEILPFLYLGCAKDSTNLDVLEEFGIKYILNVTPNLPNLFENAGEFKYKQIPISDHWSQNLSQFFPEAISFIDEARGK 82 (144)
T ss_dssp CCEEEETTEEEECTTSCCCHHHHHHTTEEEEEECCSSCCCEEEEETTEEEEECCCCCSTTCCSGGGHHHHHHHHHHHHHT
T ss_pred CCCeEECCEEECChhHhcCHHHHHhCCCcEEEEccccCCccccCCCceEEEEEEEecCCCCCHHHHHHHHHHHHHHhhhc
Confidence 79999999999999999999999999999999998764221 1378999999999999999999999999999999 89
Q ss_pred CCcEEEEecCCCchhHHHHHHHHHHhCCCCHHHHHHHHHhhCCcccCCHHHHHHHHHHHHhc
Q psy13471 78 EGAILVHCYHGVSRSATIVIAYLMKRDDLGVQTAFDRVKSARDVISPNEGFMHQLALYQRMR 139 (249)
Q Consensus 78 ~~~VLVHC~~G~sRS~tvv~AYLm~~~~~s~~~Al~~vr~~Rp~i~pn~gf~~qL~~~e~~~ 139 (249)
+++|||||.+|+|||+++++||||+++++++++|+++|+++||.+.||.+|++||..||+.+
T Consensus 83 ~~~VlVHC~~G~~RS~~vv~aYLm~~~~~~~~~A~~~v~~~Rp~i~pn~~f~~qL~~~e~~L 144 (144)
T d1mkpa_ 83 NCGVLVHSLAGISRSVTVTVAYLMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQLLDFERTL 144 (144)
T ss_dssp TCEEEEECSSCSHHHHHHHHHHHHHHHTCCHHHHHHHHHHHCTTCCCCSTTHHHHHHHHHTC
T ss_pred cceEEEEecccccchHHHHHHHHHHHhCCCHHHHHHHHHHHCCCCCCCHHHHHHHHHHHhhC
Confidence 99999999999999999999999999999999999999999999999999999999999853
|
| >d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vhra_ c.45.1.1 (A:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xria_ c.45.1.1 (A:) Putative phosphatase At1g05000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} | Back information, alignment and structure |
|---|
| >d1ywfa1 c.45.1.5 (A:4-275) Phosphotyrosine protein phosphatase PtpB {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1g4us2 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, catalytic domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1wcha_ c.45.1.2 (A:) Tyrosine-protein phosphatase, non-receptor type 13 (PTPL1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jlna_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1lara1 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2shpa1 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human (Homo sapiens), shp-2 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rpma_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), mu [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l8ka_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), T-cell [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f71a1 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yfoa_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1lara2 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lyva_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]} | Back information, alignment and structure |
|---|
| >d1p15a_ c.45.1.2 (A:) Protein-tyrosine phosphatase alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fpra_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), shp-1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ohea1 c.45.1.1 (A:42-198) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zsqa2 c.45.1.3 (A:199-585) Myotubularin-related protein 2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1urha2 c.46.1.2 (A:149-268) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|