Psyllid ID: psy13604

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------
MFSFSGTAVLVRRIDRDDITIAVDGSLYKYHPRLKHWLQKYIQLLVPNKTFRLLLAEDGSGKGAGLASAIALKLGAFHNFIMSHNFIMFSISGTAVLVRRIDRDDITIAVDGSLYKYHPRLKHWLQKYIQLLVPNKTFRLLLAEDGSGKGAGLASAIALKLGAFQSK
ccHHHHHHHHHHHHccccEEEEEccccccccccHHHHHHHHHHHHccccEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEccccccccccHHHHHHHHHHHHcccccEEEEEccccccHHHHHHHHHHHHHHHHHcc
cHHHHHHHHHHcccccEEEEEEEEcHHHHHcccHHHHHHHHHHHHcccEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEcHHHHHcccHHHHHHHHHHHHcccEEEEEEEccccHHHHHHHHHHHHHHHHHHccc
MFSFSGTAVLVRridrdditiavdgslykyhpRLKHWLQKYIQLLVPNKTFRLLLaedgsgkgAGLASAIALKLGAFHNFIMSHNFIMFSISGTAVLVRridrdditiavdgslykyhpRLKHWLQKYIQLLVPNKTFRLLLaedgsgkgAGLASAIALKLGAFQSK
MFSFSGTAVlvrridrdditiavdgslykyHPRLKHWLQKYIQLLVPNKTFRLLLAEDGSGKGAGLASAIALKLGAFHNFIMSHNFIMFSISGTAVLVRRIDRDDItiavdgslykyHPRLKHWLQKYIQLLVPNKTFRLLLAEDGSGKGAGLASAIALKLGAFQSK
MFSFSGTAVLVRRIDRDDITIAVDGSLYKYHPRLKHWLQKYIQLLVPNKTFRLLLAEDGSGKGAGLASAIALKLGAFHNFIMSHNFIMFSISGTAVLVRRIDRDDITIAVDGSLYKYHPRLKHWLQKYIQLLVPNKTFRLLLAEDGSGKGAGLASAIALKLGAFQSK
*****GTAVLVRRIDRDDITIAVDGSLYKYHPRLKHWLQKYIQLLVPNKTFRLLLAEDGSGKGAGLASAIALKLGAFHNFIMSHNFIMFSISGTAVLVRRIDRDDITIAVDGSLYKYHPRLKHWLQKYIQLLVPNKTFRLLLAEDGSGKGAGLASAIALKL******
MFSFSGTAVLVRRIDRDDITIAVDGSLYKYHPRLKHWLQKYIQLLVPNKTFRLLLAEDGSGKGAGLASAIALKLGAFHNFIMSHNFIMFSISGTAVLVRRIDRDDITIAVDGSLYKYHPRLKHWLQKYIQLLVPNKTFRLLLAEDGSGKGAGLASAIA**L******
MFSFSGTAVLVRRIDRDDITIAVDGSLYKYHPRLKHWLQKYIQLLVPNKTFRLLLAEDGSGKGAGLASAIALKLGAFHNFIMSHNFIMFSISGTAVLVRRIDRDDITIAVDGSLYKYHPRLKHWLQKYIQLLVPNKTFRLLLAEDGSGKGAGLASAIALKLGAFQSK
MFSFSGTAVLVRRIDRDDITIAVDGSLYKYHPRLKHWLQKYIQLLVPNKTFRLLLAEDGSGKGAGLASAIALKLGAFHNFIMSHNFIMFSISGTAVLVRRIDRDDITIAVDGSLYKYHPRLKHWLQKYIQLLVPNKTFRLLLAEDGSGKGAGLASAIALKLG*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFSFSGTAVLVRRIDRDDITIAVDGSLYKYHPRLKHWLQKYIQLLVPNKTFRLLLAEDGSGKGAGLASAIALKLGAFHNFIMSHNFIMFSISGTAVLVRRIDRDDITIAVDGSLYKYHPRLKHWLQKYIQLLVPNKTFRLLLAEDGSGKGAGLASAIALKLGAFQSK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query167 2.2.26 [Sep-21-2011]
A2PYL6 917 Hexokinase-2 OS=Equus cab yes N/A 0.347 0.063 0.525 4e-11
A2PYL7 917 Hexokinase-2 OS=Equus zeb N/A N/A 0.347 0.063 0.525 4e-11
A2PYL8 917 Hexokinase-2 OS=Equus gre N/A N/A 0.347 0.063 0.525 4e-11
Q26609451 Hexokinase OS=Schistosoma N/A N/A 0.413 0.152 0.442 7e-11
P17710 974 Hexokinase-1 OS=Mus muscu yes N/A 0.443 0.075 0.419 2e-10
Q1W674 917 Hexokinase-2 OS=Sus scrof no N/A 0.425 0.077 0.441 3e-10
P27595918 Hexokinase-1 OS=Bos tauru no N/A 0.419 0.076 0.394 4e-10
Q5RC71 917 Hexokinase-1 OS=Pongo abe yes N/A 0.371 0.067 0.467 5e-10
P19367 917 Hexokinase-1 OS=Homo sapi yes N/A 0.371 0.067 0.467 6e-10
P05708918 Hexokinase-1 OS=Rattus no yes N/A 0.419 0.076 0.394 9e-10
>sp|A2PYL6|HXK2_HORSE Hexokinase-2 OS=Equus caballus GN=HK2 PE=2 SV=1 Back     alignment and function desciption
 Score = 67.4 bits (163), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 31/59 (52%), Positives = 39/59 (66%)

Query: 20  TIAVDGSLYKYHPRLKHWLQKYIQLLVPNKTFRLLLAEDGSGKGAGLASAIALKLGAFH 78
           TI VDGS+YK HP     LQK ++ LVPN   R L +EDGSGKGA + +A+A +L   H
Sbjct: 409 TIGVDGSVYKKHPHFAKRLQKTVRRLVPNCDIRFLCSEDGSGKGAAMVTAVAYRLAYQH 467

Equus caballus (taxid: 9796)
EC: 2EC: .EC: 7EC: .EC: 1EC: .EC: 1
>sp|A2PYL7|HXK2_EQUZE Hexokinase-2 OS=Equus zebra GN=HK2 PE=2 SV=1 Back     alignment and function description
>sp|A2PYL8|HXK2_EQUGR Hexokinase-2 OS=Equus grevyi GN=HK2 PE=2 SV=1 Back     alignment and function description
>sp|Q26609|HXK_SCHMA Hexokinase OS=Schistosoma mansoni PE=1 SV=2 Back     alignment and function description
>sp|P17710|HXK1_MOUSE Hexokinase-1 OS=Mus musculus GN=Hk1 PE=1 SV=3 Back     alignment and function description
>sp|Q1W674|HXK2_PIG Hexokinase-2 OS=Sus scrofa GN=HK2 PE=2 SV=1 Back     alignment and function description
>sp|P27595|HXK1_BOVIN Hexokinase-1 OS=Bos taurus GN=HK1 PE=2 SV=1 Back     alignment and function description
>sp|Q5RC71|HXK1_PONAB Hexokinase-1 OS=Pongo abelii GN=HK1 PE=2 SV=1 Back     alignment and function description
>sp|P19367|HXK1_HUMAN Hexokinase-1 OS=Homo sapiens GN=HK1 PE=1 SV=3 Back     alignment and function description
>sp|P05708|HXK1_RAT Hexokinase-1 OS=Rattus norvegicus GN=Hk1 PE=1 SV=4 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query167
383865855 470 PREDICTED: hexokinase-1-like [Megachile 0.485 0.172 0.530 6e-18
328779857 447 PREDICTED: hexokinase-2-like [Apis melli 0.401 0.149 0.626 3e-17
380011126 452 PREDICTED: hexokinase-2-like [Apis flore 0.401 0.148 0.626 3e-17
322785508 391 hypothetical protein SINV_14712 [Solenop 0.401 0.171 0.626 5e-17
307174516 443 Hexokinase-2 [Camponotus floridanus] 0.401 0.151 0.611 5e-17
340712831 470 PREDICTED: hexokinase-1-like isoform 1 [ 0.401 0.142 0.611 5e-17
321462303 461 hypothetical protein DAPPUDRAFT_307951 [ 0.473 0.171 0.55 1e-16
350422744 470 PREDICTED: hexokinase-1-like [Bombus imp 0.401 0.142 0.611 1e-16
332020496 418 Hexokinase-2 [Acromyrmex echinatior] 0.401 0.160 0.617 6e-16
307195602 563 Hexokinase-2 [Harpegnathos saltator] 0.401 0.119 0.588 3e-15
>gi|383865855|ref|XP_003708388.1| PREDICTED: hexokinase-1-like [Megachile rotundata] Back     alignment and taxonomy information
 Score = 95.5 bits (236), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 63/81 (77%)

Query: 81  IMSHNFIMFSISGTAVLVRRIDRDDITIAVDGSLYKYHPRLKHWLQKYIQLLVPNKTFRL 140
           ++S+   +   +  AVL++RIDR+ +TIAVDGSLYK+HPRL+ W+++YI LL P+  F++
Sbjct: 385 VISNRAALLVSTCLAVLLKRIDRERVTIAVDGSLYKHHPRLESWIKQYIPLLAPDHKFKI 444

Query: 141 LLAEDGSGKGAGLASAIALKL 161
           + AEDGSGKGA L +AIA +L
Sbjct: 445 IHAEDGSGKGAALVAAIAQRL 465

Source: Megachile rotundata

Species: Megachile rotundata

Genus: Megachile

Family: Megachilidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|328779857|ref|XP_392350.3| PREDICTED: hexokinase-2-like [Apis mellifera] Back     alignment and taxonomy information
>gi|380011126|ref|XP_003689663.1| PREDICTED: hexokinase-2-like [Apis florea] Back     alignment and taxonomy information
>gi|322785508|gb|EFZ12177.1| hypothetical protein SINV_14712 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|307174516|gb|EFN64975.1| Hexokinase-2 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|340712831|ref|XP_003394957.1| PREDICTED: hexokinase-1-like isoform 1 [Bombus terrestris] gi|340712833|ref|XP_003394958.1| PREDICTED: hexokinase-1-like isoform 2 [Bombus terrestris] Back     alignment and taxonomy information
>gi|321462303|gb|EFX73328.1| hypothetical protein DAPPUDRAFT_307951 [Daphnia pulex] Back     alignment and taxonomy information
>gi|350422744|ref|XP_003493269.1| PREDICTED: hexokinase-1-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|332020496|gb|EGI60911.1| Hexokinase-2 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307195602|gb|EFN77452.1| Hexokinase-2 [Harpegnathos saltator] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query167
MGI|MGI:96103 974 Hk1 "hexokinase 1" [Mus muscul 0.538 0.092 0.369 1.2e-21
UNIPROTKB|P19367 917 HK1 "Hexokinase-1" [Homo sapie 0.371 0.067 0.467 2.6e-21
UNIPROTKB|E7ENR4 952 HK1 "Hexokinase-1" [Homo sapie 0.371 0.065 0.467 2.9e-21
RGD|2796 918 Hk1 "hexokinase 1" [Rattus nor 0.371 0.067 0.451 4.3e-21
UNIPROTKB|P27595918 HK1 "Hexokinase-1" [Bos taurus 0.377 0.068 0.428 5.5e-21
UNIPROTKB|F1NEI1 781 HK1 "Uncharacterized protein" 0.371 0.079 0.483 5.7e-21
ZFIN|ZDB-GENE-040426-2848918 hk1 "hexokinase 1" [Danio reri 0.413 0.075 0.420 7e-21
UNIPROTKB|F1NEF0 918 HK1 "Uncharacterized protein" 0.371 0.067 0.483 8.7e-21
UNIPROTKB|F1NZJ2 923 HK1 "Uncharacterized protein" 0.371 0.067 0.483 8.8e-21
UNIPROTKB|J9PBL1 917 HK1 "Uncharacterized protein" 0.371 0.067 0.467 1.4e-20
MGI|MGI:96103 Hk1 "hexokinase 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
 Score = 150 (57.9 bits), Expect = 1.2e-21, Sum P(2) = 1.2e-21
 Identities = 34/92 (36%), Positives = 53/92 (57%)

Query:    20 TIAVDGSLYKYHPRLKHWLQKYIQLLVPNKTFRLLLAEDGSGKGAGLASAIALKLGAFHN 79
             T+ VDGSLYK HP+      K ++ LVP+   R LL+E GSGKGA + +A+A +L   H 
Sbjct:   465 TVGVDGSLYKMHPQYSRRFHKTLRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLAEQHR 524

Query:    80 FIMSHNFIMFSISGTAVL-VRRIDRDDITIAV 110
              I       F +S  A++ V++  R ++ + +
Sbjct:   525 QI-EETLSHFRLSKQALMEVKKKLRSEMEMGL 555
GO:0000166 "nucleotide binding" evidence=IEA
GO:0001678 "cellular glucose homeostasis" evidence=IBA
GO:0003824 "catalytic activity" evidence=IEA
GO:0004340 "glucokinase activity" evidence=ISO;IBA
GO:0004396 "hexokinase activity" evidence=ISO;IDA;TAS
GO:0004672 "protein kinase activity" evidence=ISO
GO:0005515 "protein binding" evidence=IPI
GO:0005524 "ATP binding" evidence=ISO
GO:0005536 "glucose binding" evidence=ISO
GO:0005739 "mitochondrion" evidence=ISO;IDA
GO:0005741 "mitochondrial outer membrane" evidence=IEA
GO:0005829 "cytosol" evidence=ISO;IDA
GO:0005901 "caveola" evidence=ISO
GO:0005975 "carbohydrate metabolic process" evidence=IEA
GO:0006096 "glycolysis" evidence=ISO;TAS
GO:0006468 "protein phosphorylation" evidence=ISO
GO:0008152 "metabolic process" evidence=IEA
GO:0008865 "fructokinase activity" evidence=IBA
GO:0010359 "regulation of anion channel activity" evidence=ISO
GO:0016020 "membrane" evidence=IEA
GO:0016301 "kinase activity" evidence=IEA
GO:0016310 "phosphorylation" evidence=IEA
GO:0016740 "transferase activity" evidence=IEA
GO:0016773 "phosphotransferase activity, alcohol group as acceptor" evidence=IEA
GO:0018105 "peptidyl-serine phosphorylation" evidence=ISO
GO:0018107 "peptidyl-threonine phosphorylation" evidence=ISO
GO:0018108 "peptidyl-tyrosine phosphorylation" evidence=ISO
GO:0019158 "mannokinase activity" evidence=IBA
GO:0032403 "protein complex binding" evidence=ISO
GO:0042803 "protein homodimerization activity" evidence=ISO
GO:0043066 "negative regulation of apoptotic process" evidence=ISO
GO:0043234 "protein complex" evidence=ISO
GO:0045121 "membrane raft" evidence=IDA
GO:0046777 "protein autophosphorylation" evidence=ISO
GO:0046835 "carbohydrate phosphorylation" evidence=ISO;IDA;TAS
GO:0051156 "glucose 6-phosphate metabolic process" evidence=ISO
UNIPROTKB|P19367 HK1 "Hexokinase-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E7ENR4 HK1 "Hexokinase-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|2796 Hk1 "hexokinase 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P27595 HK1 "Hexokinase-1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1NEI1 HK1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-2848 hk1 "hexokinase 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NEF0 HK1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NZJ2 HK1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|J9PBL1 HK1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query167
pfam03727238 pfam03727, Hexokinase_2, Hexokinase 2e-14
pfam03727238 pfam03727, Hexokinase_2, Hexokinase 2e-14
PTZ00107464 PTZ00107, PTZ00107, hexokinase; Provisional 7e-08
PTZ00107464 PTZ00107, PTZ00107, hexokinase; Provisional 7e-08
COG5026466 COG5026, COG5026, Hexokinase [Carbohydrate transpo 0.001
COG5026466 COG5026, COG5026, Hexokinase [Carbohydrate transpo 0.001
>gnl|CDD|202746 pfam03727, Hexokinase_2, Hexokinase Back     alignment and domain information 
 Score = 68.1 bits (167), Expect = 2e-14
 Identities = 27/75 (36%), Positives = 44/75 (58%), Gaps = 6/75 (8%)

Query: 90  SISGTAVLVRRI------DRDDITIAVDGSLYKYHPRLKHWLQKYIQLLVPNKTFRLLLA 143
             +G A ++++I      +   +T+ VDGS+YK +P  K  L + ++ L P+     + A
Sbjct: 164 CAAGLAAILQKIRENRGYEHLKVTVGVDGSVYKLYPGFKERLAETLRDLAPDCDVSFIPA 223

Query: 144 EDGSGKGAGLASAIA 158
           EDGSGKGA L +A+A
Sbjct: 224 EDGSGKGAALVAAVA 238

Hexokinase (EC:2.7.1.1) contains two structurally similar domains represented by this family and pfam00349. Some members of the family have two copies of each of these domains. Length = 238
>gnl|CDD|202746 pfam03727, Hexokinase_2, Hexokinase Back     alignment and domain information
>gnl|CDD|240270 PTZ00107, PTZ00107, hexokinase; Provisional Back     alignment and domain information
>gnl|CDD|240270 PTZ00107, PTZ00107, hexokinase; Provisional Back     alignment and domain information
>gnl|CDD|227359 COG5026, COG5026, Hexokinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|227359 COG5026, COG5026, Hexokinase [Carbohydrate transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query167
1bdg_A451 Hexokinase From Schistosoma Mansoni Complexed With 6e-12
1bdg_A451 Hexokinase From Schistosoma Mansoni Complexed With 6e-12
1hkc_A 917 Recombinant Human Hexokinase Type I Complexed With 5e-11
1hkc_A917 Recombinant Human Hexokinase Type I Complexed With 6e-11
1hkb_A 917 Crystal Structure Of Recombinant Human Brain Hexoki 5e-11
1hkb_A917 Crystal Structure Of Recombinant Human Brain Hexoki 6e-11
1dgk_N 917 Mutant Monomer Of Recombinant Human Hexokinase Type 5e-11
1dgk_N917 Mutant Monomer Of Recombinant Human Hexokinase Type 6e-11
1cza_N 917 Mutant Monomer Of Recombinant Human Hexokinase Type 5e-11
1cza_N917 Mutant Monomer Of Recombinant Human Hexokinase Type 6e-11
1bg3_A918 Rat Brain Hexokinase Type I Complex With Glucose An 8e-11
1bg3_A918 Rat Brain Hexokinase Type I Complex With Glucose An 8e-11
2nzt_A 902 Crystal Structure Of Human Hexokinase Ii Length = 9 1e-10
2nzt_A 902 Crystal Structure Of Human Hexokinase Ii Length = 9 3e-10
3hm8_A445 Crystal Structure Of The C-Terminal Hexokinase Doma 2e-09
3hm8_A445 Crystal Structure Of The C-Terminal Hexokinase Doma 2e-09
4dch_A473 Insights Into Glucokinase Activation Mechanism: Obs 7e-09
4dch_A473 Insights Into Glucokinase Activation Mechanism: Obs 7e-09
1v4t_A451 Crystal Structure Of Human Glucokinase Length = 451 7e-09
1v4t_A451 Crystal Structure Of Human Glucokinase Length = 451 7e-09
3imx_A455 Crystal Structure Of Human Glucokinase In Complex W 7e-09
3imx_A455 Crystal Structure Of Human Glucokinase In Complex W 7e-09
3f9m_A470 Human Pancreatic Glucokinase In Complex With Glucos 7e-09
3f9m_A470 Human Pancreatic Glucokinase In Complex With Glucos 7e-09
3s41_A469 Glucokinase In Complex With Activator And Glucose L 7e-09
3s41_A469 Glucokinase In Complex With Activator And Glucose L 7e-09
3fr0_A455 Human Glucokinase In Complex With 2-Amino Benzamide 7e-09
3fr0_A455 Human Glucokinase In Complex With 2-Amino Benzamide 7e-09
1v4s_A455 Crystal Structure Of Human Glucokinase Length = 455 7e-09
1v4s_A455 Crystal Structure Of Human Glucokinase Length = 455 7e-09
3qic_A470 The Structure Of Human Glucokinase E339k Mutation L 3e-08
3qic_A470 The Structure Of Human Glucokinase E339k Mutation L 3e-08
>pdb|1BDG|A Chain A, Hexokinase From Schistosoma Mansoni Complexed With Glucose Length = 451 Back     alignment and structure 
Iteration: 1

 Score = 66.6 bits (161), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 45/70 (64%), Gaps = 1/70 (1%)
Query: 5   SGTAVLVRRIDRDDITIAVDGSLYKYHPRLKHWLQKYIQLLVPNKT-FRLLLAEDGSGKG 63
           +G A ++RRI+R ++T+ VDGSLYK+HP+    +   +  L P  T F L L+EDGSGKG
Sbjct: 380 AGIACILRRINRSEVTVGVDGSLYKFHPKFCERMTDMVDKLKPKNTRFCLRLSEDGSGKG 439
Query: 64  AGLASAIALK 73
           A   +A   +
Sbjct: 440 AAAIAASCTR 449
>pdb|1BDG|A Chain A, Hexokinase From Schistosoma Mansoni Complexed With Glucose Length = 451 Back     alignment and structure
>pdb|1HKC|A Chain A, Recombinant Human Hexokinase Type I Complexed With Glucose And Phosphate Length = 917 Back     alignment and structure
>pdb|1HKC|A Chain A, Recombinant Human Hexokinase Type I Complexed With Glucose And Phosphate Length = 917 Back     alignment and structure
>pdb|1HKB|A Chain A, Crystal Structure Of Recombinant Human Brain Hexokinase Type I Complexed With Glucose And Glucose-6-Phosphate Length = 917 Back     alignment and structure
>pdb|1HKB|A Chain A, Crystal Structure Of Recombinant Human Brain Hexokinase Type I Complexed With Glucose And Glucose-6-Phosphate Length = 917 Back     alignment and structure
>pdb|1DGK|N Chain N, Mutant Monomer Of Recombinant Human Hexokinase Type I With Glucose And Adp In The Active Site Length = 917 Back     alignment and structure
>pdb|1DGK|N Chain N, Mutant Monomer Of Recombinant Human Hexokinase Type I With Glucose And Adp In The Active Site Length = 917 Back     alignment and structure
>pdb|1CZA|N Chain N, Mutant Monomer Of Recombinant Human Hexokinase Type I Complexed With Glucose, Glucose-6-Phosphate, And Adp Length = 917 Back     alignment and structure
>pdb|1CZA|N Chain N, Mutant Monomer Of Recombinant Human Hexokinase Type I Complexed With Glucose, Glucose-6-Phosphate, And Adp Length = 917 Back     alignment and structure
>pdb|1BG3|A Chain A, Rat Brain Hexokinase Type I Complex With Glucose And Inhibitor Glucose-6-Phosphate Length = 918 Back     alignment and structure
>pdb|1BG3|A Chain A, Rat Brain Hexokinase Type I Complex With Glucose And Inhibitor Glucose-6-Phosphate Length = 918 Back     alignment and structure
>pdb|2NZT|A Chain A, Crystal Structure Of Human Hexokinase Ii Length = 902 Back     alignment and structure
>pdb|2NZT|A Chain A, Crystal Structure Of Human Hexokinase Ii Length = 902 Back     alignment and structure
>pdb|3HM8|A Chain A, Crystal Structure Of The C-Terminal Hexokinase Domain Of Human Hk3 Length = 445 Back     alignment and structure
>pdb|3HM8|A Chain A, Crystal Structure Of The C-Terminal Hexokinase Domain Of Human Hk3 Length = 445 Back     alignment and structure
>pdb|4DCH|A Chain A, Insights Into Glucokinase Activation Mechanism: Observation Of Multiple Distinct Protein Conformations Length = 473 Back     alignment and structure
>pdb|4DCH|A Chain A, Insights Into Glucokinase Activation Mechanism: Observation Of Multiple Distinct Protein Conformations Length = 473 Back     alignment and structure
>pdb|1V4T|A Chain A, Crystal Structure Of Human Glucokinase Length = 451 Back     alignment and structure
>pdb|1V4T|A Chain A, Crystal Structure Of Human Glucokinase Length = 451 Back     alignment and structure
>pdb|3IMX|A Chain A, Crystal Structure Of Human Glucokinase In Complex With A Synthetic Activator Length = 455 Back     alignment and structure
>pdb|3IMX|A Chain A, Crystal Structure Of Human Glucokinase In Complex With A Synthetic Activator Length = 455 Back     alignment and structure
>pdb|3F9M|A Chain A, Human Pancreatic Glucokinase In Complex With Glucose And Activator Showing A Mobile Flap Length = 470 Back     alignment and structure
>pdb|3F9M|A Chain A, Human Pancreatic Glucokinase In Complex With Glucose And Activator Showing A Mobile Flap Length = 470 Back     alignment and structure
>pdb|3S41|A Chain A, Glucokinase In Complex With Activator And Glucose Length = 469 Back     alignment and structure
>pdb|3S41|A Chain A, Glucokinase In Complex With Activator And Glucose Length = 469 Back     alignment and structure
>pdb|3FR0|A Chain A, Human Glucokinase In Complex With 2-Amino Benzamide Activator Length = 455 Back     alignment and structure
>pdb|3FR0|A Chain A, Human Glucokinase In Complex With 2-Amino Benzamide Activator Length = 455 Back     alignment and structure
>pdb|1V4S|A Chain A, Crystal Structure Of Human Glucokinase Length = 455 Back     alignment and structure
>pdb|1V4S|A Chain A, Crystal Structure Of Human Glucokinase Length = 455 Back     alignment and structure
>pdb|3QIC|A Chain A, The Structure Of Human Glucokinase E339k Mutation Length = 470 Back     alignment and structure
>pdb|3QIC|A Chain A, The Structure Of Human Glucokinase E339k Mutation Length = 470 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query167
3hm8_A445 Hexokinase-3; glucose, glucose-6-phosphate, non-pr 2e-16
3hm8_A445 Hexokinase-3; glucose, glucose-6-phosphate, non-pr 2e-16
3f9m_A470 Glucokinase; hexokinase IV, ATP-binding, diabetes 6e-16
3f9m_A470 Glucokinase; hexokinase IV, ATP-binding, diabetes 7e-16
1cza_N917 Hexokinase type I; structurally homologous domains 7e-16
1cza_N917 Hexokinase type I; structurally homologous domains 7e-16
1cza_N 917 Hexokinase type I; structurally homologous domains 1e-06
1cza_N 917 Hexokinase type I; structurally homologous domains 4e-06
1bdg_A451 Hexokinase; phosphotransferase; HET: GLC; 2.60A {S 1e-14
1bdg_A451 Hexokinase; phosphotransferase; HET: GLC; 2.60A {S 1e-14
3o8m_A485 Hexokinase; rnaseh-like fold, glycolysis, glucose 2e-13
3o8m_A485 Hexokinase; rnaseh-like fold, glycolysis, glucose 2e-13
2yhx_A457 Hexokinase B; transferase(phosphoryl,alcohol accep 2e-11
2yhx_A457 Hexokinase B; transferase(phosphoryl,alcohol accep 2e-11
>3hm8_A Hexokinase-3; glucose, glucose-6-phosphate, non-protein kinase, structural genomics consortium, SGC, A enzyme, ATP-binding, glycolysis; HET: GLC BG6; 2.80A {Homo sapiens} Length = 445 Back     alignment and structure
 Score = 74.7 bits (183), Expect = 2e-16
 Identities = 25/63 (39%), Positives = 38/63 (60%)

Query: 12  RRIDRDDITIAVDGSLYKYHPRLKHWLQKYIQLLVPNKTFRLLLAEDGSGKGAGLASAIA 71
           R ++   +++ VDG+LYK HPR    +   ++ L P      L +EDGSGKGA L +A+A
Sbjct: 378 RGLEELAVSVGVDGTLYKLHPRFSSLVAATVRELAPRCVVTFLQSEDGSGKGAALVTAVA 437

Query: 72  LKL 74
            +L
Sbjct: 438 CRL 440
>3hm8_A Hexokinase-3; glucose, glucose-6-phosphate, non-protein kinase, structural genomics consortium, SGC, A enzyme, ATP-binding, glycolysis; HET: GLC BG6; 2.80A {Homo sapiens} Length = 445 Back     alignment and structure
>3f9m_A Glucokinase; hexokinase IV, ATP-binding, diabetes mellitus, mutation, glycolysis, nucleotide-binding, transfera; HET: GLC MRK; 1.50A {Homo sapiens} PDB: 3fgu_A* 3id8_A* 3idh_A* 3vev_A* 3vf6_A* 3qic_A* 3s41_A* 4dhy_A* 4dch_A* 3vey_A* 1v4s_A* 3a0i_X* 3fr0_A* 3goi_A* 3imx_A* 3h1v_X* 1v4t_A* Length = 470 Back     alignment and structure
>3f9m_A Glucokinase; hexokinase IV, ATP-binding, diabetes mellitus, mutation, glycolysis, nucleotide-binding, transfera; HET: GLC MRK; 1.50A {Homo sapiens} PDB: 3fgu_A* 3id8_A* 3idh_A* 3vev_A* 3vf6_A* 3qic_A* 3s41_A* 4dhy_A* 4dch_A* 3vey_A* 1v4s_A* 3a0i_X* 3fr0_A* 3goi_A* 3imx_A* 3h1v_X* 1v4t_A* Length = 470 Back     alignment and structure
>1cza_N Hexokinase type I; structurally homologous domains, transferase; HET: GLC G6P ADP; 1.90A {Homo sapiens} SCOP: c.55.1.3 c.55.1.3 c.55.1.3 c.55.1.3 PDB: 1dgk_N* 1hkb_A* 1qha_A* 1hkc_A* 1bg3_A* 2nzt_A* Length = 917 Back     alignment and structure
>1cza_N Hexokinase type I; structurally homologous domains, transferase; HET: GLC G6P ADP; 1.90A {Homo sapiens} SCOP: c.55.1.3 c.55.1.3 c.55.1.3 c.55.1.3 PDB: 1dgk_N* 1hkb_A* 1qha_A* 1hkc_A* 1bg3_A* 2nzt_A* Length = 917 Back     alignment and structure
>1cza_N Hexokinase type I; structurally homologous domains, transferase; HET: GLC G6P ADP; 1.90A {Homo sapiens} SCOP: c.55.1.3 c.55.1.3 c.55.1.3 c.55.1.3 PDB: 1dgk_N* 1hkb_A* 1qha_A* 1hkc_A* 1bg3_A* 2nzt_A* Length = 917 Back     alignment and structure
>1cza_N Hexokinase type I; structurally homologous domains, transferase; HET: GLC G6P ADP; 1.90A {Homo sapiens} SCOP: c.55.1.3 c.55.1.3 c.55.1.3 c.55.1.3 PDB: 1dgk_N* 1hkb_A* 1qha_A* 1hkc_A* 1bg3_A* 2nzt_A* Length = 917 Back     alignment and structure
>1bdg_A Hexokinase; phosphotransferase; HET: GLC; 2.60A {Schistosoma mansoni} SCOP: c.55.1.3 c.55.1.3 Length = 451 Back     alignment and structure
>1bdg_A Hexokinase; phosphotransferase; HET: GLC; 2.60A {Schistosoma mansoni} SCOP: c.55.1.3 c.55.1.3 Length = 451 Back     alignment and structure
>3o8m_A Hexokinase; rnaseh-like fold, glycolysis, glucose repression binding, MIG1 binding, transferase; HET: GLC BGC; 1.42A {Kluyveromyces lactis} PDB: 3o1b_A 3o08_A* 3o1w_A* 3o5b_A* 3o4w_A 3o80_A* 3o6w_A* 1ig8_A 3b8a_X* Length = 485 Back     alignment and structure
>3o8m_A Hexokinase; rnaseh-like fold, glycolysis, glucose repression binding, MIG1 binding, transferase; HET: GLC BGC; 1.42A {Kluyveromyces lactis} PDB: 3o1b_A 3o08_A* 3o1w_A* 3o5b_A* 3o4w_A 3o80_A* 3o6w_A* 1ig8_A 3b8a_X* Length = 485 Back     alignment and structure
>2yhx_A Hexokinase B; transferase(phosphoryl,alcohol acceptr); HET: OTG; 2.10A {Saccharomyces cerevisiae} SCOP: i.12.1.1 PDB: 1hkg_A Length = 457 Back     alignment and structure
>2yhx_A Hexokinase B; transferase(phosphoryl,alcohol acceptr); HET: OTG; 2.10A {Saccharomyces cerevisiae} SCOP: i.12.1.1 PDB: 1hkg_A Length = 457 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query167
3hm8_A445 Hexokinase-3; glucose, glucose-6-phosphate, non-pr 99.93
3f9m_A470 Glucokinase; hexokinase IV, ATP-binding, diabetes 99.93
3o8m_A485 Hexokinase; rnaseh-like fold, glycolysis, glucose 99.9
2yhx_A457 Hexokinase B; transferase(phosphoryl,alcohol accep 99.82
3hm8_A445 Hexokinase-3; glucose, glucose-6-phosphate, non-pr 99.8
3f9m_A470 Glucokinase; hexokinase IV, ATP-binding, diabetes 99.77
1cza_N917 Hexokinase type I; structurally homologous domains 99.76
3o8m_A485 Hexokinase; rnaseh-like fold, glycolysis, glucose 99.73
1bdg_A451 Hexokinase; phosphotransferase; HET: GLC; 2.60A {S 99.68
1cza_N 917 Hexokinase type I; structurally homologous domains 99.58
2yhx_A457 Hexokinase B; transferase(phosphoryl,alcohol accep 99.57
1bdg_A451 Hexokinase; phosphotransferase; HET: GLC; 2.60A {S 99.36
2ch5_A347 NAGK protein; transferase, N-acetylglucosamine, gl 96.03
2qm1_A326 Glucokinase; alpha-beta structure, putative helix- 95.18
2hoe_A380 N-acetylglucosamine kinase; TM1224, structural gen 93.99
3r8e_A321 Hypothetical sugar kinase; ribonuclease H-like mot 93.93
2e2o_A299 Hexokinase; acetate and sugar kinases, HSP70, acti 93.92
2aa4_A289 Mannac kinase, putative N-acetylmannosamine kinase 91.61
4htl_A297 Beta-glucoside kinase; structural genomics, sugar 90.22
1z05_A429 Transcriptional regulator, ROK family; structural 90.19
3vgl_A321 Glucokinase; ROK family, transferase; HET: BGC ANP 90.03
1z6r_A406 MLC protein; transcriptional repressor, ROK family 89.69
3vov_A302 Glucokinase, hexokinase; ROK, sugar kinase, transf 89.39
4db3_A327 Glcnac kinase, N-acetyl-D-glucosamine kinase; stru 89.0
2gup_A292 ROK family protein; sugar kinase, streptococcus pn 88.7
2yhw_A343 Bifunctional UDP-N-acetylglucosamine 2-epimerase/N 88.27
2ap1_A327 Putative regulator protein; zinc binding protein, 87.56
3htv_A310 D-allose kinase, allokinase; NP_418508.1, structur 84.5
2ch5_A347 NAGK protein; transferase, N-acetylglucosamine, gl 83.24
1saz_A381 Probable butyrate kinase 2; askha (acetate and sug 81.92
>3hm8_A Hexokinase-3; glucose, glucose-6-phosphate, non-protein kinase, structural genomics consortium, SGC, A enzyme, ATP-binding, glycolysis; HET: GLC BG6; 2.80A {Homo sapiens} Back     alignment and structure
Probab=99.93  E-value=6.6e-27  Score=208.96  Aligned_cols=100  Identities=33%  Similarity=0.501  Sum_probs=89.3

Q ss_pred             HHHHHHHhcccc-----------chHHHHHHHHHHHHHHHHHHHHhCC------CceEEEEcCcccccCcchHHHHHHHH
Q psy13604         67 ASAIALKLGAFH-----------NFIMSHNFIMFSISGTAVLVRRIDR------DDITIAVDGSLYKYHPRLKHWLQKYI  129 (167)
Q Consensus        67 ~aav~~~lg~~~-----------~~~V~~RsA~L~Aa~iaail~~~~~------~~~~IavDGSv~e~~P~f~~~l~~~l  129 (167)
                      ...+.+.++.+.           |++|++|||||+|++++||++|+++      .+++|||||||||+||+|+++|++++
T Consensus       329 ~~~~l~~l~~~~t~~d~~~vr~i~~~V~~RaA~L~Aa~iaai~~k~~~~~~~~~~~~~VgvDGsvy~~~P~f~~~l~~~l  408 (445)
T 3hm8_A          329 VRAILEDLGLPLTSDDALMVLEVCQAVSQRAAQLCGAGVAAVVEKIRENRGLEELAVSVGVDGTLYKLHPRFSSLVAATV  408 (445)
T ss_dssp             HHHHHHTTTCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCSSEEEEEEEECHHHHHCTTHHHHHHHHH
T ss_pred             HHHHHHHhCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcccccccccCcEEEEeceehccChhHHHHHHHHH
Confidence            455667787743           9999999999999999999999964      26899999999999999999999999


Q ss_pred             HhhCCCCcEEEEEcCCcchHHHHHHHHHHHHHhhccC
Q psy13604        130 QLLVPNKTFRLLLAEDGSGKGAGLASAIALKLGAFQS  166 (167)
Q Consensus       130 ~~l~~~~~v~~~~a~dGSg~GAAl~aA~a~~~~~~~~  166 (167)
                      ++|.|+++|+|.+++||||+|||++||++.++..|++
T Consensus       409 ~~l~~~~~v~~~~s~DGSg~GAAl~AA~a~~~~~~~~  445 (445)
T 3hm8_A          409 RELAPRCVVTFLQSEDGSGKGAALVTAVACRLAQLTR  445 (445)
T ss_dssp             HHHCTTEEEEEEECSSCHHHHHHHHHHHHHHHHC---
T ss_pred             HHhCCCCcEEEEECCCCchHHHHHHHHHHHHHHhhcC
Confidence            9999999999999999999999999999999999875
>3f9m_A Glucokinase; hexokinase IV, ATP-binding, diabetes mellitus, mutation, glycolysis, nucleotide-binding, transfera; HET: GLC MRK; 1.50A {Homo sapiens} PDB: 3fgu_A* 3id8_A* 3idh_A* 3vev_A* 3vf6_A* 3qic_A* 3s41_A* 4dhy_A* 4dch_A* 3vey_A* 1v4s_A* 3a0i_X* 3fr0_A* 3goi_A* 3imx_A* 3h1v_X* 1v4t_A* Back     alignment and structure
>3o8m_A Hexokinase; rnaseh-like fold, glycolysis, glucose repression binding, MIG1 binding, transferase; HET: GLC BGC; 1.42A {Kluyveromyces lactis} PDB: 3o1b_A 3o08_A* 3o1w_A* 3o5b_A* 3o4w_A 3o80_A* 3o6w_A* 1ig8_A 3b8a_X* Back     alignment and structure
>2yhx_A Hexokinase B; transferase(phosphoryl,alcohol acceptr); HET: OTG; 2.10A {Saccharomyces cerevisiae} SCOP: i.12.1.1 PDB: 1hkg_A Back     alignment and structure
>3hm8_A Hexokinase-3; glucose, glucose-6-phosphate, non-protein kinase, structural genomics consortium, SGC, A enzyme, ATP-binding, glycolysis; HET: GLC BG6; 2.80A {Homo sapiens} Back     alignment and structure
>3f9m_A Glucokinase; hexokinase IV, ATP-binding, diabetes mellitus, mutation, glycolysis, nucleotide-binding, transfera; HET: GLC MRK; 1.50A {Homo sapiens} PDB: 3fgu_A* 3id8_A* 3idh_A* 3vev_A* 3vf6_A* 3qic_A* 3s41_A* 4dhy_A* 4dch_A* 3vey_A* 1v4s_A* 3a0i_X* 3fr0_A* 3goi_A* 3imx_A* 3h1v_X* 1v4t_A* Back     alignment and structure
>1cza_N Hexokinase type I; structurally homologous domains, transferase; HET: GLC G6P ADP; 1.90A {Homo sapiens} SCOP: c.55.1.3 c.55.1.3 c.55.1.3 c.55.1.3 PDB: 1dgk_N* 1hkb_A* 1qha_A* 1hkc_A* 1bg3_A* 2nzt_A* Back     alignment and structure
>3o8m_A Hexokinase; rnaseh-like fold, glycolysis, glucose repression binding, MIG1 binding, transferase; HET: GLC BGC; 1.42A {Kluyveromyces lactis} PDB: 3o1b_A 3o08_A* 3o1w_A* 3o5b_A* 3o4w_A 3o80_A* 3o6w_A* 1ig8_A 3b8a_X* Back     alignment and structure
>1bdg_A Hexokinase; phosphotransferase; HET: GLC; 2.60A {Schistosoma mansoni} SCOP: c.55.1.3 c.55.1.3 Back     alignment and structure
>1cza_N Hexokinase type I; structurally homologous domains, transferase; HET: GLC G6P ADP; 1.90A {Homo sapiens} SCOP: c.55.1.3 c.55.1.3 c.55.1.3 c.55.1.3 PDB: 1dgk_N* 1hkb_A* 1qha_A* 1hkc_A* 1bg3_A* 2nzt_A* Back     alignment and structure
>2yhx_A Hexokinase B; transferase(phosphoryl,alcohol acceptr); HET: OTG; 2.10A {Saccharomyces cerevisiae} SCOP: i.12.1.1 PDB: 1hkg_A Back     alignment and structure
>1bdg_A Hexokinase; phosphotransferase; HET: GLC; 2.60A {Schistosoma mansoni} SCOP: c.55.1.3 c.55.1.3 Back     alignment and structure
>2ch5_A NAGK protein; transferase, N-acetylglucosamine, glcnac, sugar kinase, RIBO H fold, sugar kinase/HSP70/actin superfamily, domain rotati conformation; HET: NAG NDG; 1.9A {Homo sapiens} SCOP: c.55.1.5 c.55.1.5 PDB: 2ch6_A* Back     alignment and structure
>2qm1_A Glucokinase; alpha-beta structure, putative helix-turn-helix, structural PSI-2, protein structure initiative; HET: MSE; 2.02A {Enterococcus faecalis} Back     alignment and structure
>2hoe_A N-acetylglucosamine kinase; TM1224, structural genomics, PSI-2, protein structure initiative, joint center structural genomics, JCSG; 2.46A {Thermotoga maritima} SCOP: a.4.5.63 c.55.1.10 c.55.1.10 Back     alignment and structure
>3r8e_A Hypothetical sugar kinase; ribonuclease H-like motif, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.65A {Cytophaga hutchinsonii} Back     alignment and structure
>2e2o_A Hexokinase; acetate and sugar kinases, HSP70, actin superfamily, ribonuc fold, sugar kinase, glucose, phosphoryl transfer, transferase; HET: BGC; 1.65A {Sulfolobus tokodaii} PDB: 2e2n_A* 2e2p_A* 2e2q_A* Back     alignment and structure
>2aa4_A Mannac kinase, putative N-acetylmannosamine kinase; sugar methabolism, structural genomics, PSI, protein structure initiative; 2.20A {Escherichia coli} SCOP: c.55.1.10 c.55.1.10 Back     alignment and structure
>4htl_A Beta-glucoside kinase; structural genomics, sugar kinase, ROK family, PSI-biology, center for structural genomics, MCSG, transferase; HET: MSE; 1.64A {Listeria monocytogenes} Back     alignment and structure
>1z05_A Transcriptional regulator, ROK family; structural genomics, protein structure initiative, midwest center for structural genomics; 2.00A {Vibrio cholerae o1 biovar eltor} SCOP: a.4.5.63 c.55.1.10 c.55.1.10 Back     alignment and structure
>3vgl_A Glucokinase; ROK family, transferase; HET: BGC ANP; 1.55A {Streptomyces griseus} PDB: 3vgk_A* 3vgm_A* Back     alignment and structure
>1z6r_A MLC protein; transcriptional repressor, ROK family protein, DNA binding P helix-turn-helix, phosphotransferase system; 2.70A {Escherichia coli} SCOP: a.4.5.63 c.55.1.10 c.55.1.10 PDB: 3bp8_A Back     alignment and structure
>3vov_A Glucokinase, hexokinase; ROK, sugar kinase, transferase; 2.02A {Thermus thermophilus} Back     alignment and structure
>4db3_A Glcnac kinase, N-acetyl-D-glucosamine kinase; structural genomics, center for structural genomics of infec diseases, csgid, transferase; 1.95A {Vibrio vulnificus} Back     alignment and structure
>2gup_A ROK family protein; sugar kinase, streptococcus pneumoniae TIGR4, AP sucrose, structural genomics, PSI; HET: SUC; 2.01A {Streptococcus pneumoniae} SCOP: c.55.1.10 c.55.1.10 Back     alignment and structure
>2yhw_A Bifunctional UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase; transferase, sialic acid, mannac, ROK family; HET: BM3 2PE; 1.64A {Homo sapiens} PDB: 2yhy_A* 2yi1_A* 3eo3_A Back     alignment and structure
>2ap1_A Putative regulator protein; zinc binding protein, structural genomics, PSI, protein STRU initiative; 1.90A {Salmonella typhimurium} SCOP: c.55.1.10 c.55.1.10 Back     alignment and structure
>3htv_A D-allose kinase, allokinase; NP_418508.1, structural genomics, joint CEN structural genomics, JCSG, protein structure initiative; HET: MSE; 1.95A {Escherichia coli k-12} Back     alignment and structure
>2ch5_A NAGK protein; transferase, N-acetylglucosamine, glcnac, sugar kinase, RIBO H fold, sugar kinase/HSP70/actin superfamily, domain rotati conformation; HET: NAG NDG; 1.9A {Homo sapiens} SCOP: c.55.1.5 c.55.1.5 PDB: 2ch6_A* Back     alignment and structure
>1saz_A Probable butyrate kinase 2; askha (acetate and sugar kinases, HSC70, actin) superfamily, acetate kinase, isobutyrate kinase; HET: ACP; 2.50A {Thermotoga maritima} SCOP: c.55.1.2 c.55.1.2 PDB: 1x9j_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 167
d1czan4243 c.55.1.3 (N:671-913) Mammalian type I hexokinase { 6e-19
d1czan4243 c.55.1.3 (N:671-913) Mammalian type I hexokinase { 6e-19
d1czan2243 c.55.1.3 (N:223-465) Mammalian type I hexokinase { 7e-19
d1czan2243 c.55.1.3 (N:223-465) Mammalian type I hexokinase { 1e-18
d1v4sa2243 c.55.1.3 (A:219-461) Glucokinase {Human (Homo sapi 5e-18
d1v4sa2243 c.55.1.3 (A:219-461) Glucokinase {Human (Homo sapi 1e-17
d1bdga2237 c.55.1.3 (A:223-460) Hexokinase {Blood fluke (Schi 5e-18
d1bdga2237 c.55.1.3 (A:223-460) Hexokinase {Blood fluke (Schi 5e-18
d1ig8a2262 c.55.1.3 (A:225-486) Hexokinase {Baker's yeast (Sa 1e-17
d1ig8a2262 c.55.1.3 (A:225-486) Hexokinase {Baker's yeast (Sa 3e-17
>d1czan4 c.55.1.3 (N:671-913) Mammalian type I hexokinase {Human (Homo sapiens) [TaxId: 9606]} Length = 243 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Ribonuclease H-like motif
superfamily: Actin-like ATPase domain
family: Hexokinase
domain: Mammalian type I hexokinase
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 78.4 bits (193), Expect = 6e-19
 Identities = 27/63 (42%), Positives = 41/63 (65%)

Query: 12  RRIDRDDITIAVDGSLYKYHPRLKHWLQKYIQLLVPNKTFRLLLAEDGSGKGAGLASAIA 71
           R +DR ++T+ VDG+LYK HP     + + ++ L P      LL+EDGSGKGA L +A+ 
Sbjct: 179 RGLDRLNVTVGVDGTLYKLHPHFSRIMHQTVKELSPKCNVSFLLSEDGSGKGAALITAVG 238

Query: 72  LKL 74
           ++L
Sbjct: 239 VRL 241
>d1czan4 c.55.1.3 (N:671-913) Mammalian type I hexokinase {Human (Homo sapiens) [TaxId: 9606]} Length = 243 Back     information, alignment and structure
>d1czan2 c.55.1.3 (N:223-465) Mammalian type I hexokinase {Human (Homo sapiens) [TaxId: 9606]} Length = 243 Back     information, alignment and structure
>d1czan2 c.55.1.3 (N:223-465) Mammalian type I hexokinase {Human (Homo sapiens) [TaxId: 9606]} Length = 243 Back     information, alignment and structure
>d1v4sa2 c.55.1.3 (A:219-461) Glucokinase {Human (Homo sapiens) [TaxId: 9606]} Length = 243 Back     information, alignment and structure
>d1v4sa2 c.55.1.3 (A:219-461) Glucokinase {Human (Homo sapiens) [TaxId: 9606]} Length = 243 Back     information, alignment and structure
>d1bdga2 c.55.1.3 (A:223-460) Hexokinase {Blood fluke (Schistosoma mansoni) [TaxId: 6183]} Length = 237 Back     information, alignment and structure
>d1bdga2 c.55.1.3 (A:223-460) Hexokinase {Blood fluke (Schistosoma mansoni) [TaxId: 6183]} Length = 237 Back     information, alignment and structure
>d1ig8a2 c.55.1.3 (A:225-486) Hexokinase {Baker's yeast (Saccharomyces cerevisiae), pII [TaxId: 4932]} Length = 262 Back     information, alignment and structure
>d1ig8a2 c.55.1.3 (A:225-486) Hexokinase {Baker's yeast (Saccharomyces cerevisiae), pII [TaxId: 4932]} Length = 262 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query167
d1czan2243 Mammalian type I hexokinase {Human (Homo sapiens) 99.94
d1ig8a2262 Hexokinase {Baker's yeast (Saccharomyces cerevisia 99.93
d1v4sa2243 Glucokinase {Human (Homo sapiens) [TaxId: 9606]} 99.93
d1czan4243 Mammalian type I hexokinase {Human (Homo sapiens) 99.93
d1bdga2237 Hexokinase {Blood fluke (Schistosoma mansoni) [Tax 99.91
d1czan2243 Mammalian type I hexokinase {Human (Homo sapiens) 99.81
d1czan4243 Mammalian type I hexokinase {Human (Homo sapiens) 99.8
d1v4sa2243 Glucokinase {Human (Homo sapiens) [TaxId: 9606]} 99.79
d1ig8a2262 Hexokinase {Baker's yeast (Saccharomyces cerevisia 99.79
d1bdga2237 Hexokinase {Blood fluke (Schistosoma mansoni) [Tax 99.76
d2ch5a1227 N-acetylglucosamine kinase, NAGK {Human (Homo sapi 97.13
d1z05a2197 Transcriptional regulator VC2007 {Vibrio cholerae 96.15
d2hoea2169 N-acetylglucosamine kinase {Thermotoga maritima [T 95.66
d2aa4a2170 N-acetylmannosamine kinase NanK {Escherichia coli 93.93
d1z6ra3196 Mlc protein {Escherichia coli [TaxId: 562]} 93.51
d2ch5a1227 N-acetylglucosamine kinase, NAGK {Human (Homo sapi 93.31
d2gupa2175 Hypothetical protein SP2142 {Streptococcus pneumon 91.79
d1r59o2235 Glycerol kinase {Enterococcus casseliflavus [TaxId 89.05
d2ap1a1186 Putative regulator protein YcfX {Salmonella typhim 86.24
d2p3ra2247 Glycerol kinase {Escherichia coli [TaxId: 562]} 86.13
d1huxa_259 Hydroxyglutaryl-CoA dehydratase component A {Acida 84.37
d2hoea2169 N-acetylglucosamine kinase {Thermotoga maritima [T 83.49
d1z05a2197 Transcriptional regulator VC2007 {Vibrio cholerae 82.87
>d1czan2 c.55.1.3 (N:223-465) Mammalian type I hexokinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Ribonuclease H-like motif
superfamily: Actin-like ATPase domain
family: Hexokinase
domain: Mammalian type I hexokinase
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.94  E-value=6.5e-27  Score=192.43  Aligned_cols=100  Identities=34%  Similarity=0.511  Sum_probs=90.9

Q ss_pred             hhHHHHHHHHhcccc-----------chHHHHHHHHHHHHHHHHHHHHhCC------CceEEEEcCcccccCcchHHHHH
Q psy13604         64 AGLASAIALKLGAFH-----------NFIMSHNFIMFSISGTAVLVRRIDR------DDITIAVDGSLYKYHPRLKHWLQ  126 (167)
Q Consensus        64 aA~~aav~~~lg~~~-----------~~~V~~RsA~L~Aa~iaail~~~~~------~~~~IavDGSv~e~~P~f~~~l~  126 (167)
                      ......+..+++.+.           |++|++|||+|+|++++||++|++.      .+++||+|||||+|||+|+++|+
T Consensus       127 ~~~~~~il~~~~~~~s~~d~~~lr~i~~~v~~RAA~L~Aa~iaail~~~~~~~~~~~~~~~Va~dGSv~~~~p~f~~~~~  206 (243)
T d1czan2         127 LHNAKEILTRLGVEPSDDDCVSVQHVCTIVSFRSANLVAATLGAILNRLRDNKGTPRLRTTVGVDGSLYKTHPQYSRRFH  206 (243)
T ss_dssp             HHHHHHHHHHTTCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTCSSEEEEEEEECHHHHHCSSHHHHHH
T ss_pred             HHHHHHHHHHcCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhccccCCCCcceEEEEechhhhhCchHHHHHH
Confidence            445667778888753           9999999999999999999999963      36899999999999999999999


Q ss_pred             HHHHhhCCCCcEEEEEcCCcchHHHHHHHHHHHHHhh
Q psy13604        127 KYIQLLVPNKTFRLLLAEDGSGKGAGLASAIALKLGA  163 (167)
Q Consensus       127 ~~l~~l~~~~~v~~~~a~dGSg~GAAl~aA~a~~~~~  163 (167)
                      +++++|+|+.+|+|.+++||||+|||++||++.|+++
T Consensus       207 ~~l~~l~~~~~v~~~~~~DGSg~GAAl~Aa~a~r~~~  243 (243)
T d1czan2         207 KTLRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLAE  243 (243)
T ss_dssp             HHHHHHCTTEEEEEEECTTCHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHCCCCceEEEEccCCcHHHHHHHHHHHHHhhC
Confidence            9999999999999999999999999999999999863
>d1ig8a2 c.55.1.3 (A:225-486) Hexokinase {Baker's yeast (Saccharomyces cerevisiae), pII [TaxId: 4932]} Back     information, alignment and structure
>d1v4sa2 c.55.1.3 (A:219-461) Glucokinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1czan4 c.55.1.3 (N:671-913) Mammalian type I hexokinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bdga2 c.55.1.3 (A:223-460) Hexokinase {Blood fluke (Schistosoma mansoni) [TaxId: 6183]} Back     information, alignment and structure
>d1czan2 c.55.1.3 (N:223-465) Mammalian type I hexokinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1czan4 c.55.1.3 (N:671-913) Mammalian type I hexokinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v4sa2 c.55.1.3 (A:219-461) Glucokinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ig8a2 c.55.1.3 (A:225-486) Hexokinase {Baker's yeast (Saccharomyces cerevisiae), pII [TaxId: 4932]} Back     information, alignment and structure
>d1bdga2 c.55.1.3 (A:223-460) Hexokinase {Blood fluke (Schistosoma mansoni) [TaxId: 6183]} Back     information, alignment and structure
>d2ch5a1 c.55.1.5 (A:118-344) N-acetylglucosamine kinase, NAGK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z05a2 c.55.1.10 (A:209-405) Transcriptional regulator VC2007 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2hoea2 c.55.1.10 (A:200-368) N-acetylglucosamine kinase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2aa4a2 c.55.1.10 (A:120-289) N-acetylmannosamine kinase NanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z6ra3 c.55.1.10 (A:211-406) Mlc protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ch5a1 c.55.1.5 (A:118-344) N-acetylglucosamine kinase, NAGK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gupa2 c.55.1.10 (A:115-289) Hypothetical protein SP2142 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1r59o2 c.55.1.4 (O:257-491) Glycerol kinase {Enterococcus casseliflavus [TaxId: 37734]} Back     information, alignment and structure
>d2ap1a1 c.55.1.10 (A:118-303) Putative regulator protein YcfX {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1huxa_ c.55.1.5 (A:) Hydroxyglutaryl-CoA dehydratase component A {Acidaminococcus fermentans [TaxId: 905]} Back     information, alignment and structure
>d2hoea2 c.55.1.10 (A:200-368) N-acetylglucosamine kinase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1z05a2 c.55.1.10 (A:209-405) Transcriptional regulator VC2007 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure