Psyllid ID: psy13613


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110--
MPRYCLFGDTVNTASRMESTSEPMKIHISENTKDLIPAEYRVSQRGEILIKGKGSMKTYWLEQHDRRAPLSRLCTVPPSYPELEWEKYADNMKDLVEERRVYSPNLKLKLKQ
ccccccccHHHHHHcccccccccccEEEcHHHHHHcccccEEEEEEcEEEEccEEEEEEEEEccccccccccccccccccccHHHHHHHccHHHHHHHHHccccccHHHccc
cccEEEccccccccHHcccccccEEEEEcHHHHHHHcccEEEEEccEEEEEcccEEEEEEEEcccccccccccccccccccccccccccHHHHHHHHHHHHccccccccccc
mpryclfgdtvntasrmestsepmkihisentkdlipaeyrvsqRGEILIKGKGSMKTYWLeqhdrraplsrlctvppsypelewEKYADNMKDLVEERRvyspnlklklkq
mpryclfgdtvntasrmestsepmkihisentkdlipaeYRVSQRGEILIKGKGSMKTYWLEQhdrraplsrlcTVPPSYPELEWEKYADNMKDLVEErrvyspnlklklkq
MPRYCLFGDTVNTASRMESTSEPMKIHISENTKDLIPAEYRVSQRGEILIKGKGSMKTYWLEQHDRRAPLSRLCTVPPSYPELEWEKYADNMKDLVEERRVYSPNLKLKLKQ
****CLFG**************************LIPAEYRVSQRGEILIKGKGSMKTYWLEQHDRRAPLSRLCTVPPSYPELEWEKYADNMKDL*****************
MPRYCLFGDTVNTASRMESTSEPMKIHISENTKDLIPAEYRVSQRGEILIKGKGSMKTYWLEQH************************************************
MPRYCLFGDTVNTASRMESTSEPMKIHISENTKDLIPAEYRVSQRGEILIKGKGSMKTYWLEQHDRRAPLSRLCTVPPSYPELEWEKYADNMKDLVEERRVYSPNLKLKLKQ
*PRYCLFGDTVNTASRMESTSEPMKIHISENTKDLIPAEYRVSQRGEILIKGKGSMKTYWLEQHDRRAPLSRLCT*********WEKYA***K*LVEER*************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPRYCLFGDTVNTASRMESTSEPMKIHISENTKDLIPAEYRVSQRGEILIKGKGSMKTYWLEQHDRRAPLSRLCTVPPSYPELEWEKYADNMKDLVEERRVYSPNLKLKLKQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query112 2.2.26 [Sep-21-2011]
Q8INF0 947 Soluble guanylate cyclase yes N/A 0.625 0.073 0.7 1e-23
Q075531163 Guanylate cyclase 32E OS= no N/A 0.562 0.054 0.630 1e-16
Q094351137 Guanylate cyclase recepto no N/A 0.571 0.056 0.557 1e-16
Q6VVW51047 Atrial natriuretic peptid yes N/A 0.616 0.065 0.535 2e-16
P160671047 Atrial natriuretic peptid yes N/A 0.607 0.064 0.549 2e-16
P461971047 Atrial natriuretic peptid no N/A 0.607 0.064 0.549 3e-16
P552051100 Guanylate cyclase 2G OS=R no N/A 0.741 0.075 0.488 3e-16
P205941047 Atrial natriuretic peptid yes N/A 0.607 0.064 0.549 3e-16
Q9VEU6667 Soluble guanylate cyclase no N/A 0.544 0.091 0.612 4e-16
P552021050 Atrial natriuretic peptid N/A N/A 0.544 0.058 0.587 6e-16
>sp|Q8INF0|GCY8E_DROME Soluble guanylate cyclase 88E OS=Drosophila melanogaster GN=Gyc88E PE=1 SV=3 Back     alignment and function desciption
 Score =  108 bits (269), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 58/70 (82%)

Query: 1   MPRYCLFGDTVNTASRMESTSEPMKIHISENTKDLIPAEYRVSQRGEILIKGKGSMKTYW 60
           MPRYCLFGDTVNTASRMESTS  MK+HISE+TK LI   Y++ +RGEI +KGKG+M TYW
Sbjct: 532 MPRYCLFGDTVNTASRMESTSIAMKVHISESTKVLIGPNYKIIERGEIDVKGKGTMGTYW 591

Query: 61  LEQHDRRAPL 70
           LE+ + R PL
Sbjct: 592 LEERENRLPL 601




Heterodimers with Gyc-89Da and Gyc-89Db are activated in response to changing oxygen concentrations, alerting flies to hypoxic environments. Under normal oxygen concentrations, oxygen binds to the heme group and results in low levels of guanylyl cyclase activity. When exposed to reduced oxygen concentrations, the oxygen dissociates from the heme group resulting in activation of the enzyme.
Drosophila melanogaster (taxid: 7227)
EC: 4EC: .EC: 6EC: .EC: 1EC: .EC: 2
>sp|Q07553|GCY3E_DROME Guanylate cyclase 32E OS=Drosophila melanogaster GN=Gyc32E PE=1 SV=4 Back     alignment and function description
>sp|Q09435|GCY1_CAEEL Guanylate cyclase receptor-type gcy-1 OS=Caenorhabditis elegans GN=gcy-1 PE=3 SV=1 Back     alignment and function description
>sp|Q6VVW5|ANPRB_MOUSE Atrial natriuretic peptide receptor 2 OS=Mus musculus GN=Npr2 PE=2 SV=2 Back     alignment and function description
>sp|P16067|ANPRB_RAT Atrial natriuretic peptide receptor 2 OS=Rattus norvegicus GN=Npr2 PE=1 SV=1 Back     alignment and function description
>sp|P46197|ANPRB_BOVIN Atrial natriuretic peptide receptor 2 OS=Bos taurus GN=NPR2 PE=2 SV=1 Back     alignment and function description
>sp|P55205|GUC2G_RAT Guanylate cyclase 2G OS=Rattus norvegicus GN=Gucy2g PE=2 SV=2 Back     alignment and function description
>sp|P20594|ANPRB_HUMAN Atrial natriuretic peptide receptor 2 OS=Homo sapiens GN=NPR2 PE=1 SV=1 Back     alignment and function description
>sp|Q9VEU6|GCYDA_DROME Soluble guanylate cyclase 89Da OS=Drosophila melanogaster GN=Gyc-89Da PE=1 SV=2 Back     alignment and function description
>sp|P55202|ANPRB_ANGJA Atrial natriuretic peptide receptor 2 OS=Anguilla japonica GN=npr2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query112
193695130 949 PREDICTED: soluble guanylate cyclase 88E 0.866 0.102 0.673 3e-31
242003373 802 Soluble guanylate cyclase gcy-31, putati 0.982 0.137 0.553 1e-26
357618477 1015 soluble guanylyl cyclase beta-3 [Danaus 0.857 0.094 0.58 3e-25
3511175 940 soluble guanylyl cyclase beta-3 [Manduca 0.982 0.117 0.535 3e-25
347966938 1009 AGAP001985-PA [Anopheles gambiae str. PE 0.919 0.102 0.496 4e-24
312385553 1036 hypothetical protein AND_00638 [Anophele 0.928 0.100 0.5 7e-24
157135510 1025 soluble guanylate cyclase gcy [Aedes aeg 0.919 0.100 0.471 9e-24
170042594 825 soluble guanylate cyclase 88E [Culex qui 0.928 0.126 0.508 3e-23
195055626 1083 GH17385 [Drosophila grimshawi] gi|193892 0.696 0.072 0.653 1e-22
60458817 832 soluble guanylyl cyclase beta-3 [Apis me 0.776 0.104 0.573 2e-22
>gi|193695130|ref|XP_001945138.1| PREDICTED: soluble guanylate cyclase 88E-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  139 bits (349), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 78/98 (79%), Gaps = 1/98 (1%)

Query: 1   MPRYCLFGDTVNTASRMESTSEPMKIHISENTKDLIPAEYRVSQRGEILIKGKGSMKTYW 60
           MPRYCLFGD+VNTASRMESTSE MKIHIS+ T+DLI A Y V +RGEI +KGKG+MKTYW
Sbjct: 533 MPRYCLFGDSVNTASRMESTSEAMKIHISQTTRDLISASYMVKERGEIYVKGKGAMKTYW 592

Query: 61  LEQHDRRAPLSRLCTVPPS-YPELEWEKYADNMKDLVE 97
           LE  + R PLSR+  +  S  PELEWE+ AD + D+VE
Sbjct: 593 LEHRESRPPLSRVLPLANSDVPELEWERSADAVFDIVE 630




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|242003373|ref|XP_002422715.1| Soluble guanylate cyclase gcy-31, putative [Pediculus humanus corporis] gi|212505537|gb|EEB09977.1| Soluble guanylate cyclase gcy-31, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|357618477|gb|EHJ71438.1| soluble guanylyl cyclase beta-3 [Danaus plexippus] Back     alignment and taxonomy information
>gi|3511175|gb|AAD09836.1| soluble guanylyl cyclase beta-3 [Manduca sexta] Back     alignment and taxonomy information
>gi|347966938|ref|XP_321074.5| AGAP001985-PA [Anopheles gambiae str. PEST] gi|333469832|gb|EAA01162.5| AGAP001985-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|312385553|gb|EFR30023.1| hypothetical protein AND_00638 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|157135510|ref|XP_001663475.1| soluble guanylate cyclase gcy [Aedes aegypti] gi|108870209|gb|EAT34434.1| AAEL013328-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|170042594|ref|XP_001849005.1| soluble guanylate cyclase 88E [Culex quinquefasciatus] gi|167866118|gb|EDS29501.1| soluble guanylate cyclase 88E [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|195055626|ref|XP_001994714.1| GH17385 [Drosophila grimshawi] gi|193892477|gb|EDV91343.1| GH17385 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|60458817|ref|NP_001012645.1| soluble guanylyl cyclase beta-3 [Apis mellifera] gi|59891395|dbj|BAD89804.1| soluble guanylyl cyclase beta-3 [Apis mellifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query112
FB|FBgn0038295 947 Gyc88E "Guanylyl cyclase at 88 0.625 0.073 0.7 2.3e-21
WB|WBGene000015321122 gcy-5 [Caenorhabditis elegans 0.866 0.086 0.471 2.4e-16
UNIPROTKB|G3N2S3421 NPR2 "Guanylate cyclase" [Bos 0.642 0.171 0.533 3.6e-16
UNIPROTKB|D4A6T4433 Gucy2g "Guanylate cyclase" [Ra 0.741 0.191 0.488 1.1e-15
WB|WBGene000015391028 gcy-13 [Caenorhabditis elegans 0.544 0.059 0.625 1.2e-15
FB|FBgn0051183 1417 CG31183 [Drosophila melanogast 0.553 0.043 0.625 1.3e-15
UNIPROTKB|F1PMN5851 NPR2 "Guanylate cyclase" [Cani 0.642 0.084 0.533 1.5e-15
FB|FBgn0038435667 Gyc-89Da "Guanylyl cyclase at 0.544 0.091 0.612 1.6e-15
UNIPROTKB|F1PPT9967 NPR2 "Guanylate cyclase" [Cani 0.642 0.074 0.533 1.8e-15
FB|FBgn00345681161 CG3216 [Drosophila melanogaste 0.669 0.064 0.5 1.8e-15
FB|FBgn0038295 Gyc88E "Guanylyl cyclase at 88E" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 262 (97.3 bits), Expect = 2.3e-21, P = 2.3e-21
 Identities = 49/70 (70%), Positives = 58/70 (82%)

Query:     1 MPRYCLFGDTVNTASRMESTSEPMKIHISENTKDLIPAEYRVSQRGEILIKGKGSMKTYW 60
             MPRYCLFGDTVNTASRMESTS  MK+HISE+TK LI   Y++ +RGEI +KGKG+M TYW
Sbjct:   532 MPRYCLFGDTVNTASRMESTSIAMKVHISESTKVLIGPNYKIIERGEIDVKGKGTMGTYW 591

Query:    61 LEQHDRRAPL 70
             LE+ + R PL
Sbjct:   592 LEERENRLPL 601




GO:0004383 "guanylate cyclase activity" evidence=ISS;IDA;NAS
GO:0008074 "guanylate cyclase complex, soluble" evidence=ISS;IDA
GO:0035556 "intracellular signal transduction" evidence=IEA
GO:0006182 "cGMP biosynthetic process" evidence=IC;IDA
GO:0000302 "response to reactive oxygen species" evidence=IDA
GO:0046982 "protein heterodimerization activity" evidence=IPI
GO:0006184 "GTP catabolic process" evidence=IDA
GO:0020037 "heme binding" evidence=IDA
GO:0070025 "carbon monoxide binding" evidence=IDA
GO:0070026 "nitric oxide binding" evidence=IDA
GO:0019825 "oxygen binding" evidence=IDA
GO:0042803 "protein homodimerization activity" evidence=IPI
GO:0019826 "oxygen sensor activity" evidence=IDA
GO:0001666 "response to hypoxia" evidence=IMP
WB|WBGene00001532 gcy-5 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|G3N2S3 NPR2 "Guanylate cyclase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|D4A6T4 Gucy2g "Guanylate cyclase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
WB|WBGene00001539 gcy-13 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
FB|FBgn0051183 CG31183 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1PMN5 NPR2 "Guanylate cyclase" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
FB|FBgn0038435 Gyc-89Da "Guanylyl cyclase at 89Da" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1PPT9 NPR2 "Guanylate cyclase" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
FB|FBgn0034568 CG3216 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8INF0GCY8E_DROME4, ., 6, ., 1, ., 20.70.6250.0739yesN/A
Q6VVW5ANPRB_MOUSE4, ., 6, ., 1, ., 20.53520.61600.0659yesN/A
P16067ANPRB_RAT4, ., 6, ., 1, ., 20.54920.60710.0649yesN/A
P20594ANPRB_HUMAN4, ., 6, ., 1, ., 20.54920.60710.0649yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query112
pfam00211184 pfam00211, Guanylate_cyc, Adenylate and Guanylate 4e-26
cd07302177 cd07302, CHD, cyclase homology domain 1e-23
smart00044194 smart00044, CYCc, Adenylyl- / guanylyl cyclase, ca 4e-18
COG2114227 COG2114, CyaA, Adenylate cyclase, family 3 (some p 4e-09
cd07556133 cd07556, Nucleotidyl_cyc_III, Class III nucleotidy 4e-06
>gnl|CDD|201086 pfam00211, Guanylate_cyc, Adenylate and Guanylate cyclase catalytic domain Back     alignment and domain information
 Score = 95.4 bits (238), Expect = 4e-26
 Identities = 34/64 (53%), Positives = 46/64 (71%), Gaps = 2/64 (3%)

Query: 1   MPRYCLFGDTVNTASRMESTSEPMKIHISENTKDLI--PAEYRVSQRGEILIKGKGSMKT 58
            PRY ++GDTVN ASRMEST  P KIH+SE T  L+    ++  ++RGE+ +KGKG M+T
Sbjct: 120 RPRYDVWGDTVNLASRMESTGVPGKIHVSEETYRLLKTREQFEFTERGEVEVKGKGKMET 179

Query: 59  YWLE 62
           Y+L 
Sbjct: 180 YFLN 183


Length = 184

>gnl|CDD|143636 cd07302, CHD, cyclase homology domain Back     alignment and domain information
>gnl|CDD|214485 smart00044, CYCc, Adenylyl- / guanylyl cyclase, catalytic domain Back     alignment and domain information
>gnl|CDD|225025 COG2114, CyaA, Adenylate cyclase, family 3 (some proteins contain HAMP domain) [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|143637 cd07556, Nucleotidyl_cyc_III, Class III nucleotidyl cyclases Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 112
KOG3619|consensus867 99.65
KOG4171|consensus671 99.6
PF00211184 Guanylate_cyc: Adenylate and Guanylate cyclase cat 99.52
KOG3618|consensus1318 99.42
KOG1023|consensus484 99.27
COG2114227 CyaA Adenylate cyclase, family 3 (some proteins co 99.26
cd07302177 CHD cyclase homology domain. Catalytic domains of 99.14
smart00044194 CYCc Adenylyl- / guanylyl cyclase, catalytic domai 98.51
KOG3618|consensus 1318 98.27
KOG3619|consensus 867 98.16
>KOG3619|consensus Back     alignment and domain information
Probab=99.65  E-value=1.1e-16  Score=132.80  Aligned_cols=62  Identities=45%  Similarity=0.805  Sum_probs=60.3

Q ss_pred             CCcccccCchHHHHHHHhccCCCCeEEECHHHHhhccC-cceEEEcceEEecCcCceEEEEEe
Q psy13613          1 MPRYCLFGDTVNTASRMESTSEPMKIHISENTKDLIPA-EYRVSQRGEILIKGKGSMKTYWLE   62 (112)
Q Consensus         1 ~~~y~v~Gd~VNiAsRLes~a~~~~I~vS~~t~~~l~~-~~~~~~~~~~~lkG~~~~~~~~l~   62 (112)
                      +||||+||+|||+||||+|.+.+|+|+||++|+..|.. +|.|..+|.+.+|||+++.||++.
T Consensus       779 KPqYDIWGNTVNvASRMdSTGv~g~IQVTEEt~~iL~~~gy~~~~RG~i~VKGkGel~Tyfl~  841 (867)
T KOG3619|consen  779 KPQYDIWGNTVNVASRMDSTGVPGRIQVTEETANILQGLGYRFECRGVINVKGKGELETYFLC  841 (867)
T ss_pred             CCCccccccchhhhhcccccCCCCeEEecHHHHHHHhcCCeeEEecceEEEecccceeEEEec
Confidence            79999999999999999999999999999999999977 899999999999999999999998



>KOG4171|consensus Back     alignment and domain information
>PF00211 Guanylate_cyc: Adenylate and Guanylate cyclase catalytic domain; InterPro: IPR001054 Guanylate cyclases (4 Back     alignment and domain information
>KOG3618|consensus Back     alignment and domain information
>KOG1023|consensus Back     alignment and domain information
>COG2114 CyaA Adenylate cyclase, family 3 (some proteins contain HAMP domain) [Signal transduction mechanisms] Back     alignment and domain information
>cd07302 CHD cyclase homology domain Back     alignment and domain information
>smart00044 CYCc Adenylyl- / guanylyl cyclase, catalytic domain Back     alignment and domain information
>KOG3618|consensus Back     alignment and domain information
>KOG3619|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query112
3et6_B190 The Crystal Structure Of The Catalytic Domain Of A 9e-14
3et6_A190 The Crystal Structure Of The Catalytic Domain Of A 1e-13
1yk9_A204 Crystal Structure Of A Mutant Form Of The Mycobacte 7e-10
1ab8_A220 Rat Type Ii Adenylyl Cyclase C2 DomainFORSKOLIN COM 2e-08
1cul_B208 Complex Of Gs-Alpha With The Catalytic Domains Of M 2e-08
1azs_B212 Complex Of Gs-Alpha With The Catalytic Domains Of M 2e-08
2wz1_A219 Structure Of The Catalytic Domain Of Human Soluble 5e-08
3uvj_B220 Crystal Structure Of The Catalytic Domain Of The He 9e-07
3uvj_A225 Crystal Structure Of The Catalytic Domain Of The He 3e-05
3r5g_A198 Crystal Structure Of The Adenylyl Cyclase Cyab From 7e-04
>pdb|3ET6|B Chain B, The Crystal Structure Of The Catalytic Domain Of A Eukaryotic Guanylate Cyclase Length = 190 Back     alignment and structure

Iteration: 1

Score = 72.0 bits (175), Expect = 9e-14, Method: Compositional matrix adjust. Identities = 35/68 (51%), Positives = 47/68 (69%), Gaps = 2/68 (2%) Query: 1 MPRYCLFGDTVNTASRMESTSEPMKIHISENTKDLIPAE--YRVSQRGEILIKGKGSMKT 58 MPR+ LFGDTVNTASRMES E +IHISE + ++ + + +RG I +KGKG+M+T Sbjct: 122 MPRFXLFGDTVNTASRMESHGEAGQIHISEACYXCLRSKERFEIRERGNITVKGKGTMRT 181 Query: 59 YWLEQHDR 66 Y L +R Sbjct: 182 YLLSPLER 189
>pdb|3ET6|A Chain A, The Crystal Structure Of The Catalytic Domain Of A Eukaryotic Guanylate Cyclase Length = 190 Back     alignment and structure
>pdb|1YK9|A Chain A, Crystal Structure Of A Mutant Form Of The Mycobacterial Adenylyl Cyclase Rv1625c Length = 204 Back     alignment and structure
>pdb|1AB8|A Chain A, Rat Type Ii Adenylyl Cyclase C2 DomainFORSKOLIN COMPLEX Length = 220 Back     alignment and structure
>pdb|1CUL|B Chain B, Complex Of Gs-Alpha With The Catalytic Domains Of Mammalian Adenylyl Cyclase: Complex With 2',5'-Dideoxy-Adenosine 3'- Triphosphate And Mg Length = 208 Back     alignment and structure
>pdb|1AZS|B Chain B, Complex Of Gs-Alpha With The Catalytic Domains Of Mammalian Adenylyl Cyclase Length = 212 Back     alignment and structure
>pdb|2WZ1|A Chain A, Structure Of The Catalytic Domain Of Human Soluble Guanylate Cyclase 1 Beta 3. Length = 219 Back     alignment and structure
>pdb|3UVJ|B Chain B, Crystal Structure Of The Catalytic Domain Of The Heterodimeric Human Soluble Guanylate Cyclase 1. Length = 220 Back     alignment and structure
>pdb|3UVJ|A Chain A, Crystal Structure Of The Catalytic Domain Of The Heterodimeric Human Soluble Guanylate Cyclase 1. Length = 225 Back     alignment and structure
>pdb|3R5G|A Chain A, Crystal Structure Of The Adenylyl Cyclase Cyab From P. Aeruginosa Length = 198 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query112
1yk9_A204 Adenylate cyclase; beta-alpha-beta sandwich, struc 2e-40
1ab8_A220 Adenylyl cyclase; lyase, complex (transferase-inhi 3e-38
2wz1_A219 Guanylate cyclase soluble subunit beta-1; lyase, G 5e-38
3uvj_A225 Guanylate cyclase soluble subunit alpha-3; nitric 1e-33
3et6_A190 Soluble guanylyl cyclase beta; guanylate cyclase, 8e-32
1azs_A220 VC1; complex (lyase/hydrolase), hydrolase, signal 2e-29
1y10_A407 Hypothetical protein RV1264/MT1302; adenylyl cycla 1e-21
1fx2_A235 Receptor-type adenylate cyclase gresag 4.1; CAMP, 1e-18
1ybt_A184 Hydrolase, alpha/beta hydrolase fold family; cycla 6e-13
2w01_A208 Adenylate cyclase; guanylyl cyclase, class III nuc 1e-12
3r5g_A198 CYAB; adenylyl cyclase, lyase; 1.50A {Pseudomonas 1e-12
3mr7_A189 Adenylate/guanylate cyclase/hydrolase, alpha/beta 8e-11
1wc3_A219 Adenylate cyclase; soluble adenylyl cyclase, CAMP 2e-10
>1yk9_A Adenylate cyclase; beta-alpha-beta sandwich, structural genomics, PSI, protein structure initiative; 2.70A {Mycobacterium tuberculosis} Length = 204 Back     alignment and structure
 Score =  132 bits (334), Expect = 2e-40
 Identities = 27/83 (32%), Positives = 44/83 (53%)

Query: 1   MPRYCLFGDTVNTASRMESTSEPMKIHISENTKDLIPAEYRVSQRGEILIKGKGSMKTYW 60
             RYC++GD VN ASRMEST    +I + +   + +  ++ + +RG I +KGKG M+T++
Sbjct: 122 RFRYCVWGDAVNVASRMESTDSVGQIQVPDEVYERLKDDFVLRERGHINVKGKGVMRTWY 181

Query: 61  LEQHDRRAPLSRLCTVPPSYPEL 83
           L      A    +    P    +
Sbjct: 182 LIGRKVAADPGEVRGAEPRTAGV 204


>1ab8_A Adenylyl cyclase; lyase, complex (transferase-inhibitor); HET: FOK; 2.20A {Rattus norvegicus} SCOP: d.58.29.1 PDB: 1azs_B* 1cjk_B* 1cjt_B* 1cju_B* 1cjv_B* 1cs4_B* 1tl7_B* 1u0h_B* 2gvd_B* 2gvz_B* 3c14_B* 3c15_B* 3c16_B* 3e8a_B* 3g82_B* 3maa_B* 1cul_B* Length = 220 Back     alignment and structure
>2wz1_A Guanylate cyclase soluble subunit beta-1; lyase, GUCY1, metal-binding, CGMP biosynthesis, nucleotide-B cyclase, GUCY1B3, GTP-binding; 1.63A {Homo sapiens} PDB: 3uvj_B Length = 219 Back     alignment and structure
>3uvj_A Guanylate cyclase soluble subunit alpha-3; nitric oxide, structural genomics, structural genomics conso SGC, CGMP biosynthesis; 2.08A {Homo sapiens} Length = 225 Back     alignment and structure
>3et6_A Soluble guanylyl cyclase beta; guanylate cyclase, dimethylarsenic, lyase, membrane, transmembrane; 2.55A {Chlamydomonas reinhardtii} PDB: 3et6_B Length = 190 Back     alignment and structure
>1azs_A VC1; complex (lyase/hydrolase), hydrolase, signal transducing protein, cyclase, effector enzyme; HET: GSP FKP; 2.30A {Canis lupus familiaris} SCOP: d.58.29.1 PDB: 1cs4_A* 1u0h_A* 2gvd_A* 2gvz_A* 3c14_A* 3c15_A* 3c16_A* 3e8a_A* 3g82_A* 3maa_A* 1cul_A* 1cjk_A* 1cju_A* 1cjv_A* 1cjt_A* 1tl7_A* Length = 220 Back     alignment and structure
>1y10_A Hypothetical protein RV1264/MT1302; adenylyl cyclase fold, lyase; HET: 1PE; 2.30A {Mycobacterium tuberculosis} PDB: 1y11_A* Length = 407 Back     alignment and structure
>1fx2_A Receptor-type adenylate cyclase gresag 4.1; CAMP, trypanosomes, adenylyl cyclases, monomer-dimer, catalysis, lyase; 1.46A {Trypanosoma brucei} SCOP: d.58.29.1 PDB: 1fx4_A Length = 235 Back     alignment and structure
>1ybt_A Hydrolase, alpha/beta hydrolase fold family; cyclase homology domain, CHD, RV1900C; 2.31A {Mycobacterium tuberculosis} PDB: 1ybu_A* Length = 184 Back     alignment and structure
>2w01_A Adenylate cyclase; guanylyl cyclase, class III nucleotidyl cyclase, lyase; 2.31A {Synechocystis SP} Length = 208 Back     alignment and structure
>3r5g_A CYAB; adenylyl cyclase, lyase; 1.50A {Pseudomonas aeruginosa} Length = 198 Back     alignment and structure
>3mr7_A Adenylate/guanylate cyclase/hydrolase, alpha/beta family; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; 2.60A {Ruegeria pomeroyi} Length = 189 Back     alignment and structure
>1wc3_A Adenylate cyclase; soluble adenylyl cyclase, CAMP signaling, lyase; HET: APC; 1.9A {Spirulina platensis} SCOP: d.58.29.1 PDB: 1wc0_A* 1wc4_A* 1wc5_A* 2bw7_A* 1wc1_A* 1wc6_A* Length = 219 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query112
1ab8_A220 Adenylyl cyclase; lyase, complex (transferase-inhi 99.6
2wz1_A219 Guanylate cyclase soluble subunit beta-1; lyase, G 99.59
3et6_A190 Soluble guanylyl cyclase beta; guanylate cyclase, 99.59
1yk9_A204 Adenylate cyclase; beta-alpha-beta sandwich, struc 99.59
3r5g_A198 CYAB; adenylyl cyclase, lyase; 1.50A {Pseudomonas 99.56
2w01_A208 Adenylate cyclase; guanylyl cyclase, class III nuc 99.55
1fx2_A235 Receptor-type adenylate cyclase gresag 4.1; CAMP, 99.54
3mr7_A189 Adenylate/guanylate cyclase/hydrolase, alpha/beta 99.51
1ybt_A184 Hydrolase, alpha/beta hydrolase fold family; cycla 99.5
1y10_A407 Hypothetical protein RV1264/MT1302; adenylyl cycla 99.48
1wc3_A219 Adenylate cyclase; soluble adenylyl cyclase, CAMP 99.47
1azs_A220 VC1; complex (lyase/hydrolase), hydrolase, signal 99.43
3uvj_A225 Guanylate cyclase soluble subunit alpha-3; nitric 99.42
>1ab8_A Adenylyl cyclase; lyase, complex (transferase-inhibitor); HET: FOK; 2.20A {Rattus norvegicus} SCOP: d.58.29.1 PDB: 1azs_B* 1cjk_B* 1cjt_B* 1cju_B* 1cjv_B* 1cs4_B* 1tl7_B* 1u0h_B* 2gvd_B* 2gvz_B* 3c14_B* 3c15_B* 3c16_B* 3e8a_B* 3g82_B* 3maa_B* 1cul_B* Back     alignment and structure
Probab=99.60  E-value=1.1e-16  Score=114.00  Aligned_cols=66  Identities=41%  Similarity=0.667  Sum_probs=44.2

Q ss_pred             CCcccccCchHHHHHHHhccCCCCeEEECHHHHhhccC-cceEEEcceEEecCcCceEEEEEeeeCC
Q psy13613          1 MPRYCLFGDTVNTASRMESTSEPMKIHISENTKDLIPA-EYRVSQRGEILIKGKGSMKTYWLEQHDR   66 (112)
Q Consensus         1 ~~~y~v~Gd~VNiAsRLes~a~~~~I~vS~~t~~~l~~-~~~~~~~~~~~lkG~~~~~~~~l~~~~~   66 (112)
                      +|+||+||++||+|+|||+.+++++|+||++|++.+.+ .|.++++|.+.+||++.+.+|++.....
T Consensus       144 r~~y~v~Gd~VN~AaRle~~a~~g~I~vS~~~~~~l~~~~~~~~~~g~~~lKG~~~~~~~~~~~~~~  210 (220)
T 1ab8_A          144 KPQYDIWGNTVNVASRMDSTGVLDKIQVTEETSLILQTLGYTCTCRGIINVKGKGDLKTYFVNTEMS  210 (220)
T ss_dssp             SCEEEEESHHHHHHHHHHHTCCTTCEEECHHHHHHHHHHTCCCCC---------------CCC----
T ss_pred             ceeEEEECcHHHHHHHHHhcCCCCeEEECHHHHHHhhcCceEEEEeccEEecCCCceEEEEEecccC
Confidence            47899999999999999999999999999999999987 6999999999999999998888765543



>2wz1_A Guanylate cyclase soluble subunit beta-1; lyase, GUCY1, metal-binding, CGMP biosynthesis, nucleotide-B cyclase, GUCY1B3, GTP-binding; 1.63A {Homo sapiens} PDB: 3uvj_B Back     alignment and structure
>3et6_A Soluble guanylyl cyclase beta; guanylate cyclase, dimethylarsenic, lyase, membrane, transmembrane; 2.55A {Chlamydomonas reinhardtii} PDB: 3et6_B Back     alignment and structure
>1yk9_A Adenylate cyclase; beta-alpha-beta sandwich, structural genomics, PSI, protein structure initiative; 2.70A {Mycobacterium tuberculosis} Back     alignment and structure
>3r5g_A CYAB; adenylyl cyclase, lyase; 1.50A {Pseudomonas aeruginosa} SCOP: d.58.29.0 Back     alignment and structure
>2w01_A Adenylate cyclase; guanylyl cyclase, class III nucleotidyl cyclase, lyase; 2.31A {Synechocystis SP} Back     alignment and structure
>1fx2_A Receptor-type adenylate cyclase gresag 4.1; CAMP, trypanosomes, adenylyl cyclases, monomer-dimer, catalysis, lyase; 1.46A {Trypanosoma brucei} SCOP: d.58.29.1 PDB: 1fx4_A Back     alignment and structure
>3mr7_A Adenylate/guanylate cyclase/hydrolase, alpha/beta family; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; 2.60A {Ruegeria pomeroyi} Back     alignment and structure
>1ybt_A Hydrolase, alpha/beta hydrolase fold family; cyclase homology domain, CHD, RV1900C; 2.31A {Mycobacterium tuberculosis} PDB: 1ybu_A* Back     alignment and structure
>1y10_A Hypothetical protein RV1264/MT1302; adenylyl cyclase fold, lyase; HET: 1PE; 2.30A {Mycobacterium tuberculosis} PDB: 1y11_A* Back     alignment and structure
>1wc3_A Adenylate cyclase; soluble adenylyl cyclase, CAMP signaling, lyase; HET: APC; 1.9A {Spirulina platensis} SCOP: d.58.29.1 PDB: 1wc0_A* 1wc4_A* 1wc5_A* 2bw7_A* 1wc1_A* 1wc6_A* Back     alignment and structure
>1azs_A VC1; complex (lyase/hydrolase), hydrolase, signal transducing protein, cyclase, effector enzyme; HET: GSP FKP; 2.30A {Canis lupus familiaris} SCOP: d.58.29.1 PDB: 1cs4_A* 1u0h_A* 2gvd_A* 2gvz_A* 3c14_A* 3c15_A* 3c16_A* 3e8a_A* 3g82_A* 3maa_A* 1cul_A* 1cjk_A* 1cju_A* 1cjv_A* 1cjt_A* 1tl7_A* Back     alignment and structure
>3uvj_A Guanylate cyclase soluble subunit alpha-3; nitric oxide, structural genomics, structural genomics conso SGC, CGMP biosynthesis; 2.08A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 112
d1azsb_199 d.58.29.1 (B:) Adenylyl cyclase IIC1, domain C2a { 2e-21
d1azsa_190 d.58.29.1 (A:) Adenylyl cyclase VC1, domain C1a {D 5e-15
d1fx2a_235 d.58.29.1 (A:) Receptor-type monomeric adenylyl cy 2e-12
d1wc1a_197 d.58.29.1 (A:) Adenylate cyclase CyaC {Spirulina p 1e-11
>d1azsb_ d.58.29.1 (B:) Adenylyl cyclase IIC1, domain C2a {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 199 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: Nucleotide cyclase
family: Adenylyl and guanylyl cyclase catalytic domain
domain: Adenylyl cyclase IIC1, domain C2a
species: Rat (Rattus norvegicus) [TaxId: 10116]
 Score = 82.3 bits (202), Expect = 2e-21
 Identities = 27/62 (43%), Positives = 41/62 (66%), Gaps = 1/62 (1%)

Query: 1   MPRYCLFGDTVNTASRMESTSEPMKIHISENTKDLIP-AEYRVSQRGEILIKGKGSMKTY 59
            P+Y ++G+TVN ASRM+ST    KI ++E T  ++    Y  + RG I +KGKG +KTY
Sbjct: 136 KPQYDIWGNTVNVASRMDSTGVLDKIQVTEETSLILQTLGYTCTCRGIINVKGKGDLKTY 195

Query: 60  WL 61
           ++
Sbjct: 196 FV 197


>d1azsa_ d.58.29.1 (A:) Adenylyl cyclase VC1, domain C1a {Dog (Canis familiaris) [TaxId: 9615]} Length = 190 Back     information, alignment and structure
>d1fx2a_ d.58.29.1 (A:) Receptor-type monomeric adenylyl cyclase {Trypanosome (Trypanosoma brucei), different isoform [TaxId: 5691]} Length = 235 Back     information, alignment and structure
>d1wc1a_ d.58.29.1 (A:) Adenylate cyclase CyaC {Spirulina platensis [TaxId: 118562]} Length = 197 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query112
d1azsb_199 Adenylyl cyclase IIC1, domain C2a {Rat (Rattus nor 99.67
d1wc1a_197 Adenylate cyclase CyaC {Spirulina platensis [TaxId 99.5
d1azsa_190 Adenylyl cyclase VC1, domain C1a {Dog (Canis famil 99.46
d1fx2a_235 Receptor-type monomeric adenylyl cyclase {Trypanos 99.43
>d1azsb_ d.58.29.1 (B:) Adenylyl cyclase IIC1, domain C2a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: Nucleotide cyclase
family: Adenylyl and guanylyl cyclase catalytic domain
domain: Adenylyl cyclase IIC1, domain C2a
species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=99.67  E-value=1.7e-17  Score=115.17  Aligned_cols=62  Identities=44%  Similarity=0.725  Sum_probs=58.7

Q ss_pred             CCcccccCchHHHHHHHhccCCCCeEEECHHHHhhccC-cceEEEcceEEecCcCceEEEEEe
Q psy13613          1 MPRYCLFGDTVNTASRMESTSEPMKIHISENTKDLIPA-EYRVSQRGEILIKGKGSMKTYWLE   62 (112)
Q Consensus         1 ~~~y~v~Gd~VNiAsRLes~a~~~~I~vS~~t~~~l~~-~~~~~~~~~~~lkG~~~~~~~~l~   62 (112)
                      +|+||+|||+||+|+|||+.+++++|+||++|++.+.+ .|.++++|.+.+||++.+.+|+|.
T Consensus       136 ~~~y~v~Gd~VN~AaRle~~a~~g~I~vS~~t~~~l~~~~~~~~~~g~i~vKGkg~~~ty~l~  198 (199)
T d1azsb_         136 KPQYDIWGNTVNVASRMDSTGVLDKIQVTEETSLILQTLGYTCTCRGIINVKGKGDLKTYFVN  198 (199)
T ss_dssp             SCEEEEESHHHHHHHHHHHTCCTTEEEEEHHHHHHHHHTTCCEEEEEEEEETTTEEEEEEEEC
T ss_pred             cccccccchHHHHHHHHHhcCCCCeEEECHHHHHHHhcCCeEEEEeCCEEecCCCeEEEEEEe
Confidence            58999999999999999999999999999999999977 699999999999999999999985



>d1wc1a_ d.58.29.1 (A:) Adenylate cyclase CyaC {Spirulina platensis [TaxId: 118562]} Back     information, alignment and structure
>d1azsa_ d.58.29.1 (A:) Adenylyl cyclase VC1, domain C1a {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1fx2a_ d.58.29.1 (A:) Receptor-type monomeric adenylyl cyclase {Trypanosome (Trypanosoma brucei), different isoform [TaxId: 5691]} Back     information, alignment and structure