Psyllid ID: psy13542
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 147 | ||||||
| 242021355 | 477 | Peroxisomal N1-acetyl-spermine/spermidin | 0.857 | 0.264 | 0.416 | 1e-17 | |
| 321472409 | 484 | hypothetical protein DAPPUDRAFT_301970 [ | 0.863 | 0.262 | 0.389 | 6e-17 | |
| 307183354 | 475 | Peroxisomal N(1)-acetyl-spermine/spermid | 0.897 | 0.277 | 0.380 | 2e-16 | |
| 321466720 | 481 | hypothetical protein DAPPUDRAFT_53901 [D | 0.918 | 0.280 | 0.391 | 2e-16 | |
| 322795354 | 838 | hypothetical protein SINV_80022 [Solenop | 0.897 | 0.157 | 0.365 | 3e-15 | |
| 332019664 | 563 | Peroxisomal N(1)-acetyl-spermine/spermid | 0.877 | 0.229 | 0.366 | 4e-15 | |
| 270002494 | 931 | hypothetical protein TcasGA2_TC004564 [T | 0.965 | 0.152 | 0.333 | 4e-15 | |
| 170054634 | 481 | spermine oxidase [Culex quinquefasciatus | 0.870 | 0.266 | 0.375 | 8e-15 | |
| 383858521 | 513 | PREDICTED: peroxisomal N(1)-acetyl-sperm | 0.823 | 0.235 | 0.370 | 9e-15 | |
| 332019665 | 755 | Peroxisomal N(1)-acetyl-spermine/spermid | 0.897 | 0.174 | 0.343 | 1e-14 |
| >gi|242021355|ref|XP_002431110.1| Peroxisomal N1-acetyl-spermine/spermidine oxidase precursor, putative [Pediculus humanus corporis] gi|212516359|gb|EEB18372.1| Peroxisomal N1-acetyl-spermine/spermidine oxidase precursor, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Score = 94.7 bits (234), Expect = 1e-17, Method: Composition-based stats.
Identities = 57/137 (41%), Positives = 75/137 (54%), Gaps = 11/137 (8%)
Query: 1 MDYVGKNQNTYDGSENWFETSARGLDSFTDLEGCFGVVWKKGGYGNVFKLLMKQMPG--- 57
++Y K QN DGS +W ETS RG + D G G+ WK + +F +L +PG
Sbjct: 161 VNYFEKWQNGLDGSHSWHETSLRGQLEYWDCPGNQGITWKNNRFSALFNILSGNIPGVSK 220
Query: 58 QTPIDLSKKLLLKKEVTKINW-----EDPKGVVVTCADGTQYSADRILITVSLGVLKSNL 112
Q P++ +K+L KEV I W ++ V+VTC DG+ YS D IL+T SLGVLK
Sbjct: 221 QYPVE--EKVLFNKEVKFIKWNKECDKNVPNVLVTCTDGSMYSTDHILLTCSLGVLKEKS 278
Query: 113 IT-FVPPLPPKKLTAIE 128
F P LP KK IE
Sbjct: 279 TKLFSPALPLKKQLCIE 295
|
Source: Pediculus humanus corporis Species: Pediculus humanus Genus: Pediculus Family: Pediculidae Order: Phthiraptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|321472409|gb|EFX83379.1| hypothetical protein DAPPUDRAFT_301970 [Daphnia pulex] | Back alignment and taxonomy information |
|---|
| >gi|307183354|gb|EFN70212.1| Peroxisomal N(1)-acetyl-spermine/spermidine oxidase [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|321466720|gb|EFX77714.1| hypothetical protein DAPPUDRAFT_53901 [Daphnia pulex] | Back alignment and taxonomy information |
|---|
| >gi|322795354|gb|EFZ18159.1| hypothetical protein SINV_80022 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|332019664|gb|EGI60138.1| Peroxisomal N(1)-acetyl-spermine/spermidine oxidase [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|270002494|gb|EEZ98941.1| hypothetical protein TcasGA2_TC004564 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|170054634|ref|XP_001863219.1| spermine oxidase [Culex quinquefasciatus] gi|167874906|gb|EDS38289.1| spermine oxidase [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|383858521|ref|XP_003704749.1| PREDICTED: peroxisomal N(1)-acetyl-spermine/spermidine oxidase-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|332019665|gb|EGI60139.1| Peroxisomal N(1)-acetyl-spermine/spermidine oxidase [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 147 | ||||||
| FB|FBgn0035943 | 480 | CG5653 [Drosophila melanogaste | 0.891 | 0.272 | 0.345 | 6e-14 | |
| FB|FBgn0036749 | 486 | CG7460 [Drosophila melanogaste | 0.945 | 0.286 | 0.335 | 2e-12 | |
| FB|FBgn0033584 | 509 | CG7737 [Drosophila melanogaste | 0.836 | 0.241 | 0.357 | 9.8e-12 | |
| ZFIN|ZDB-GENE-030131-5768 | 495 | zgc:66484 "zgc:66484" [Danio r | 0.782 | 0.232 | 0.346 | 1.5e-11 | |
| FB|FBgn0036750 | 479 | CG6034 [Drosophila melanogaste | 0.850 | 0.260 | 0.330 | 2.4e-11 | |
| TAIR|locus:2018571 | 497 | PAO4 "polyamine oxidase 4" [Ar | 0.687 | 0.203 | 0.364 | 2e-07 | |
| TAIR|locus:2173219 | 472 | PAO1 "polyamine oxidase 1" [Ar | 0.442 | 0.137 | 0.378 | 2.3e-07 | |
| UNIPROTKB|G4MR69 | 1200 | MGG_09915 "Lysine-specific his | 0.782 | 0.095 | 0.330 | 7.9e-07 | |
| CGD|CAL0002916 | 477 | orf19.4589 [Candida albicans ( | 0.687 | 0.211 | 0.333 | 2.8e-06 | |
| TAIR|locus:2134393 | 533 | PAO5 "polyamine oxidase 5" [Ar | 0.523 | 0.144 | 0.404 | 3.3e-06 |
| FB|FBgn0035943 CG5653 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 188 (71.2 bits), Expect = 6.0e-14, P = 6.0e-14
Identities = 47/136 (34%), Positives = 75/136 (55%)
Query: 6 KNQNTYDGSENWFETSARGLDSFTDLEGCFGVVWKKGGYGNVFKLLMKQMPGQTPIDLSK 65
K++++ G++N FE S R + + +G + W GY +LLMK + TP +L
Sbjct: 166 KHESSIIGADNLFEVSVREHIEYHECDGDKLLHWGTKGYRRFLRLLMK-VSEDTPEELGL 224
Query: 66 ---KLLLKKEVTKINWEDPKGVVVTCADGTQYSADRILITVSLGVLKS-NLITFVPPLPP 121
++ L K+V KI P+ V++ C DG + AD ++ TVSLGVL+ + FVPPLP
Sbjct: 225 LEGRIQLDKKVIKIELACPRKVILRCQDGDYFGADHVICTVSLGVLQEQHEKLFVPPLPA 284
Query: 122 KKLTAIELTNLTSIQQ 137
K+ AI L ++ +
Sbjct: 285 AKVNAIRSLTLGTVNK 300
|
|
| FB|FBgn0036749 CG7460 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0033584 CG7737 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-5768 zgc:66484 "zgc:66484" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0036750 CG6034 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2018571 PAO4 "polyamine oxidase 4" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2173219 PAO1 "polyamine oxidase 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G4MR69 MGG_09915 "Lysine-specific histone demethylase 1" [Magnaporthe oryzae 70-15 (taxid:242507)] | Back alignment and assigned GO terms |
|---|
| CGD|CAL0002916 orf19.4589 [Candida albicans (taxid:5476)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2134393 PAO5 "polyamine oxidase 5" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 147 | |||
| PLN02268 | 435 | PLN02268, PLN02268, probable polyamine oxidase | 2e-15 | |
| PLN02676 | 487 | PLN02676, PLN02676, polyamine oxidase | 2e-14 | |
| pfam01593 | 444 | pfam01593, Amino_oxidase, Flavin containing amine | 2e-13 | |
| PLN02568 | 539 | PLN02568, PLN02568, polyamine oxidase | 7e-13 | |
| PLN02976 | 1713 | PLN02976, PLN02976, amine oxidase | 9e-10 | |
| COG1231 | 450 | COG1231, COG1231, Monoamine oxidase [Amino acid tr | 3e-07 | |
| PLN03000 | 881 | PLN03000, PLN03000, amine oxidase | 2e-06 | |
| PLN02529 | 738 | PLN02529, PLN02529, lysine-specific histone demeth | 2e-05 | |
| PLN02328 | 808 | PLN02328, PLN02328, lysine-specific histone demeth | 2e-05 |
| >gnl|CDD|177909 PLN02268, PLN02268, probable polyamine oxidase | Back alignment and domain information |
|---|
Score = 71.3 bits (175), Expect = 2e-15
Identities = 45/118 (38%), Positives = 55/118 (46%), Gaps = 18/118 (15%)
Query: 15 ENWFET-----SARGLDSFTDLEGCFGVVWKKGGYGNVFKLLMKQMPGQTPIDLSKKLLL 69
E WF S + D LEG G++ + GY V L K +D+ L
Sbjct: 168 EGWFAADADTISLKSWDQEELLEGGHGLMVR--GYDPVINTLAKG------LDIR----L 215
Query: 70 KKEVTKINWEDPKGVVVTCADGTQYSADRILITVSLGVLKSNLITFVPPLPPKKLTAI 127
VTKI GV VT DGT + AD +I V LGVLK+N+I F P LP K AI
Sbjct: 216 NHRVTKIV-RRYNGVKVTVEDGTTFVADAAIIAVPLGVLKANIIKFEPELPEWKEEAI 272
|
Length = 435 |
| >gnl|CDD|215362 PLN02676, PLN02676, polyamine oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|216593 pfam01593, Amino_oxidase, Flavin containing amine oxidoreductase | Back alignment and domain information |
|---|
| >gnl|CDD|215308 PLN02568, PLN02568, polyamine oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|215527 PLN02976, PLN02976, amine oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|224152 COG1231, COG1231, Monoamine oxidase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|178578 PLN03000, PLN03000, amine oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|178144 PLN02529, PLN02529, lysine-specific histone demethylase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|215187 PLN02328, PLN02328, lysine-specific histone demethylase 1 homolog | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 147 | ||||
| 1b37_A | 472 | A 30 Angstrom U-Shaped Catalytic Tunnel In The Crys | 3e-08 | ||
| 3kpf_A | 478 | X-Ray Structure Of The Mutant Lys300met Of Polyamin | 3e-08 | ||
| 4gu1_A | 784 | Crystal Structure Of Lsd2 Length = 784 | 1e-06 | ||
| 4gur_A | 776 | Crystal Structure Of Lsd2-npac With H3 In Space Gro | 1e-06 | ||
| 4fwe_A | 796 | Native Structure Of Lsd2 /aof1/kdm1b In Spacegroup | 1e-06 | ||
| 1yy5_A | 513 | Crystal Structure Of Fms1, A Polyamine Oxidase From | 1e-05 | ||
| 1z6l_A | 516 | Crystal Structure Of Fms1 In Complex With Its Subst | 2e-05 | ||
| 4gdp_A | 516 | Yeast Polyamine Oxidase Fms1, N195a Mutant Length = | 2e-05 | ||
| 1rsg_A | 516 | Crystal Structure Of The Polyamine Oxidase Fms1 Fro | 2e-05 | ||
| 4ech_A | 516 | Yeast Polyamine Oxidase Fms1, H67q Mutant Length = | 2e-05 |
| >pdb|1B37|A Chain A, A 30 Angstrom U-Shaped Catalytic Tunnel In The Crystal Structure Of Polyamine Oxidase Length = 472 | Back alignment and structure |
|
| >pdb|3KPF|A Chain A, X-Ray Structure Of The Mutant Lys300met Of Polyamine Oxidase From Zea Mays Length = 478 | Back alignment and structure |
| >pdb|4GU1|A Chain A, Crystal Structure Of Lsd2 Length = 784 | Back alignment and structure |
| >pdb|4GUR|A Chain A, Crystal Structure Of Lsd2-npac With H3 In Space Group P21 Length = 776 | Back alignment and structure |
| >pdb|4FWE|A Chain A, Native Structure Of Lsd2 /aof1/kdm1b In Spacegroup Of C2221 At 2.13a Length = 796 | Back alignment and structure |
| >pdb|1YY5|A Chain A, Crystal Structure Of Fms1, A Polyamine Oxidase From Yeast Length = 513 | Back alignment and structure |
| >pdb|1Z6L|A Chain A, Crystal Structure Of Fms1 In Complex With Its Substrate Length = 516 | Back alignment and structure |
| >pdb|4GDP|A Chain A, Yeast Polyamine Oxidase Fms1, N195a Mutant Length = 516 | Back alignment and structure |
| >pdb|1RSG|A Chain A, Crystal Structure Of The Polyamine Oxidase Fms1 From Yeast Length = 516 | Back alignment and structure |
| >pdb|4ECH|A Chain A, Yeast Polyamine Oxidase Fms1, H67q Mutant Length = 516 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 147 | |||
| 1b37_A | 472 | Protein (polyamine oxidase); flavin-dependent amin | 1e-31 | |
| 1rsg_A | 516 | FMS1 protein; FAD binding motif, oxidoreductase; H | 3e-25 | |
| 1s3e_A | 520 | Amine oxidase [flavin-containing] B; human monoami | 7e-24 | |
| 2vvm_A | 495 | Monoamine oxidase N; FAD, peroxisome, flavoprotein | 1e-22 | |
| 2yg5_A | 453 | Putrescine oxidase; oxidoreductase, flavin; HET: F | 2e-22 | |
| 2z3y_A | 662 | Lysine-specific histone demethylase 1; chromatin, | 5e-22 | |
| 2xag_A | 852 | Lysine-specific histone demethylase 1; amine oxida | 2e-21 | |
| 3k7m_X | 431 | 6-hydroxy-L-nicotine oxidase; enantiomeric substra | 9e-21 | |
| 2iid_A | 498 | L-amino-acid oxidase; flavoenzyme, FAD binding dom | 2e-15 | |
| 2jae_A | 489 | L-amino acid oxidase; oxidoreductase, dimerisation | 2e-12 | |
| 2e1m_B | 130 | L-glutamate oxidase; L-amino acid oxidase, FAD, L- | 8e-07 |
| >1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Length = 472 | Back alignment and structure |
|---|
Score = 116 bits (291), Expect = 1e-31
Identities = 40/131 (30%), Positives = 59/131 (45%), Gaps = 4/131 (3%)
Query: 1 MDYVGKNQNTYDGSENWFETSARGLDSFTDLEGCFGVVWKKGGYGNVFKLLMKQMPGQTP 60
+DY + + + L +F+D V + GY V L Q
Sbjct: 162 VDYYKFDYEFAEPPRVTSLQNTVPLATFSDFGDDVYFVADQRGYEAVVYYLAGQYLKTDD 221
Query: 61 I---DLSKKLLLKKEVTKINWEDPKGVVVTCADGTQYSADRILITVSLGVLKSNLITFVP 117
+ +L L K V +I + P GV V D + YSAD ++++ SLGVL+S+LI F P
Sbjct: 222 KSGKIVDPRLQLNKVVREIKY-SPGGVTVKTEDNSVYSADYVMVSASLGVLQSDLIQFKP 280
Query: 118 PLPPKKLTAIE 128
LP K+ AI
Sbjct: 281 KLPTWKVRAIY 291
|
| >1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Length = 516 | Back alignment and structure |
|---|
| >1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Length = 520 | Back alignment and structure |
|---|
| >2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Length = 495 | Back alignment and structure |
|---|
| >2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Length = 453 | Back alignment and structure |
|---|
| >2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Length = 662 | Back alignment and structure |
|---|
| >2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Length = 852 | Back alignment and structure |
|---|
| >3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Length = 431 | Back alignment and structure |
|---|
| >2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Length = 498 | Back alignment and structure |
|---|
| >2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Length = 489 | Back alignment and structure |
|---|
| >2e1m_B L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Length = 130 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 147 | |||
| 2z3y_A | 662 | Lysine-specific histone demethylase 1; chromatin, | 99.77 | |
| 2xag_A | 852 | Lysine-specific histone demethylase 1; amine oxida | 99.74 | |
| 1rsg_A | 516 | FMS1 protein; FAD binding motif, oxidoreductase; H | 99.72 | |
| 1s3e_A | 520 | Amine oxidase [flavin-containing] B; human monoami | 99.71 | |
| 2vvm_A | 495 | Monoamine oxidase N; FAD, peroxisome, flavoprotein | 99.69 | |
| 4gut_A | 776 | Lysine-specific histone demethylase 1B; histone de | 99.68 | |
| 1b37_A | 472 | Protein (polyamine oxidase); flavin-dependent amin | 99.67 | |
| 2yg5_A | 453 | Putrescine oxidase; oxidoreductase, flavin; HET: F | 99.66 | |
| 2iid_A | 498 | L-amino-acid oxidase; flavoenzyme, FAD binding dom | 99.65 | |
| 3k7m_X | 431 | 6-hydroxy-L-nicotine oxidase; enantiomeric substra | 99.6 | |
| 2jae_A | 489 | L-amino acid oxidase; oxidoreductase, dimerisation | 99.56 | |
| 3ayj_A | 721 | Pro-enzyme of L-phenylalanine oxidase; amino acid | 99.53 | |
| 3i6d_A | 470 | Protoporphyrinogen oxidase; protein-inhibitor comp | 99.49 | |
| 2ivd_A | 478 | PPO, PPOX, protoporphyrinogen oxidase; porphyrin b | 99.48 | |
| 3qj4_A | 342 | Renalase; FAD/NAD(P)-binding rossmann fold superfa | 99.46 | |
| 3lov_A | 475 | Protoporphyrinogen oxidase; structural genomics, J | 99.44 | |
| 2e1m_B | 130 | L-glutamate oxidase; L-amino acid oxidase, FAD, L- | 99.38 | |
| 4dsg_A | 484 | UDP-galactopyranose mutase; rossmann fold, flavin | 99.36 | |
| 3nks_A | 477 | Protoporphyrinogen oxidase; FAD containing protein | 99.35 | |
| 1sez_A | 504 | Protoporphyrinogen oxidase, mitochondrial; FAD-bin | 99.26 | |
| 3ka7_A | 425 | Oxidoreductase; structural genomics, PSI-2, protei | 99.25 | |
| 4dgk_A | 501 | Phytoene dehydrogenase; the FAD/NAD(P)-binding ros | 99.19 | |
| 3nrn_A | 421 | Uncharacterized protein PF1083; alpha-beta protein | 99.17 | |
| 4gde_A | 513 | UDP-galactopyranose mutase; flavin adenine dinucle | 99.06 | |
| 2b9w_A | 424 | Putative aminooxidase; isomerase, conjugated linol | 99.01 | |
| 1yvv_A | 336 | Amine oxidase, flavin-containing; oxidoreductase, | 98.71 | |
| 1v0j_A | 399 | UDP-galactopyranose mutase; flavoprotein, isomeras | 98.23 | |
| 1d5t_A | 433 | Guanine nucleotide dissociation inhibitor; ultra-h | 98.07 | |
| 3p1w_A | 475 | Rabgdi protein; GDI RAB, malaria, structural genom | 98.04 | |
| 1vg0_A | 650 | RAB proteins geranylgeranyltransferase component A | 97.96 | |
| 2bcg_G | 453 | Secretory pathway GDP dissociation inhibitor; RABG | 97.93 | |
| 2bi7_A | 384 | UDP-galactopyranose mutase; FAD, flavoprotein, iso | 97.9 | |
| 1i8t_A | 367 | UDP-galactopyranose mutase; rossman fold, FAD, con | 97.84 | |
| 3hdq_A | 397 | UDP-galactopyranose mutase; substrate and inhibito | 97.54 | |
| 2e1m_A | 376 | L-glutamate oxidase; L-amino acid oxidase, FAD, L- | 97.44 | |
| 3dje_A | 438 | Fructosyl amine: oxygen oxidoreductase; fructosyl- | 96.98 | |
| 3nyc_A | 381 | D-arginine dehydrogenase; FAD, imino-arginine, oxi | 96.9 | |
| 3dme_A | 369 | Conserved exported protein; structural genomics, P | 96.8 | |
| 3ps9_A | 676 | TRNA 5-methylaminomethyl-2-thiouridine biosynthes | 96.75 | |
| 3pvc_A | 689 | TRNA 5-methylaminomethyl-2-thiouridine biosynthes | 96.66 | |
| 2uzz_A | 372 | N-methyl-L-tryptophan oxidase; N-methyltryptophan | 96.52 | |
| 1y56_B | 382 | Sarcosine oxidase; dehydrogenase, protein-protein | 96.43 | |
| 4hb9_A | 412 | Similarities with probable monooxygenase; flavin, | 96.38 | |
| 2xdo_A | 398 | TETX2 protein; tetracycline degradation, tigecycli | 96.37 | |
| 3v76_A | 417 | Flavoprotein; structural genomics, PSI-biology, NE | 96.36 | |
| 1ryi_A | 382 | Glycine oxidase; flavoprotein, protein-inhibitor c | 96.33 | |
| 2vou_A | 397 | 2,6-dihydroxypyridine hydroxylase; oxidoreductase, | 96.31 | |
| 2oln_A | 397 | NIKD protein; flavoprotein, rossmann fold, oxidore | 96.31 | |
| 2i0z_A | 447 | NAD(FAD)-utilizing dehydrogenases; structural geno | 96.28 | |
| 2gf3_A | 389 | MSOX, monomeric sarcosine oxidase; flavoprotein ox | 96.27 | |
| 2v3a_A | 384 | Rubredoxin reductase; alkane degradation, NADH oxi | 96.13 | |
| 3rp8_A | 407 | Flavoprotein monooxygenase; FAD-binding protein, o | 96.03 | |
| 2ywl_A | 180 | Thioredoxin reductase related protein; uncharacter | 96.0 | |
| 3nlc_A | 549 | Uncharacterized protein VP0956; FAD-binding protei | 95.99 | |
| 1xdi_A | 499 | RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun | 95.98 | |
| 3iwa_A | 472 | FAD-dependent pyridine nucleotide-disulphide oxido | 95.97 | |
| 3o0h_A | 484 | Glutathione reductase; ssgcid, structur genomics, | 95.95 | |
| 3lxd_A | 415 | FAD-dependent pyridine nucleotide-disulphide oxido | 95.84 | |
| 2gqf_A | 401 | Hypothetical protein HI0933; structural genomics, | 95.81 | |
| 3oc4_A | 452 | Oxidoreductase, pyridine nucleotide-disulfide FAM; | 95.62 | |
| 3fg2_P | 404 | Putative rubredoxin reductase; ferredoxin reductas | 95.6 | |
| 1m6i_A | 493 | Programmed cell death protein 8; apoptosis, AIF, o | 95.53 | |
| 2x3n_A | 399 | Probable FAD-dependent monooxygenase; oxidoreducta | 95.51 | |
| 2yqu_A | 455 | 2-oxoglutarate dehydrogenase E3 component; lipoami | 95.41 | |
| 2gag_B | 405 | Heterotetrameric sarcosine oxidase beta-subunit; f | 95.33 | |
| 1fec_A | 490 | Trypanothione reductase; redox-active center, oxid | 95.29 | |
| 1mo9_A | 523 | ORF3; nucleotide binding motifs, nucleotide bindin | 95.26 | |
| 2zbw_A | 335 | Thioredoxin reductase; redox protein, oxidoreducta | 95.23 | |
| 3ab1_A | 360 | Ferredoxin--NADP reductase; oxidoreductase, electr | 95.21 | |
| 3ef6_A | 410 | Toluene 1,2-dioxygenase system ferredoxin--NAD(+) | 95.19 | |
| 2wpf_A | 495 | Trypanothione reductase; oxidoreductase, trypanoso | 95.12 | |
| 2r9z_A | 463 | Glutathione amide reductase; NAD, FAD, substrate s | 95.03 | |
| 4a9w_A | 357 | Monooxygenase; baeyer-villiger, FAD, oxidoreductas | 94.96 | |
| 1ges_A | 450 | Glutathione reductase; oxidoreductase(flavoenzyme) | 94.85 | |
| 3lzw_A | 332 | Ferredoxin--NADP reductase 2; ferredoxin reductase | 94.82 | |
| 1pj5_A | 830 | N,N-dimethylglycine oxidase; channelling, FAD bind | 94.67 | |
| 4dna_A | 463 | Probable glutathione reductase; structural genomic | 94.67 | |
| 1onf_A | 500 | GR, grase, glutathione reductase; oxidoreductase; | 94.65 | |
| 2hqm_A | 479 | GR, grase, glutathione reductase; glutathione redu | 94.62 | |
| 2qa2_A | 499 | CABE, polyketide oxygenase CABE; FAD, angucycline, | 94.41 | |
| 3c4n_A | 405 | Uncharacterized protein DR_0571; alpha-beta protei | 94.4 | |
| 4ap3_A | 549 | Steroid monooxygenase; oxidoreductase, baeyer-vill | 94.39 | |
| 1k0i_A | 394 | P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h | 94.33 | |
| 2gv8_A | 447 | Monooxygenase; FMO, FAD, NADPH, cofactor complex, | 94.33 | |
| 3d1c_A | 369 | Flavin-containing putative monooxygenase; NP_37310 | 94.27 | |
| 1w4x_A | 542 | Phenylacetone monooxygenase; baeyer-villiger, FAD; | 94.27 | |
| 3f8d_A | 323 | Thioredoxin reductase (TRXB-3); redox protein, nuc | 94.21 | |
| 3gwf_A | 540 | Cyclohexanone monooxygenase; flavoprotein biocatal | 94.18 | |
| 1fl2_A | 310 | Alkyl hydroperoxide reductase subunit F; reactive | 94.11 | |
| 2qa1_A | 500 | PGAE, polyketide oxygenase PGAE; FAD, angucycline, | 94.08 | |
| 2qae_A | 468 | Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin | 94.07 | |
| 2cdu_A | 452 | NADPH oxidase; flavoenzyme, oxidoreductase; HET: F | 94.06 | |
| 3lad_A | 476 | Dihydrolipoamide dehydrogenase; oxidoreductase; HE | 94.03 | |
| 1ojt_A | 482 | Surface protein; redox-active center, glycolysis, | 93.9 | |
| 3alj_A | 379 | 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; | 93.86 | |
| 3fbs_A | 297 | Oxidoreductase; structural genomics, PSI2, MCSG, p | 93.83 | |
| 3axb_A | 448 | Putative oxidoreductase; dinucleotide-binding fold | 93.8 | |
| 1trb_A | 320 | Thioredoxin reductase; oxidoreductase(flavoenzyme) | 93.73 | |
| 3vrd_B | 401 | FCCB subunit, flavocytochrome C flavin subunit; su | 93.7 | |
| 2q0l_A | 311 | TRXR, thioredoxin reductase; bacterial thiredoxin | 93.7 | |
| 3cgv_A | 397 | Geranylgeranyl reductase related protein; NP_39399 | 93.7 | |
| 3ntd_A | 565 | FAD-dependent pyridine nucleotide-disulphide oxido | 93.68 | |
| 1y0p_A | 571 | Fumarate reductase flavoprotein subunit; flavocyto | 93.59 | |
| 2weu_A | 511 | Tryptophan 5-halogenase; regioselectivity, antifun | 93.58 | |
| 3ihg_A | 535 | RDME; flavoenzyme, anthracycline, polyketide biosy | 93.55 | |
| 2eq6_A | 464 | Pyruvate dehydrogenase complex, dihydrolipoamide d | 93.53 | |
| 3nix_A | 421 | Flavoprotein/dehydrogenase; structural genomics, P | 93.46 | |
| 1qo8_A | 566 | Flavocytochrome C3 fumarate reductase; oxidoreduct | 93.4 | |
| 3fmw_A | 570 | Oxygenase; mithramycin, baeyer-villiger, flavin bi | 93.24 | |
| 1zmd_A | 474 | Dihydrolipoyl dehydrogenase; lipoamide dehydrogena | 93.22 | |
| 1q1r_A | 431 | Putidaredoxin reductase; glutathione reductase fol | 93.14 | |
| 4b1b_A | 542 | TRXR, thioredoxin reductase; oxidoreductase, FAD, | 93.11 | |
| 2a8x_A | 464 | Dihydrolipoyl dehydrogenase, E3 component of alpha | 92.96 | |
| 1d4d_A | 572 | Flavocytochrome C fumarate reductase; oxidoreducta | 92.95 | |
| 1zk7_A | 467 | HGII, reductase, mercuric reductase; mercuric ION | 92.86 | |
| 3uox_A | 545 | Otemo; baeyer-villiger monooxygenase, oxidoreducta | 92.83 | |
| 3klj_A | 385 | NAD(FAD)-dependent dehydrogenase, NIRB-family (N- | 92.82 | |
| 3atr_A | 453 | Conserved archaeal protein; saturating double bond | 92.8 | |
| 4at0_A | 510 | 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore | 92.68 | |
| 2qcu_A | 501 | Aerobic glycerol-3-phosphate dehydrogenase; glycer | 92.57 | |
| 1vdc_A | 333 | NTR, NADPH dependent thioredoxin reductase; hypoth | 92.53 | |
| 3e1t_A | 512 | Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro | 92.44 | |
| 3dgh_A | 483 | TRXR-1, thioredoxin reductase 1, mitochondrial; ox | 92.43 | |
| 1ebd_A | 455 | E3BD, dihydrolipoamide dehydrogenase; redox-active | 92.43 | |
| 2cul_A | 232 | Glucose-inhibited division protein A-related PROT | 92.4 | |
| 3s5w_A | 463 | L-ornithine 5-monooxygenase; class B flavin depend | 92.27 | |
| 1dxl_A | 470 | Dihydrolipoamide dehydrogenase; oxidoreductase, mu | 92.13 | |
| 3i3l_A | 591 | Alkylhalidase CMLS; flavin-dependent halogenase, c | 92.05 | |
| 2gmh_A | 584 | Electron transfer flavoprotein-ubiquinone oxidored | 92.05 | |
| 3h8l_A | 409 | NADH oxidase; membrane protein, complete form, ros | 91.96 | |
| 2gqw_A | 408 | Ferredoxin reductase; flavoprotein, oxidoreductase | 91.92 | |
| 1hyu_A | 521 | AHPF, alkyl hydroperoxide reductase subunit F; thi | 91.79 | |
| 3ic9_A | 492 | Dihydrolipoamide dehydrogenase; APC62701, colwelli | 91.68 | |
| 3ics_A | 588 | Coenzyme A-disulfide reductase; pyridine nucleotid | 91.65 | |
| 3urh_A | 491 | Dihydrolipoyl dehydrogenase; PSI-biology, structur | 91.63 | |
| 2e4g_A | 550 | Tryptophan halogenase; flavin-binding, rebeccamyci | 91.55 | |
| 3itj_A | 338 | Thioredoxin reductase 1; disulfide B flavoprotein, | 91.53 | |
| 3s5w_A | 463 | L-ornithine 5-monooxygenase; class B flavin depend | 91.49 | |
| 2aqj_A | 538 | Tryptophan halogenase, pRNA; flavin-dependent halo | 91.44 | |
| 3l8k_A | 466 | Dihydrolipoyl dehydrogenase; redox-active center, | 90.92 | |
| 1nhp_A | 447 | NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA | 90.85 | |
| 2bc0_A | 490 | NADH oxidase; flavoprotein, pyridine nucleotide di | 90.8 | |
| 1y56_A | 493 | Hypothetical protein PH1363; dehydrogenase, protei | 90.75 | |
| 3itj_A | 338 | Thioredoxin reductase 1; disulfide B flavoprotein, | 90.57 | |
| 3da1_A | 561 | Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 | 90.46 | |
| 3dk9_A | 478 | Grase, GR, glutathione reductase; flavoenzyme, nic | 90.41 | |
| 4fk1_A | 304 | Putative thioredoxin reductase; structural genomic | 90.32 | |
| 4b63_A | 501 | L-ornithine N5 monooxygenase; oxidoreductase, side | 90.25 | |
| 3d1c_A | 369 | Flavin-containing putative monooxygenase; NP_37310 | 90.25 | |
| 2xve_A | 464 | Flavin-containing monooxygenase; oxidoreductase; H | 90.07 | |
| 1trb_A | 320 | Thioredoxin reductase; oxidoreductase(flavoenzyme) | 90.02 | |
| 3c96_A | 410 | Flavin-containing monooxygenase; FAD, oxidoreducta | 89.87 | |
| 2zbw_A | 335 | Thioredoxin reductase; redox protein, oxidoreducta | 89.73 | |
| 2r0c_A | 549 | REBC; flavin adenine dinucleotide, monooxygenase, | 89.64 | |
| 2zxi_A | 637 | TRNA uridine 5-carboxymethylaminomethyl modificat | 89.54 | |
| 1v59_A | 478 | Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog | 89.53 | |
| 2pyx_A | 526 | Tryptophan halogenase; structural genomics, JOI fo | 89.34 | |
| 3f8d_A | 323 | Thioredoxin reductase (TRXB-3); redox protein, nuc | 89.23 | |
| 2q7v_A | 325 | Thioredoxin reductase; rossman fold, FAD, flavopro | 88.92 | |
| 3cty_A | 319 | Thioredoxin reductase; FAD, oxidoreductase, flavin | 88.78 | |
| 2bry_A | 497 | NEDD9 interacting protein with calponin homology a | 88.7 | |
| 3ces_A | 651 | MNMG, tRNA uridine 5-carboxymethylaminomethyl modi | 88.42 | |
| 3dgz_A | 488 | Thioredoxin reductase 2; oxidoreductase, rossmann, | 88.4 | |
| 2a87_A | 335 | TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL | 88.29 | |
| 3cgb_A | 480 | Pyridine nucleotide-disulfide oxidoreductase, CLA; | 88.05 | |
| 3lzw_A | 332 | Ferredoxin--NADP reductase 2; ferredoxin reductase | 87.66 | |
| 3r9u_A | 315 | Thioredoxin reductase; structural genomics, center | 87.56 | |
| 3ab1_A | 360 | Ferredoxin--NADP reductase; oxidoreductase, electr | 87.54 | |
| 1q1r_A | 431 | Putidaredoxin reductase; glutathione reductase fol | 87.29 | |
| 1rp0_A | 284 | ARA6, thiazole biosynthetic enzyme; protein ligand | 87.19 | |
| 2h88_A | 621 | Succinate dehydrogenase flavoprotein subunit; comp | 86.94 | |
| 2q0l_A | 311 | TRXR, thioredoxin reductase; bacterial thiredoxin | 86.77 | |
| 3h28_A | 430 | Sulfide-quinone reductase; monotopic membrane prot | 86.73 | |
| 2rgh_A | 571 | Alpha-glycerophosphate oxidase; flavoprotein oxida | 86.57 | |
| 3cgb_A | 480 | Pyridine nucleotide-disulfide oxidoreductase, CLA; | 86.48 | |
| 1kf6_A | 602 | Fumarate reductase flavoprotein; respiration, fuma | 86.33 | |
| 2gqw_A | 408 | Ferredoxin reductase; flavoprotein, oxidoreductase | 86.06 | |
| 1lvl_A | 458 | Dihydrolipoamide dehydrogenase; oxidoreductase; HE | 85.94 | |
| 2q7v_A | 325 | Thioredoxin reductase; rossman fold, FAD, flavopro | 84.91 | |
| 3ef6_A | 410 | Toluene 1,2-dioxygenase system ferredoxin--NAD(+) | 84.86 | |
| 2bc0_A | 490 | NADH oxidase; flavoprotein, pyridine nucleotide di | 84.81 | |
| 3cp8_A | 641 | TRNA uridine 5-carboxymethylaminomethyl modificati | 84.81 | |
| 2wdq_A | 588 | Succinate dehydrogenase flavoprotein subunit; succ | 84.74 | |
| 4g6h_A | 502 | Rotenone-insensitive NADH-ubiquinone oxidoreducta | 84.65 | |
| 1xhc_A | 367 | NADH oxidase /nitrite reductase; southe collaborat | 84.59 | |
| 1fl2_A | 310 | Alkyl hydroperoxide reductase subunit F; reactive | 83.82 | |
| 1m6i_A | 493 | Programmed cell death protein 8; apoptosis, AIF, o | 83.8 | |
| 3fbs_A | 297 | Oxidoreductase; structural genomics, PSI2, MCSG, p | 83.67 | |
| 3kd9_A | 449 | Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o | 83.49 | |
| 2dkh_A | 639 | 3-hydroxybenzoate hydroxylase; flavoprotein, monoo | 83.01 | |
| 3cty_A | 319 | Thioredoxin reductase; FAD, oxidoreductase, flavin | 82.92 | |
| 2bs2_A | 660 | Quinol-fumarate reductase flavoprotein subunit A; | 82.55 | |
| 3oc4_A | 452 | Oxidoreductase, pyridine nucleotide-disulfide FAM; | 82.24 | |
| 3ntd_A | 565 | FAD-dependent pyridine nucleotide-disulphide oxido | 82.11 | |
| 1nhp_A | 447 | NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA | 81.86 | |
| 1vdc_A | 333 | NTR, NADPH dependent thioredoxin reductase; hypoth | 81.81 | |
| 3hyw_A | 430 | Sulfide-quinone reductase; monotopic membrane prot | 81.78 | |
| 3ics_A | 588 | Coenzyme A-disulfide reductase; pyridine nucleotid | 81.74 | |
| 3hyw_A | 430 | Sulfide-quinone reductase; monotopic membrane prot | 80.86 | |
| 3iwa_A | 472 | FAD-dependent pyridine nucleotide-disulphide oxido | 80.4 | |
| 1xhc_A | 367 | NADH oxidase /nitrite reductase; southe collaborat | 80.38 | |
| 3lxd_A | 415 | FAD-dependent pyridine nucleotide-disulphide oxido | 80.33 |
| >2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A | Back alignment and structure |
|---|
Probab=99.77 E-value=5.9e-19 Score=150.61 Aligned_cols=121 Identities=24% Similarity=0.377 Sum_probs=101.7
Q ss_pred cCCCChhccccccccccc--cCCCCceeeecCCcHHHHHHHHHhhCCCCCCCCCcceEEcCCceEEEEecCCCcEEEEeC
Q psy13542 12 DGSENWFETSARGLDSFT--DLEGCFGVVWKKGGYGNVFKLLMKQMPGQTPIDLSKKLLLKKEVTKINWEDPKGVVVTCA 89 (147)
Q Consensus 12 ~~g~~~~~~S~~~~~~~~--~~~g~~~~~~~~gG~~~l~~~l~~~l~~~~~~~~g~~i~l~~~V~~I~~~~~~~v~v~~~ 89 (147)
.++.+++.+|+..+.... ...|.+.. ++||+++|+++|++.+ +|++|++|++|.+ ++++|+|++.
T Consensus 368 ~~~~~l~~ls~~~~~~~~~~~~~g~~~~--~~gG~~~l~~~La~~l----------~I~l~~~V~~I~~-~~~~v~V~~~ 434 (662)
T 2z3y_A 368 ANATPLSTLSLKHWDQDDDFEFTGSHLT--VRNGYSCVPVALAEGL----------DIKLNTAVRQVRY-TASGCEVIAV 434 (662)
T ss_dssp HTTSCGGGBBTTTTTTTGGGCCBSCCEE--ETTCTTHHHHHHTTTC----------EEETTEEEEEEEE-ETTEEEEEEE
T ss_pred hcCCChhhcCHhhcCCCcccccCCceee--ecCcHHHHHHHHHhcC----------ceecCCeEEEEEE-CCCcEEEEEe
Confidence 447788899988765432 23344443 7999999999998755 6999999999999 7788999876
Q ss_pred C------CcEEEcCEEEEecChhHHhhCC--cccCCCCCHHHHHHHhcCCCcceeEEEEEeCCCC
Q psy13542 90 D------GTQYSADRILITVSLGVLKSNL--ITFVPPLPPKKLTAIELTNLTSIQQDTLFQIPTE 146 (147)
Q Consensus 90 ~------g~~~~ad~VI~t~P~~~l~~~~--~~f~p~Lp~~~~~ai~~~~~g~~~Kv~l~~~~~~ 146 (147)
+ |++++||+||+|+|+++|+++. +.|.|+||+.+.++|++++||.+.||++ .|+++
T Consensus 435 ~~~~~~~~~~~~Ad~VI~tvP~~vL~~l~~~i~f~P~LP~~k~~Ai~~l~~g~~~KV~l-~f~~~ 498 (662)
T 2z3y_A 435 NTRSTSQTFIYKCDAVLCTLPLGVLKQQPPAVQFVPPLPEWKTSAVQRMGFGNLNKVVL-CFDRV 498 (662)
T ss_dssp ESSCTTCEEEEEESEEEECCCHHHHHCSSCSSEEESCCCHHHHHHHHHSEECCCEEEEE-ECSSC
T ss_pred ecccCCCCeEEEeCEEEECCCHHHHhcccCceEEcCCCCHHHHHHHHhCCccceeEEEE-EcCcc
Confidence 5 5689999999999999999842 4799999999999999999999999999 99876
|
| >2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A | Back alignment and structure |
|---|
| >1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* | Back alignment and structure |
|---|
| >1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... | Back alignment and structure |
|---|
| >2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* | Back alignment and structure |
|---|
| >4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* | Back alignment and structure |
|---|
| >1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* | Back alignment and structure |
|---|
| >2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* | Back alignment and structure |
|---|
| >2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* | Back alignment and structure |
|---|
| >3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* | Back alignment and structure |
|---|
| >2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* | Back alignment and structure |
|---|
| >3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* | Back alignment and structure |
|---|
| >3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* | Back alignment and structure |
|---|
| >3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} | Back alignment and structure |
|---|
| >2e1m_B L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} | Back alignment and structure |
|---|
| >4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* | Back alignment and structure |
|---|
| >3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 | Back alignment and structure |
|---|
| >3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} | Back alignment and structure |
|---|
| >3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* | Back alignment and structure |
|---|
| >2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* | Back alignment and structure |
|---|
| >1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A | Back alignment and structure |
|---|
| >3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} | Back alignment and structure |
|---|
| >1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* | Back alignment and structure |
|---|
| >2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* | Back alignment and structure |
|---|
| >2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* | Back alignment and structure |
|---|
| >1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 | Back alignment and structure |
|---|
| >3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* | Back alignment and structure |
|---|
| >2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} | Back alignment and structure |
|---|
| >3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* | Back alignment and structure |
|---|
| >3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* | Back alignment and structure |
|---|
| >3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} | Back alignment and structure |
|---|
| >3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* | Back alignment and structure |
|---|
| >3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* | Back alignment and structure |
|---|
| >2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} | Back alignment and structure |
|---|
| >1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} | Back alignment and structure |
|---|
| >2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* | Back alignment and structure |
|---|
| >3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* | Back alignment and structure |
|---|
| >2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 | Back alignment and structure |
|---|
| >2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* | Back alignment and structure |
|---|
| >2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 | Back alignment and structure |
|---|
| >2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* | Back alignment and structure |
|---|
| >2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* | Back alignment and structure |
|---|
| >3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* | Back alignment and structure |
|---|
| >2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* | Back alignment and structure |
|---|
| >3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} | Back alignment and structure |
|---|
| >3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} | Back alignment and structure |
|---|
| >3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 | Back alignment and structure |
|---|
| >3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* | Back alignment and structure |
|---|
| >2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* | Back alignment and structure |
|---|
| >2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* | Back alignment and structure |
|---|
| >1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* | Back alignment and structure |
|---|
| >1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* | Back alignment and structure |
|---|
| >2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} | Back alignment and structure |
|---|
| >3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* | Back alignment and structure |
|---|
| >2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* | Back alignment and structure |
|---|
| >2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* | Back alignment and structure |
|---|
| >4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} | Back alignment and structure |
|---|
| >1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* | Back alignment and structure |
|---|
| >3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* | Back alignment and structure |
|---|
| >1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* | Back alignment and structure |
|---|
| >4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} | Back alignment and structure |
|---|
| >3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* | Back alignment and structure |
|---|
| >1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... | Back alignment and structure |
|---|
| >2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* | Back alignment and structure |
|---|
| >3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* | Back alignment and structure |
|---|
| >3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* | Back alignment and structure |
|---|
| >3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* | Back alignment and structure |
|---|
| >1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 | Back alignment and structure |
|---|
| >2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} | Back alignment and structure |
|---|
| >2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} | Back alignment and structure |
|---|
| >3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* | Back alignment and structure |
|---|
| >1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* | Back alignment and structure |
|---|
| >3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* | Back alignment and structure |
|---|
| >3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* | Back alignment and structure |
|---|
| >1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* | Back alignment and structure |
|---|
| >3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* | Back alignment and structure |
|---|
| >2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* | Back alignment and structure |
|---|
| >3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* | Back alignment and structure |
|---|
| >1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* | Back alignment and structure |
|---|
| >2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* | Back alignment and structure |
|---|
| >3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} | Back alignment and structure |
|---|
| >2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* | Back alignment and structure |
|---|
| >3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 | Back alignment and structure |
|---|
| >3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} | Back alignment and structure |
|---|
| >1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* | Back alignment and structure |
|---|
| >1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* | Back alignment and structure |
|---|
| >4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* | Back alignment and structure |
|---|
| >1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* | Back alignment and structure |
|---|
| >1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* | Back alignment and structure |
|---|
| >3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* | Back alignment and structure |
|---|
| >3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* | Back alignment and structure |
|---|
| >4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* | Back alignment and structure |
|---|
| >2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* | Back alignment and structure |
|---|
| >1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* | Back alignment and structure |
|---|
| >3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} | Back alignment and structure |
|---|
| >3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* | Back alignment and structure |
|---|
| >1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 | Back alignment and structure |
|---|
| >3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* | Back alignment and structure |
|---|
| >1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} | Back alignment and structure |
|---|
| >2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* | Back alignment and structure |
|---|
| >3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* | Back alignment and structure |
|---|
| >2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* | Back alignment and structure |
|---|
| >1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A | Back alignment and structure |
|---|
| >3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} | Back alignment and structure |
|---|
| >3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* | Back alignment and structure |
|---|
| >3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A | Back alignment and structure |
|---|
| >3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* | Back alignment and structure |
|---|
| >3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* | Back alignment and structure |
|---|
| >2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* | Back alignment and structure |
|---|
| >3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* | Back alignment and structure |
|---|
| >2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* | Back alignment and structure |
|---|
| >1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* | Back alignment and structure |
|---|
| >3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... | Back alignment and structure |
|---|
| >4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* | Back alignment and structure |
|---|
| >4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* | Back alignment and structure |
|---|
| >3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* | Back alignment and structure |
|---|
| >1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* | Back alignment and structure |
|---|
| >3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* | Back alignment and structure |
|---|
| >2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* | Back alignment and structure |
|---|
| >2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* | Back alignment and structure |
|---|
| >1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* | Back alignment and structure |
|---|
| >2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} | Back alignment and structure |
|---|
| >3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* | Back alignment and structure |
|---|
| >2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* | Back alignment and structure |
|---|
| >3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A | Back alignment and structure |
|---|
| >3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* | Back alignment and structure |
|---|
| >2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* | Back alignment and structure |
|---|
| >3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* | Back alignment and structure |
|---|
| >3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} | Back alignment and structure |
|---|
| >3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} | Back alignment and structure |
|---|
| >1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* | Back alignment and structure |
|---|
| >1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 | Back alignment and structure |
|---|
| >2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... | Back alignment and structure |
|---|
| >2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* | Back alignment and structure |
|---|
| >2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* | Back alignment and structure |
|---|
| >3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* | Back alignment and structure |
|---|
| >1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* | Back alignment and structure |
|---|
| >2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* | Back alignment and structure |
|---|
| >1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* | Back alignment and structure |
|---|
| >2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* | Back alignment and structure |
|---|
| >3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} | Back alignment and structure |
|---|
| >2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* | Back alignment and structure |
|---|
| >4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* | Back alignment and structure |
|---|
| >1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 | Back alignment and structure |
|---|
| >1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* | Back alignment and structure |
|---|
| >3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* | Back alignment and structure |
|---|
| >3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* | Back alignment and structure |
|---|
| >3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* | Back alignment and structure |
|---|
| >1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* | Back alignment and structure |
|---|
| >1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* | Back alignment and structure |
|---|
| >3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* | Back alignment and structure |
|---|
| >3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* | Back alignment and structure |
|---|
| >3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* | Back alignment and structure |
|---|
| >3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} | Back alignment and structure |
|---|
| >1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 147 | ||||
| d2v5za1 | 383 | c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {H | 7e-11 | |
| d1b5qa1 | 347 | c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Mai | 2e-10 | |
| d2iida1 | 370 | c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {M | 2e-09 | |
| d2ivda1 | 347 | c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen ox | 2e-04 | |
| d1aoga2 | 117 | c.3.1.5 (A:170-286) Trypanothione reductase {Trypa | 0.004 |
| >d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Length = 383 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: FAD/NAD(P)-binding domain superfamily: FAD/NAD(P)-binding domain family: FAD-linked reductases, N-terminal domain domain: Monoamine oxidase B species: Human (Homo sapiens) [TaxId: 9606]
Score = 56.7 bits (135), Expect = 7e-11
Identities = 19/90 (21%), Positives = 34/90 (37%), Gaps = 3/90 (3%)
Query: 39 WKKGGYGNVFKLLMKQMPGQTPIDLSKKLLLKKEVTKINWEDPKGVVVTCADGTQYSADR 98
GG F Q+ + L ++ L++ V I+ + V+V + Y A
Sbjct: 196 TTNGGQERKFVGGSGQVSERIMDLLGDRVKLERPVIYIDQTR-ENVLVETLNHEMYEAKY 254
Query: 99 ILITVSLGVLKSNLITFVPPLPPKKLTAIE 128
++ + + I F PPLP + I
Sbjct: 255 VISAIPPTLGMK--IHFNPPLPMMRNQMIT 282
|
| >d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Length = 347 | Back information, alignment and structure |
|---|
| >d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Length = 370 | Back information, alignment and structure |
|---|
| >d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Length = 347 | Back information, alignment and structure |
|---|
| >d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Length = 117 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 147 | |||
| d2iida1 | 370 | L-aminoacid oxidase {Malayan pit viper (Calloselas | 99.33 | |
| d2v5za1 | 383 | Monoamine oxidase B {Human (Homo sapiens) [TaxId: | 99.31 | |
| d2ivda1 | 347 | Protoporphyrinogen oxidase {Myxococcus xanthus [Ta | 98.94 | |
| d1b5qa1 | 347 | Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | 98.85 | |
| d2bcgg1 | 297 | Guanine nucleotide dissociation inhibitor, GDI {Ba | 98.67 | |
| d1d5ta1 | 336 | Guanine nucleotide dissociation inhibitor, GDI {Co | 98.32 | |
| d1seza1 | 373 | Protoporphyrinogen oxidase {Tobacco (Nicotiana tab | 98.06 | |
| d1aoga2 | 117 | Trypanothione reductase {Trypanosoma cruzi [TaxId: | 97.91 | |
| d1m6ia2 | 137 | Apoptosis-inducing factor (AIF) {Human (Homo sapie | 97.79 | |
| d1gesa2 | 116 | Glutathione reductase {Escherichia coli [TaxId: 56 | 97.62 | |
| d1feca2 | 117 | Trypanothione reductase {Crithidia fasciculata [Ta | 97.58 | |
| d2gf3a1 | 281 | Sarcosine oxidase {Bacillus sp., strain b0618 [Tax | 97.55 | |
| d1onfa2 | 117 | Glutathione reductase {Plasmodium falciparum [TaxI | 97.47 | |
| d1ryia1 | 276 | Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} | 97.34 | |
| d3lada2 | 119 | Dihydrolipoamide dehydrogenase {Azotobacter vinela | 97.31 | |
| d2i0za1 | 251 | Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] | 97.31 | |
| d1pj5a2 | 305 | N,N-dimethylglycine oxidase {Arthrobacter globifor | 97.09 | |
| d1ebda2 | 117 | Dihydrolipoamide dehydrogenase {Bacillus stearothe | 96.66 | |
| d1q1ra2 | 133 | Putidaredoxin reductase {Pseudomonas putida [TaxId | 96.63 | |
| d1nhpa2 | 123 | NADH peroxidase {Enterococcus faecalis [TaxId: 135 | 96.57 | |
| d1ojta2 | 125 | Dihydrolipoamide dehydrogenase {Neisseria meningit | 96.43 | |
| d2gv8a1 | 335 | Flavin-dependent monoxygenase SPBP16F5.08c {Schizo | 96.37 | |
| d1d7ya2 | 121 | NADH-dependent ferredoxin reductase, BphA4 {Pseudo | 96.23 | |
| d1dxla2 | 123 | Dihydrolipoamide dehydrogenase {Garden pea (Pisum | 96.2 | |
| d1v59a2 | 122 | Dihydrolipoamide dehydrogenase {Baker's yeast (Sac | 96.15 | |
| d1w4xa1 | 298 | Phenylacetone monooxygenase {Thermobifida fusca [T | 96.09 | |
| d2gqfa1 | 253 | Hypothetical protein HI0933 {Haemophilus influenza | 95.89 | |
| d1mo9a2 | 121 | NADH-dependent 2-ketopropyl coenzyme M oxidoreduct | 95.62 | |
| d1m6ia1 | 213 | Apoptosis-inducing factor (AIF) {Human (Homo sapie | 95.42 | |
| d1lvla2 | 115 | Dihydrolipoamide dehydrogenase {Pseudomonas putida | 95.32 | |
| d2voua1 | 265 | Dihydroxypyridine hydroxylase DhpH {Arthrobacter n | 95.3 | |
| d3grsa2 | 125 | Glutathione reductase {Human (Homo sapiens) [TaxId | 94.72 | |
| d1vg0a1 | 491 | Rab escort protein 1 {Rat (Rattus norvegicus) [Tax | 94.45 | |
| d1d7ya1 | 183 | NADH-dependent ferredoxin reductase, BphA4 {Pseudo | 92.27 | |
| d1xhca2 | 122 | NADH oxidase /nitrite reductase {Pyrococcus furios | 92.22 | |
| d1h6va2 | 122 | Mammalian thioredoxin reductase {Rat (Rattus norve | 91.8 | |
| d1d4ca2 | 322 | Flavocytochrome c3 (respiratory fumarate reductase | 91.71 | |
| d1y0pa2 | 308 | Flavocytochrome c3 (respiratory fumarate reductase | 91.16 | |
| d1qo8a2 | 317 | Flavocytochrome c3 (respiratory fumarate reductase | 88.78 | |
| d1nhpa1 | 198 | NADH peroxidase {Enterococcus faecalis [TaxId: 135 | 87.85 | |
| d2bi7a1 | 314 | UDP-galactopyranose mutase, N-terminal domain {Kle | 87.24 | |
| d1xhca1 | 167 | NADH oxidase /nitrite reductase {Pyrococcus furios | 86.68 | |
| d2cula1 | 230 | GidA-related protein TTHA1897 {Thermus thermophilu | 84.35 | |
| d1ps9a2 | 162 | 2,4-dienoyl-CoA reductase, C-terminal domain {Esch | 83.68 | |
| d3coxa1 | 370 | Cholesterol oxidase of GMC family {Brevibacterium | 83.58 | |
| d1n4wa1 | 367 | Cholesterol oxidase of GMC family {Streptomyces sp | 81.7 | |
| d3c96a1 | 288 | Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: | 80.78 |
| >d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: FAD/NAD(P)-binding domain superfamily: FAD/NAD(P)-binding domain family: FAD-linked reductases, N-terminal domain domain: L-aminoacid oxidase species: Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]
Probab=99.33 E-value=2.9e-12 Score=95.63 Aligned_cols=83 Identities=20% Similarity=0.323 Sum_probs=72.9
Q ss_pred cCCcHHHHHHHHHhhCCCCCCCCCcceEEcCCceEEEEecCCCcEEEEe----CCCcEEEcCEEEEecChhHHhhCCccc
Q psy13542 40 KKGGYGNVFKLLMKQMPGQTPIDLSKKLLLKKEVTKINWEDPKGVVVTC----ADGTQYSADRILITVSLGVLKSNLITF 115 (147)
Q Consensus 40 ~~gG~~~l~~~l~~~l~~~~~~~~g~~i~l~~~V~~I~~~~~~~v~v~~----~~g~~~~ad~VI~t~P~~~l~~~~~~f 115 (147)
+.+|+..++++|++..+ ..|++|++|++|.. ++++++|+. .++++++||+||+|+|+.+|+.+ .|
T Consensus 233 ~~~~~~~l~~~l~~~~g--------~~i~~~~~V~~I~~-~~~~v~v~~~~~~~~~~~~~aD~VI~A~p~~~l~~i--~~ 301 (370)
T d2iida1 233 IVDGMDKLPTAMYRDIQ--------DKVHFNAQVIKIQQ-NDQKVTVVYETLSKETPSVTADYVIVCTTSRAVRLI--KF 301 (370)
T ss_dssp ETTCTTHHHHHHHHHTG--------GGEESSCEEEEEEE-CSSCEEEEEECSSSCCCEEEESEEEECSCHHHHTTS--EE
T ss_pred chhhHHHHHHHHHHhcC--------CccccCceEEEEEE-eCCeEEEEEEecCCCeEEEEeeEEEecCCHHHHhhC--cc
Confidence 79999999999998875 38999999999999 888887764 34578999999999999999998 89
Q ss_pred CCCCCHHHHHHHhcCCCc
Q psy13542 116 VPPLPPKKLTAIELTNLT 133 (147)
Q Consensus 116 ~p~Lp~~~~~ai~~~~~g 133 (147)
.|+||+++.++++.+...
T Consensus 302 ~p~l~~~~~~ai~~~~~~ 319 (370)
T d2iida1 302 NPPLLPKKAHALRSVFTP 319 (370)
T ss_dssp ESCCCHHHHHHHHHCCCT
T ss_pred CCCCCHHHHHHHHhcCCc
Confidence 999999999999887653
|
| >d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} | Back information, alignment and structure |
|---|
| >d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} | Back information, alignment and structure |
|---|
| >d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} | Back information, alignment and structure |
|---|
| >d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} | Back information, alignment and structure |
|---|
| >d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} | Back information, alignment and structure |
|---|
| >d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} | Back information, alignment and structure |
|---|
| >d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vg0a1 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} | Back information, alignment and structure |
|---|
| >d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} | Back information, alignment and structure |
|---|
| >d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} | Back information, alignment and structure |
|---|
| >d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} | Back information, alignment and structure |
|---|
| >d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} | Back information, alignment and structure |
|---|
| >d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|