Psyllid ID: psy13486


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-
MDHNGILYFNLIDRNAVGCWNSQYPYKPENIGHIDIDNEALIFPSDVKVVGDDLWVISDRMPIHLESELNFNDVNFRIFTVPLQEAVREQT
cccccEEEEEEcccccEEEEEcccccccccEEEEEEcccEEEccccEEEEccEEEEEEccccEEEcccccccccEEEEEEccHHHHHHccc
cccccEEEEEEEccccEEEEcccccccHcccEEEEEcccEEEEccccEEccccEEEEEccccHHEEccccccccEEEEEEccHHHHHHccc
MDHNGILYFNLIDrnavgcwnsqypykpenighididnealifpsdvkvvgddlwvisdrmpihleselnfndvnfrIFTVPLQEAVREQT
MDHNGILYFNLIDRNAVGCWNSQYPYKPENIGHIDIDNEALIFPSDVKVVGDDLWVISDRMPIHLeselnfndvnfRIFTVPLQEAVREQT
MDHNGILYFNLIDRNAVGCWNSQYPYKPENIGHIDIDNEALIFPSDVKVVGDDLWVISDRMPIHLESELNFNDVNFRIFTVPLQEAVREQT
****GILYFNLIDRNAVGCWNSQYPYKPENIGHIDIDNEALIFPSDVKVVGDDLWVISDRMPIHLESELNFNDVNFRIFTVPL********
*DHNGILYFNLIDRNAVGCWNSQYPYKPENIGHIDIDNEALIFPSDVKVVGDDLWVISDRMPIHLESELNFNDVNFRIFTVPLQEAVR***
MDHNGILYFNLIDRNAVGCWNSQYPYKPENIGHIDIDNEALIFPSDVKVVGDDLWVISDRMPIHLESELNFNDVNFRIFTVPLQEAVREQT
***NGILYFNLIDRNAVGCWNSQYPYKPENIGHIDIDNEALIFPSDVKVVGDDLWVISDRMPIHLESELNFNDVNFRIFTVPLQEAVRE**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDHNGILYFNLIDRNAVGCWNSQYPYKPENIGHIDIDNEALIFPSDVKVVGDDLWVISDRMPIHLESELNFNDVNFRIFTVPLQEAVREQT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query91 2.2.26 [Sep-21-2011]
Q9GP71 568 Protein yellow OS=Drosoph N/A N/A 0.912 0.146 0.523 2e-21
O02437 568 Protein yellow OS=Drosoph N/A N/A 0.912 0.146 0.511 2e-21
Q9GP81 568 Protein yellow OS=Drosoph N/A N/A 0.912 0.146 0.523 4e-21
Q9BI18 560 Protein yellow OS=Drosoph yes N/A 0.956 0.155 0.5 2e-20
Q9BI17 541 Protein yellow OS=Drosoph N/A N/A 0.956 0.160 0.511 2e-20
Q9BI23 541 Protein yellow OS=Drosoph N/A N/A 0.956 0.160 0.511 2e-20
P09957 541 Protein yellow OS=Drosoph yes N/A 0.956 0.160 0.511 2e-20
P62407 541 Protein yellow OS=Drosoph N/A N/A 0.956 0.160 0.511 2e-20
P62408 541 Protein yellow OS=Drosoph N/A N/A 0.956 0.160 0.511 2e-20
O77061452 Major royal jelly protein no N/A 0.967 0.194 0.284 7e-07
>sp|Q9GP71|YELL_DROMD Protein yellow OS=Drosophila madeirensis GN=y PE=3 SV=1 Back     alignment and function desciption
 Score =  101 bits (251), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 44/84 (52%), Positives = 64/84 (76%), Gaps = 1/84 (1%)

Query: 1   MDHNGILYFNLIDRNAVGCWNSQYPYKPENIGHIDIDNEALIFPSDVKV-VGDDLWVISD 59
           M  +G+  FNLID+NAVGCW+S  PY P++ G +D D+  L+FP+DVK+    ++WV+SD
Sbjct: 320 MSDDGVELFNLIDQNAVGCWHSSMPYSPQSHGIVDRDDVGLVFPADVKIDENKNVWVLSD 379

Query: 60  RMPIHLESELNFNDVNFRIFTVPL 83
           RMP+ L S+L+++D NFRI+T PL
Sbjct: 380 RMPVFLLSDLDYSDTNFRIYTAPL 403




Controls the pigmentation pattern of the adult cuticle and larval mouth parts.
Drosophila madeirensis (taxid: 30013)
>sp|O02437|YELL_DROSU Protein yellow OS=Drosophila subobscura GN=y PE=3 SV=1 Back     alignment and function description
>sp|Q9GP81|YELL_DROGU Protein yellow OS=Drosophila guanche GN=y PE=3 SV=1 Back     alignment and function description
>sp|Q9BI18|YELL_DROPS Protein yellow OS=Drosophila pseudoobscura pseudoobscura GN=y PE=3 SV=2 Back     alignment and function description
>sp|Q9BI17|YELL_DROYA Protein yellow OS=Drosophila yakuba GN=y PE=3 SV=1 Back     alignment and function description
>sp|Q9BI23|YELL_DROER Protein yellow OS=Drosophila erecta GN=y PE=3 SV=1 Back     alignment and function description
>sp|P09957|YELL_DROME Protein yellow OS=Drosophila melanogaster GN=y PE=1 SV=1 Back     alignment and function description
>sp|P62407|YELL_DROSI Protein yellow OS=Drosophila simulans GN=y PE=3 SV=1 Back     alignment and function description
>sp|P62408|YELL_DROMA Protein yellow OS=Drosophila mauritiana GN=y PE=3 SV=1 Back     alignment and function description
>sp|O77061|MRJP2_APIME Major royal jelly protein 2 OS=Apis mellifera GN=MRJP2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query91
288869481 423 yellow-y precursor [Acyrthosiphon pisum] 0.956 0.205 0.693 1e-27
307178532 382 Protein yellow [Camponotus floridanus] 0.956 0.227 0.609 1e-24
294846073 526 yellow [Biston betularia] 0.901 0.155 0.574 7e-24
350413914 429 PREDICTED: protein yellow-like [Bombus i 0.956 0.202 0.597 8e-24
380017835 430 PREDICTED: protein yellow-like [Apis flo 0.956 0.202 0.597 1e-23
340712146 429 PREDICTED: protein yellow-like [Bombus t 0.956 0.202 0.597 1e-23
383850349 603 PREDICTED: protein yellow-like [Megachil 0.956 0.144 0.586 1e-23
290578556 430 yellow-like protein [Apis mellifera] 0.956 0.202 0.586 2e-23
323505959 487 yellow [Heliconius numata] 0.967 0.180 0.573 2e-23
332024125 370 Protein yellow [Acromyrmex echinatior] 0.956 0.235 0.586 4e-23
>gi|288869481|ref|NP_001165848.1| yellow-y precursor [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 75/88 (85%), Gaps = 1/88 (1%)

Query: 1   MDHNGILYFNLIDRNAVGCWNSQYPYKPENIGHIDIDNEALIFPSDVKVVG-DDLWVISD 59
           M  +GIL+FNLIDRNAVGCWNS+ PY+P+N+G ID+D+EALIFPSDVKV   +++WVISD
Sbjct: 311 MHDDGILFFNLIDRNAVGCWNSRLPYEPKNLGIIDVDDEALIFPSDVKVDSLNNVWVISD 370

Query: 60  RMPIHLESELNFNDVNFRIFTVPLQEAV 87
           RMP HL S+LNFND+NFRIF  PL  A+
Sbjct: 371 RMPNHLLSKLNFNDINFRIFFAPLDAAL 398




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|307178532|gb|EFN67221.1| Protein yellow [Camponotus floridanus] Back     alignment and taxonomy information
>gi|294846073|gb|ADF43215.1| yellow [Biston betularia] Back     alignment and taxonomy information
>gi|350413914|ref|XP_003490152.1| PREDICTED: protein yellow-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|380017835|ref|XP_003692850.1| PREDICTED: protein yellow-like [Apis florea] Back     alignment and taxonomy information
>gi|340712146|ref|XP_003394625.1| PREDICTED: protein yellow-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|383850349|ref|XP_003700758.1| PREDICTED: protein yellow-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|290578556|gb|ADD51174.1| yellow-like protein [Apis mellifera] Back     alignment and taxonomy information
>gi|323505959|gb|ADX87343.1| yellow [Heliconius numata] Back     alignment and taxonomy information
>gi|332024125|gb|EGI64341.1| Protein yellow [Acromyrmex echinatior] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query91
FB|FBgn0004034 541 y "yellow" [Drosophila melanog 0.989 0.166 0.510 1.1e-20
FB|FBgn0041713438 yellow-c "yellow-c" [Drosophil 0.813 0.168 0.4 6.2e-14
FB|FBgn0038105452 yellow-f2 "yellow-f2" [Drosoph 0.824 0.165 0.421 1.7e-12
FB|FBgn0039896463 yellow-h "yellow-h" [Drosophil 0.934 0.183 0.366 2.3e-12
FB|FBgn0032601453 yellow-b "yellow-b" [Drosophil 0.923 0.185 0.377 3.7e-12
FB|FBgn0041710447 yellow-f "yellow-f" [Drosophil 0.824 0.167 0.342 4.1e-10
UNIPROTKB|Q8MZM5462 dce "Dopachrome conversion enz 0.923 0.181 0.235 8.2e-08
FB|FBgn0034856412 yellow-d2 "yellow-d2" [Drosoph 0.934 0.206 0.3 1.6e-05
UNIPROTKB|O18330432 MRJP1 "Major royal jelly prote 0.923 0.194 0.275 3.7e-05
FB|FBgn0038151426 yellow-e2 "yellow-e2" [Drosoph 0.967 0.206 0.223 0.00016
FB|FBgn0004034 y "yellow" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 251 (93.4 bits), Expect = 1.1e-20, P = 1.1e-20
 Identities = 47/92 (51%), Positives = 66/92 (71%)

Query:     1 MDHNGILYFNLIDRNAVGCWNSQYPYKPENIGHIDIDNEALIFPSDVKV-VGDDLWVISD 59
             M  +GI  FNLID+NAVGCW+S  PY P+  G +D D+  L+FP+DVK+    ++WV+SD
Sbjct:   313 MSDDGIELFNLIDQNAVGCWHSSMPYSPQFHGIVDRDDVGLVFPADVKIDENKNVWVLSD 372

Query:    60 RMPIHLESELNFNDVNFRIFTVPLQEAVREQT 91
             RMP+ L S+L+++D NFRI+T PL   + E T
Sbjct:   373 RMPVFLLSDLDYSDTNFRIYTAPLATLI-ENT 403




GO:0005576 "extracellular region" evidence=IDA
GO:0048066 "developmental pigmentation" evidence=IEP;IMP;TAS
GO:0005737 "cytoplasm" evidence=IDA
GO:0042438 "melanin biosynthetic process" evidence=IMP
GO:0048067 "cuticle pigmentation" evidence=IGI;IMP
GO:0048065 "male courtship behavior, veined wing extension" evidence=IMP
GO:0006583 "melanin biosynthetic process from tyrosine" evidence=TAS
GO:0060179 "male mating behavior" evidence=IMP
GO:0070451 "cell hair" evidence=IDA
GO:0048082 "regulation of adult chitin-containing cuticle pigmentation" evidence=IGI
GO:0016853 "isomerase activity" evidence=IBA
FB|FBgn0041713 yellow-c "yellow-c" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0038105 yellow-f2 "yellow-f2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0039896 yellow-h "yellow-h" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0032601 yellow-b "yellow-b" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0041710 yellow-f "yellow-f" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q8MZM5 dce "Dopachrome conversion enzyme" [Anopheles gambiae (taxid:7165)] Back     alignment and assigned GO terms
FB|FBgn0034856 yellow-d2 "yellow-d2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|O18330 MRJP1 "Major royal jelly protein 1" [Apis mellifera (taxid:7460)] Back     alignment and assigned GO terms
FB|FBgn0038151 yellow-e2 "yellow-e2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P09957YELL_DROMENo assigned EC number0.51130.95600.1608yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query91
pfam03022285 pfam03022, MRJP, Major royal jelly protein 4e-27
>gnl|CDD|217322 pfam03022, MRJP, Major royal jelly protein Back     alignment and domain information
 Score = 99.3 bits (248), Expect = 4e-27
 Identities = 37/89 (41%), Positives = 62/89 (69%), Gaps = 1/89 (1%)

Query: 1   MDHNGILYFNLIDRNAVGCWNSQYPYKPENIGHIDIDNEALIFPSDVKVVGDD-LWVISD 59
           +D NG+L+F L+ +NAVGCWN+  PY   N+G +  +++ L FPSD+K+  ++ LWV+S+
Sbjct: 193 VDPNGVLFFGLVGQNAVGCWNTSTPYSRANLGVVARNSDTLQFPSDLKIDKEEYLWVLSN 252

Query: 60  RMPIHLESELNFNDVNFRIFTVPLQEAVR 88
           RM   L ++L++++VNFRI    +   +R
Sbjct: 253 RMQKFLYNDLDYDEVNFRILGANVDLLIR 281


Royal jelly is the food of queen bee larvae, and is responsible for the high reproductive ability of the queen. Major royal jelly proteins make up around 90% of larval jelly proteins. This family also the sequence-related yellow protein of drosophila which controls pigmentation of the adult cuticle and larval mouth parts. Length = 285

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 91
PF03022287 MRJP: Major royal jelly protein; InterPro: IPR0035 99.97
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 94.6
PF0308889 Str_synth: Strictosidine synthase; InterPro: IPR01 94.11
PF0143628 NHL: NHL repeat; InterPro: IPR001258 The NHL repea 92.23
PF0005842 Ldl_recept_b: Low-density lipoprotein receptor rep 92.07
COG3386307 Gluconolactonase [Carbohydrate transport and metab 90.19
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 89.1
>PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12 Back     alignment and domain information
Probab=99.97  E-value=2.2e-31  Score=199.45  Aligned_cols=91  Identities=36%  Similarity=0.739  Sum_probs=75.9

Q ss_pred             CCccCeEEEEeCCCCcEEEeeCCCCCCCCceeeEeecCCeeeeccceEEeC---CEEEEEEeCCcceecCCCCCCcceEE
Q psy13486          1 MDHNGILYFNLIDRNAVGCWNSQYPYKPENIGHIDIDNEALIFPSDVKVVG---DDLWVISDRMPIHLESELNFNDVNFR   77 (91)
Q Consensus         1 ~d~~gvlff~lv~~~aI~cWn~~~~~~~~n~~iia~d~~~l~f~sdlkid~---~~lWvlsnrl~~f~~~~l~~~e~NfR   77 (91)
                      ||++|+|||++++++||+|||+++||+++|+.+|++|+++|+||++|+|++   |+||++|||||+|++++++++|+|||
T Consensus       193 ~D~~G~ly~~~~~~~aI~~w~~~~~~~~~~~~~l~~d~~~l~~pd~~~i~~~~~g~L~v~snrl~~~~~~~~~~~e~nfr  272 (287)
T PF03022_consen  193 IDPNGNLYFTDVEQNAIGCWDPDGPYTPENFEILAQDPRTLQWPDGLKIDPEGDGYLWVLSNRLQRFAYGNLNPDEVNFR  272 (287)
T ss_dssp             EETTTEEEEEECCCTEEEEEETTTSB-GCCEEEEEE-CC-GSSEEEEEE-T--TS-EEEEE-S--SSTGGG---SS-SEE
T ss_pred             ECCCCcEEEecCCCCeEEEEeCCCCcCccchheeEEcCceeeccceeeeccccCceEEEEECcchHhhccCCCCCccEEe
Confidence            579999999999999999999999999999999999999999999999995   89999999999999999999999999


Q ss_pred             EEecCHHHHHhcCC
Q psy13486         78 IFTVPLQEAVREQT   91 (91)
Q Consensus        78 I~~~~~~~~i~gt~   91 (91)
                      |+++++++||+||+
T Consensus       273 i~~~~v~~~~~~t~  286 (287)
T PF03022_consen  273 IWRARVDELIKGTV  286 (287)
T ss_dssp             EEES-HHHHHTTST
T ss_pred             EEEeCHHHHhcCCC
Confidence            99999999999996



5% of the mass, and 82-90% of the protein content [], of honeybee (Apis mellifera) royal jelly. Royal jelly is a substance secreted by the cephalic glands of nurse bees [] and it is used to trigger development of a queen bee from a bee larva. The biological function of the MRJPs is unknown, but they are believed to play a major role in nutrition due to their high essential amino acid content []. Two royal jelly proteins, MRJP3 and MRJP5, contain a tandem repeat that results from a high genetic variablility. This polymorphism may be useful for genotyping individual bees [].; PDB: 3Q6P_B 3Q6K_A 3Q6T_A 2QE8_B.

>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4 Back     alignment and domain information
>PF01436 NHL: NHL repeat; InterPro: IPR001258 The NHL repeat, named after NCL-1, HT2A and Lin-41, is found largely in a large number of eukaryotic and prokaryotic proteins Back     alignment and domain information
>PF00058 Ldl_recept_b: Low-density lipoprotein receptor repeat class B; InterPro: IPR000033 The low-density lipoprotein receptor (LDLR) is the major cholesterol-carrying lipoprotein of plasma, acting to regulate cholesterol homeostasis in mammalian cells Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query91
3q6k_A381 43.2 kDa salivary protein; beta propeller, binding 3e-19
2qe8_A343 Uncharacterized protein; structural genomics, join 2e-09
>3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A* Length = 381 Back     alignment and structure
 Score = 79.4 bits (195), Expect = 3e-19
 Identities = 19/91 (20%), Positives = 38/91 (41%), Gaps = 3/91 (3%)

Query: 1   MDHNGILYFNLIDRNAVGCWNSQYPYKPENIGHIDIDNEALIFPSDVKVVGDD-LWVISD 59
                +++F   +   V CWN+Q          +   +   +F +D+ V     LW +S+
Sbjct: 283 DPKTKVIFFAEANTKQVSCWNTQKMPLRMKNTDVVYTSSRFVFGTDISVDSKGGLWFMSN 342

Query: 60  RMPIHLESE-LNFNDVNFRIFTV-PLQEAVR 88
             P   +SE   ++   +R+  +   QEA+ 
Sbjct: 343 GFPPIRKSEKFKYDFPRYRLMRIMDTQEAIA 373


>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Length = 343 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query91
3q6k_A381 43.2 kDa salivary protein; beta propeller, binding 99.96
2qe8_A343 Uncharacterized protein; structural genomics, join 99.15
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 93.68
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 93.11
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 93.02
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 92.99
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 92.94
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 92.49
2p4o_A306 Hypothetical protein; putative lactonase, structur 92.21
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 92.11
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 92.02
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 91.6
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 91.53
3e5z_A 296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 91.47
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 91.23
2p9w_A 334 MAL S 1 allergenic protein; beta propeller; 1.35A 91.06
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 90.35
2fp8_A322 Strictosidine synthase; six bladed beta propeller 90.16
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 89.77
3v65_B386 Low-density lipoprotein receptor-related protein; 89.69
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 89.64
2z2n_A 299 Virginiamycin B lyase; seven-bladed beta-propeller 89.43
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 89.14
1ijq_A 316 LDL receptor, low-density lipoprotein receptor; be 89.0
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 88.89
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 88.58
2dg1_A 333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 88.55
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 88.5
2dg1_A 333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 88.08
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 87.95
3p5b_L400 Low density lipoprotein receptor variant; B-propel 87.9
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 87.64
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 87.6
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 87.3
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 87.16
3v65_B 386 Low-density lipoprotein receptor-related protein; 87.09
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 86.84
3dr2_A 305 Exported gluconolactonase; gluconolactonase SMP-30 86.63
3g4e_A 297 Regucalcin; six bladed beta-propeller, gluconolcat 86.61
3sov_A 318 LRP-6, low-density lipoprotein receptor-related pr 86.4
2p4o_A 306 Hypothetical protein; putative lactonase, structur 85.92
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 85.41
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 85.34
3fvz_A 329 Peptidyl-glycine alpha-amidating monooxygenase; be 85.2
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 85.08
3s94_A 619 LRP-6, low-density lipoprotein receptor-related pr 84.74
2fp8_A322 Strictosidine synthase; six bladed beta propeller 84.26
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 83.35
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 82.98
3tc9_A 430 Hypothetical hydrolase; 6-bladed beta-propeller, i 80.7
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 80.68
>3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A* Back     alignment and structure
Probab=99.96  E-value=5.9e-30  Score=197.45  Aligned_cols=90  Identities=24%  Similarity=0.543  Sum_probs=87.5

Q ss_pred             CC-ccCeEEEEeCCCCcEEEeeCCC-CCCCCceeeEeecCCeeeeccceEEe-CCEEEEEEeCCcceecCCC-CCCcceE
Q psy13486          1 MD-HNGILYFNLIDRNAVGCWNSQY-PYKPENIGHIDIDNEALIFPSDVKVV-GDDLWVISDRMPIHLESEL-NFNDVNF   76 (91)
Q Consensus         1 ~d-~~gvlff~lv~~~aI~cWn~~~-~~~~~n~~iia~d~~~l~f~sdlkid-~~~lWvlsnrl~~f~~~~l-~~~e~Nf   76 (91)
                      || ++|+|||++++++||+|||+++ ||+++|+++|++|+ +|+||+||+++ +|+|||+|||||+|+++++ |.+|+||
T Consensus       282 ~D~~~G~ly~~~~~~~aI~~w~~~~~~~~~~n~~~l~~d~-~l~~pd~~~i~~~g~Lwv~sn~l~~~~~g~l~d~~~~nf  360 (381)
T 3q6k_A          282 YDPKTKVIFFAEANTKQVSCWNTQKMPLRMKNTDVVYTSS-RFVFGTDISVDSKGGLWFMSNGFPPIRKSEKFKYDFPRY  360 (381)
T ss_dssp             ECTTTCEEEEEESSSSEEEEEETTSCSBCGGGEEEEEECT-TCCSEEEEEECTTSCEEEEECSCCSSTTGGGCCCSSCSE
T ss_pred             EeCCCCeEEEEeccCCeEEEEeCCCCccccCceEEEEECC-CccccCeEEECCCCeEEEEECcchHhhcCCcCCCCcCCE
Confidence            45 8999999999999999999999 99999999999999 99999999999 8999999999999999999 9999999


Q ss_pred             EEEec-CHHHHHhcCC
Q psy13486         77 RIFTV-PLQEAVREQT   91 (91)
Q Consensus        77 RI~~~-~~~~~i~gt~   91 (91)
                      ||+|+ +++++|+||+
T Consensus       361 rI~r~~~~~~~i~~t~  376 (381)
T 3q6k_A          361 RLMRIMDTQEAIAGTA  376 (381)
T ss_dssp             EEEEESCHHHHHTTST
T ss_pred             EEEEecCHHHHhcCCC
Confidence            99999 9999999995



>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query91
d2dg1a1 319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 93.85
d2p4oa1 302 Hypothetical protein All0351 homologue {Nostoc pun 93.3
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 92.77
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 92.69
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 92.11
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 91.89
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 91.65
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 91.41
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 91.13
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 90.57
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 89.64
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 87.17
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 86.75
d2ghsa1 295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 86.66
d1pjxa_ 314 Diisopropylfluorophosphatase (phosphotriesterase, 86.03
d1npea_ 263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 82.08
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Calcium-dependent phosphotriesterase
family: SGL-like
domain: Lactonase Drp35
species: Staphylococcus aureus [TaxId: 1280]
Probab=93.85  E-value=0.053  Score=37.14  Aligned_cols=52  Identities=15%  Similarity=0.075  Sum_probs=39.1

Q ss_pred             CccCeEEEEeCCCCcEEEeeCCCCCCCCceeeEeecCCeeeeccceEEe-CCEEEEEEe
Q psy13486          2 DHNGILYFNLIDRNAVGCWNSQYPYKPENIGHIDIDNEALIFPSDVKVV-GDDLWVISD   59 (91)
Q Consensus         2 d~~gvlff~lv~~~aI~cWn~~~~~~~~n~~iia~d~~~l~f~sdlkid-~~~lWvlsn   59 (91)
                      |++|.|||+.+....|..|+..+.-   -...++..   ...|.+|.++ +|.|||.+.
T Consensus        48 D~~G~Ly~~D~~~g~I~ri~p~g~~---~~~~~~~~---~~~p~gla~~~dG~l~va~~  100 (319)
T d2dg1a1          48 DRQGQLFLLDVFEGNIFKINPETKE---IKRPFVSH---KANPAAIKIHKDGRLFVCYL  100 (319)
T ss_dssp             CTTSCEEEEETTTCEEEEECTTTCC---EEEEEECS---SSSEEEEEECTTSCEEEEEC
T ss_pred             CCCCCEEEEECCCCEEEEEECCCCe---EEEEEeCC---CCCeeEEEECCCCCEEEEec
Confidence            7789999999999999999987642   12233322   2369999999 899998753



>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure