Psyllid ID: psy13634

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240--
MLWSDWGAGNGGTIERSALDGTQRSVLLHKVKANSLTVNYDEKRVYYVNLLSSSIESIDIEGRNKITIVANIEDKPVTLTLYKSEIFYSNWDKRSIEKYDKTSHTRSVIYRSSEKEINDMLIYHPSRQTGWNKCAVANNECDYLCLATPGRGGGLNYKCECPTHYTMVNGTCMAPSSFLIYAQRNILSRLITDPTQCPDSPYEIPNVKNIKALDYDPVARQIYWIDSKLQAIKRASENATRI
cEEEEccccccccEEEEcccccccEEEEccccccEEEEEccccEEEEEEcccccEEEEEcccccEEEEEcccccccEEEEEEccEEEEEEcccccEEEEEccccccEEEEEcccccEEEEEEEcccccccccccccccccccccccccccccccccccccccccEEEcccccccccccEEEEEEccEEEEEccccccccccccccccccEEEEEEEccccEEEEEEccccEEEEEEcccccc
ccEccccccccccEEEEEcccccEEEEEEcccccEEEEEcccccEEEEEccccEEEEEEEcccccEEEEEcccccccEEEEEccEEEEEccccccEEEEEccccccEEEEEccccccccEEEEccccccccccccccccccccEEEEcccccccccEEEEccccEEEccccccccccEEEEEEcccccEEEccccccccEEEEccccccEEEEEEEccccEEEEEEccccEEEEEEcccccc
mlwsdwgagnggtiersaldgtqRSVLLHKVKansltvnydekRVYYVNLLSSSiesidiegrnkITIVaniedkpvtlTLYKSeifysnwdkrsiekydktshtrsvIYRSSEKEINDMLiyhpsrqtgwnkcavannecdylclatpgrggglnykcecpthytmvngtcmapsSFLIYAQRNILSRlitdptqcpdspyeipnvknikaldydpvarQIYWIDSKLQAIKRASENATRI
mlwsdwgagnggtiersaldgtqrSVLLHkvkansltvnydekrVYYVNLLSssiesidiegrnkitivaniedkpvtltLYKSeifysnwdkrsiekydktshtrsviyrssekeiNDMLIYHPSRQTGWNKCAVANNECDYLCLATPGRGGGLNYKCECPTHYTMVNGTCMAPSSFLIYAQRNILSRLITDPTqcpdspyeipnvknikaldyDPVARQIYWIDSKLQAIKRASENATRI
MLWSDWGAGNGGTIERSALDGTQRSVLLHKVKANSLTVNYDEKRVYYVNLLsssiesidieGRNKITIVANIEDKPVTLTLYKSEIFYSNWDKRSIEKYDKTSHTRSVIYRSSEKEINDMLIYHPSRQTGWNKCAVANNECDYLCLATPGRGGGLNYKCECPTHYTMVNGTCMAPSSFLIYAQRNILSRLITDPTQCPDSPYEIPNVKNIKALDYDPVARQIYWIDSKLQAIKRASENATRI
******************LDGTQRSVLLHKVKANSLTVNYDEKRVYYVNLLSSSIESIDIEGRNKITIVANIEDKPVTLTLYKSEIFYSNWDKRSIEKYDKTSHTRSVIYRSSEKEINDMLIYHPSRQTGWNKCAVANNECDYLCLATPGRGGGLNYKCECPTHYTMVNGTCMAPSSFLIYAQRNILSRLITDPTQCPDSPYEIPNVKNIKALDYDPVARQIYWIDSKLQA***********
MLWSDWGAGNGGTIERSALDGTQRSVLLHKVKANSLTVNYDEKRVYYVNLLSSSIESIDIEGRNKITIVANIEDKPVTLTLYKSEIFYSNWDKRSIEKYDKTSHT*SVIYRSSEKEINDMLIYHPSRQTGWNKCAVANNECDYLCLATPGRGGGLNYKCECPTHYTMVNGTCMAPSSFLIYAQRNILSRLITDPTQCPDSPYEIPNVKNIKALDYDPVARQIYWIDSKLQAIKRASENAT**
MLWSDWGAGNGGTIERSALDGTQRSVLLHKVKANSLTVNYDEKRVYYVNLLSSSIESIDIEGRNKITIVANIEDKPVTLTLYKSEIFYSNWDKRSIEKYDKTSHTRSVIYRSSEKEINDMLIYHPSRQTGWNKCAVANNECDYLCLATPGRGGGLNYKCECPTHYTMVNGTCMAPSSFLIYAQRNILSRLITDPTQCPDSPYEIPNVKNIKALDYDPVARQIYWIDSKLQAIK*********
MLWSDWGAGNGGTIERSALDGTQRSVLLHKVKANSLTVNYDEKRVYYVNLLSSSIESIDIEGRNKITIVANIEDKPVTLTLYKSEIFYSNWDKRSIEKYDKTSHTRSVIYRSSEKEINDMLIYHPSRQTGWNKCAVANNECDYLCLATPGRGGGLNYKCECPTHYTMVNGTCMAPSSFLIYAQRNILSRLITDPTQCPDSPYEIPNVKNIKALDYDPVARQIYWIDSKLQAIKRASEN****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLWSDWGAGNGGTIERSALDGTQRSVLLHKVKANSLTVNYDEKRVYYVNLLSSSIESIDIEGRNKITIVANIEDKPVTLTLYKSEIFYSNWDKRSIEKYDKTSHTRSVIYRSSEKEINDMLIYHPSRQTGWNKCAVANNECDYLCLATPGRGGGLNYKCECPTHYTMVNGTCMAPSSFLIYAQRNILSRLITDPTQCPDSPYEIPNVKNIKALDYDPVARQIYWIDSKLQAIKRASENATRI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query242 2.2.26 [Sep-21-2011]
O88572 1613 Low-density lipoprotein r yes N/A 0.958 0.143 0.392 2e-51
O75581 1613 Low-density lipoprotein r yes N/A 0.966 0.145 0.381 9e-51
O75197 1615 Low-density lipoprotein r no N/A 0.950 0.142 0.359 2e-42
Q91VN0 1614 Low-density lipoprotein r no N/A 0.950 0.142 0.359 2e-41
O75096 1905 Low-density lipoprotein r no N/A 0.966 0.122 0.307 3e-31
Q9QYP1 1905 Low-density lipoprotein r no N/A 0.966 0.122 0.303 1e-30
Q8VI56 1905 Low-density lipoprotein r no N/A 0.966 0.122 0.303 1e-30
Q9NZR2 4599 Low-density lipoprotein r no N/A 0.975 0.051 0.309 1e-25
Q9JI18 4599 Low-density lipoprotein r no N/A 0.975 0.051 0.305 6e-25
P98157 4543 Low-density lipoprotein r no N/A 0.975 0.051 0.309 2e-24
>sp|O88572|LRP6_MOUSE Low-density lipoprotein receptor-related protein 6 OS=Mus musculus GN=Lrp6 PE=1 SV=1 Back     alignment and function desciption
 Score =  202 bits (513), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 95/242 (39%), Positives = 162/242 (66%), Gaps = 10/242 (4%)

Query: 1   MLWSDWGAGNGGTIERSALDGTQRSVLLHKV-KANSLTVNYDEKRVYYVNLLSSSIESID 59
           M W++WG      I+R+A+DG++R+ L+  V +AN LT++Y ++R+Y+ +L ++ IES D
Sbjct: 762 MYWTEWGGKP--KIDRAAMDGSERTTLVPNVGRANGLTIDYAKRRLYWTDLDTNLIESSD 819

Query: 60  IEGRNKITIVANIEDKPVTLTLYKSEIFYSNWDKRSIEKYDKTSHTRSVIYRSSEKEIND 119
           + G N+  ++A+    P  LT Y+  I++++W +RSIE+ +KTS     I +     + D
Sbjct: 820 MLGLNR-EVIADDLPHPFGLTQYQDYIYWTDWSRRSIERANKTSGQNRTIIQGHLDYVMD 878

Query: 120 MLIYHPSRQTGWNKCAVANNECDYLCLATPGRGGGLNYKCECPTHYTM--VNGTCMAPSS 177
           +L++H SRQ GWN+CA +N  C +LCLA P  G    + C CP HY++   N TC APS+
Sbjct: 879 ILVFHSSRQAGWNECASSNGHCSHLCLAVPVGG----FVCGCPAHYSLNADNRTCSAPST 934

Query: 178 FLIYAQRNILSRLITDPTQCPDSPYEIPNVKNIKALDYDPVARQIYWIDSKLQAIKRASE 237
           FL+++Q++ ++R++ D  Q PD    I +++N++A+DYDP+ +Q+YWIDS+  +I++A E
Sbjct: 935 FLLFSQKSAINRMVIDEQQSPDIILPIHSLRNVRAIDYDPLDKQLYWIDSRQNSIRKAHE 994

Query: 238 NA 239
           + 
Sbjct: 995 DG 996
Component of the Wnt-Fzd-LRP5-LRP6 complex that triggers beta-catenin signaling through inducing aggregation of receptor-ligand complexes into ribosome-sized signalsomes. Cell-surface coreceptor of Wnt/beta-catenin signaling, which plays a pivotal role in bone formation. The Wnt-induced Fzd/LRP6 coreceptor complex recruits DVL1 polymers to the plasma membrane which, in turn, recruits the AXIN1/GSK3B-complex to the cell surface promoting the formation of signalsomes and inhibiting AXIN1/GSK3-mediated phosphorylation and destruction of beta-catenin. Required for posterior patterning of the epiblast during gastrulation.
Mus musculus (taxid: 10090)
>sp|O75581|LRP6_HUMAN Low-density lipoprotein receptor-related protein 6 OS=Homo sapiens GN=LRP6 PE=1 SV=2 Back     alignment and function description
>sp|O75197|LRP5_HUMAN Low-density lipoprotein receptor-related protein 5 OS=Homo sapiens GN=LRP5 PE=1 SV=2 Back     alignment and function description
>sp|Q91VN0|LRP5_MOUSE Low-density lipoprotein receptor-related protein 5 OS=Mus musculus GN=Lrp5 PE=1 SV=3 Back     alignment and function description
>sp|O75096|LRP4_HUMAN Low-density lipoprotein receptor-related protein 4 OS=Homo sapiens GN=LRP4 PE=1 SV=4 Back     alignment and function description
>sp|Q9QYP1|LRP4_RAT Low-density lipoprotein receptor-related protein 4 OS=Rattus norvegicus GN=Lrp4 PE=1 SV=2 Back     alignment and function description
>sp|Q8VI56|LRP4_MOUSE Low-density lipoprotein receptor-related protein 4 OS=Mus musculus GN=Lrp4 PE=1 SV=3 Back     alignment and function description
>sp|Q9NZR2|LRP1B_HUMAN Low-density lipoprotein receptor-related protein 1B OS=Homo sapiens GN=LRP1B PE=1 SV=2 Back     alignment and function description
>sp|Q9JI18|LRP1B_MOUSE Low-density lipoprotein receptor-related protein 1B OS=Mus musculus GN=Lrp1b PE=2 SV=1 Back     alignment and function description
>sp|P98157|LRP1_CHICK Low-density lipoprotein receptor-related protein 1 OS=Gallus gallus GN=LRP1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query242
147906208 1613 low density lipoprotein receptor-related 0.962 0.144 0.405 6e-51
383857988 1606 PREDICTED: low-density lipoprotein recep 0.987 0.148 0.378 1e-50
340727334 1606 PREDICTED: low-density lipoprotein recep 0.983 0.148 0.371 3e-50
301627062 1574 PREDICTED: low-density lipoprotein recep 0.962 0.148 0.401 3e-50
47117045 1613 RecName: Full=Low-density lipoprotein re 0.958 0.143 0.392 1e-49
345322054 1502 PREDICTED: low-density lipoprotein recep 0.966 0.155 0.385 1e-49
126340141 1653 PREDICTED: low-density lipoprotein recep 0.966 0.141 0.385 1e-49
417406635 1613 Putative low-density lipoprotein recepto 0.966 0.145 0.389 1e-49
350422992 1606 PREDICTED: low-density lipoprotein recep 0.983 0.148 0.367 1e-49
380023251 1606 PREDICTED: LOW QUALITY PROTEIN: low-dens 0.987 0.148 0.361 1e-49
>gi|147906208|ref|NP_001079233.1| low density lipoprotein receptor-related protein 6 precursor [Xenopus laevis] gi|22854904|gb|AAN09807.1| lipoprotein receptor-related protein 6 [Xenopus laevis] Back     alignment and taxonomy information
 Score =  206 bits (525), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 99/244 (40%), Positives = 165/244 (67%), Gaps = 11/244 (4%)

Query: 1   MLWSDWGAGNGGTIERSALDGTQRSVLLHKV-KANSLTVNYDEKRVYYVNLLSSSIESID 59
           M W++WG      I+R+A+DG+ R  L+  V +AN LT++Y E+R+Y+ +L ++ IES +
Sbjct: 762 MYWTEWGGKP--KIDRTAMDGSGRITLVPDVGRANGLTIDYAERRLYWTDLDTNLIESSN 819

Query: 60  IEGRNKITIVANIEDKPVTLTLYKSEIFYSNWDKRSIEKYDKTSHTRSVIYRSSEKEIND 119
           + G +++ I  ++   P  LT Y+  I++++W +RSIE+ +KTS    ++ ++    + D
Sbjct: 820 MLGLDRVVIADDLP-HPFGLTQYQDYIYWTDWSRRSIERANKTSGQNRIMIQNDLDYVMD 878

Query: 120 MLIYHPSRQTGWNKCAVANNECDYLCLATPGRGGGLNYKCECPTHYTM--VNGTCMAPSS 177
           +L++H SRQ GWN+CA +N  C +LCLATP  G    Y C CP H+++   N TC APSS
Sbjct: 879 ILVFHSSRQAGWNECASSNGHCSHLCLATPISG----YTCGCPVHHSLNTDNKTCSAPSS 934

Query: 178 FLIYAQRNILSRLITDPTQCPDSPYEIPNVKNIKALDYDPVARQIYWIDSKLQAIKRASE 237
           FL+++Q+N ++R++ D  Q PD    I N++N++A+DYDP+ +Q+YWIDS+ Q I+RA E
Sbjct: 935 FLLFSQKNAINRMVIDGQQSPDIILPIHNLRNVRAIDYDPLEKQLYWIDSR-QNIRRAQE 993

Query: 238 NATR 241
           + ++
Sbjct: 994 DGSQ 997

Source: Xenopus laevis

Species: Xenopus laevis

Genus: Xenopus

Family: Pipidae

Order: Anura

Class: Amphibia

Phylum: Chordata

Superkingdom: Eukaryota
>gi|383857988|ref|XP_003704485.1| PREDICTED: low-density lipoprotein receptor-related protein 6 [Megachile rotundata] Back     alignment and taxonomy information
>gi|340727334|ref|XP_003402001.1| PREDICTED: low-density lipoprotein receptor-related protein 6-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|301627062|ref|XP_002942697.1| PREDICTED: low-density lipoprotein receptor-related protein 6-like [Xenopus (Silurana) tropicalis] Back     alignment and taxonomy information
>gi|47117045|sp|O88572.1|LRP6_MOUSE RecName: Full=Low-density lipoprotein receptor-related protein 6; Short=LRP-6; Flags: Precursor gi|3462529|gb|AAC33007.1| LDL receptor-related protein 6 [Mus musculus] Back     alignment and taxonomy information
>gi|345322054|ref|XP_001508455.2| PREDICTED: low-density lipoprotein receptor-related protein 6 [Ornithorhynchus anatinus] Back     alignment and taxonomy information
>gi|126340141|ref|XP_001371673.1| PREDICTED: low-density lipoprotein receptor-related protein 6 [Monodelphis domestica] Back     alignment and taxonomy information
>gi|417406635|gb|JAA49967.1| Putative low-density lipoprotein receptor-related protein 6 isoform 1 [Desmodus rotundus] Back     alignment and taxonomy information
>gi|350422992|ref|XP_003493352.1| PREDICTED: low-density lipoprotein receptor-related protein 6-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|380023251|ref|XP_003695438.1| PREDICTED: LOW QUALITY PROTEIN: low-density lipoprotein receptor-related protein 6-like [Apis florea] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query242
UNIPROTKB|H0YGW5 1478 LRP6 "Low-density lipoprotein 0.966 0.158 0.377 7e-47
MGI|MGI:1298218 1613 Lrp6 "low density lipoprotein 0.954 0.143 0.385 7.4e-47
UNIPROTKB|F5H7J9 1568 LRP6 "Low-density lipoprotein 0.966 0.149 0.377 8.6e-47
UNIPROTKB|F1SQ65 1470 LRP6 "Uncharacterized protein" 0.966 0.159 0.377 8.8e-47
UNIPROTKB|O75581 1613 LRP6 "Low-density lipoprotein 0.966 0.145 0.377 9.5e-47
UNIPROTKB|F1MDE1 1604 LRP6 "Uncharacterized protein" 0.966 0.145 0.377 1.2e-46
UNIPROTKB|F1PCS0 1613 LRP6 "Uncharacterized protein" 0.966 0.145 0.377 1.2e-46
RGD|1304749 1595 Lrp6 "low density lipoprotein 0.954 0.144 0.381 1.9e-46
ZFIN|ZDB-GENE-090821-1 1620 lrp6 "low-density lipoprotein 0.966 0.144 0.372 1.1e-45
UNIPROTKB|F1NWV6 1607 LRP6 "Uncharacterized protein" 0.966 0.145 0.369 5.4e-44
UNIPROTKB|H0YGW5 LRP6 "Low-density lipoprotein receptor-related protein 6" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 494 (179.0 bits), Expect = 7.0e-47, Sum P(2) = 7.0e-47
 Identities = 92/244 (37%), Positives = 159/244 (65%)

Query:     1 MLWSDWGAGNGGTIERSALDGTQRSVLLHKV-KANSLTVNYDEKRVYYVNLLXXXXXXXX 59
             M W++WG G    I+R+A+DG++R+ L+  V +AN LT++Y ++R+Y+ +L         
Sbjct:   627 MYWTEWG-GKP-KIDRAAMDGSERTTLVPNVGRANGLTIDYAKRRLYWTDLDTNLIESSN 684

Query:    60 XXGRNKITIVANIEDKPVTLTLYKSEIFYSNWDKRSIEKYDKTSHTRSVIYRSSEKEIND 119
               G N+  ++A+    P  LT Y+  I++++W +RSIE+ +KTS     I +     + D
Sbjct:   685 MLGLNR-EVIADDLPHPFGLTQYQDYIYWTDWSRRSIERANKTSGQNRTIIQGHLDYVMD 743

Query:   120 MLIYHPSRQTGWNKCAVANNECDYLCLATPGRGGGLNYKCECPTHYTMV--NGTCMAPSS 177
             +L++H SRQ+GWN+CA +N  C +LCLA P  GG   + C CP HY++   N TC AP++
Sbjct:   744 ILVFHSSRQSGWNECASSNGHCSHLCLAVPV-GG---FVCGCPAHYSLNADNRTCSAPTT 799

Query:   178 FLIYAQRNILSRLITDPTQCPDSPYEIPNVKNIKALDYDPVARQIYWIDSKLQAIKRASE 237
             FL+++Q++ ++R++ D  Q PD    I +++N++A+DYDP+ +Q+YWIDS+   I++A E
Sbjct:   800 FLLFSQKSAINRMVIDEQQSPDIILPIHSLRNVRAIDYDPLDKQLYWIDSRQNMIRKAQE 859

Query:   238 NATR 241
             + ++
Sbjct:   860 DGSQ 863
GO:0016021 "integral to membrane" evidence=IEA
MGI|MGI:1298218 Lrp6 "low density lipoprotein receptor-related protein 6" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F5H7J9 LRP6 "Low-density lipoprotein receptor-related protein 6" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SQ65 LRP6 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|O75581 LRP6 "Low-density lipoprotein receptor-related protein 6" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1MDE1 LRP6 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PCS0 LRP6 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|1304749 Lrp6 "low density lipoprotein receptor-related protein 6" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-090821-1 lrp6 "low-density lipoprotein receptor-related protein 6" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NWV6 LRP6 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query242
smart0013543 smart00135, LY, Low-density lipoprotein-receptor Y 8e-04
>gnl|CDD|214531 smart00135, LY, Low-density lipoprotein-receptor YWTD domain Back     alignment and domain information 
 Score = 36.0 bits (84), Expect = 8e-04
 Identities = 8/31 (25%), Positives = 15/31 (48%)

Query: 206 NVKNIKALDYDPVARQIYWIDSKLQAIKRAS 236
            + +   L  D +  ++YW D  L  I+ A+
Sbjct: 7   GLGHPNGLAVDWIEGRLYWTDWGLDVIEVAN 37

Type "B" repeats in low-density lipoprotein (LDL) receptor that plays a central role in mammalian cholesterol metabolism. Also present in a variety of molecules similar to gp300/megalin. Length = 43

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 242
KOG1214|consensus1289 100.0
KOG1215|consensus877 99.97
KOG1214|consensus1289 99.89
KOG1215|consensus 877 99.83
PF0005842 Ldl_recept_b: Low-density lipoprotein receptor rep 99.32
PF1467036 FXa_inhibition: Coagulation Factor Xa inhibitory s 99.26
PF0005842 Ldl_recept_b: Low-density lipoprotein receptor rep 99.21
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 99.04
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 98.86
smart0013543 LY Low-density lipoprotein-receptor YWTD domain. T 98.82
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.8
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 98.6
smart0013543 LY Low-density lipoprotein-receptor YWTD domain. T 98.59
COG3386307 Gluconolactonase [Carbohydrate transport and metab 97.85
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 97.57
TIGR02604 367 Piru_Ver_Nterm putative membrane-bound dehydrogena 97.28
KOG4499|consensus310 97.21
PF0764542 EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 97.2
PF0308889 Str_synth: Strictosidine synthase; InterPro: IPR01 97.15
PF10282 345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 97.09
PF1266224 cEGF: Complement Clr-like EGF-like 96.94
COG3386307 Gluconolactonase [Carbohydrate transport and metab 96.89
KOG1520|consensus376 96.8
PF1294736 EGF_3: EGF domain; InterPro: IPR024731 This entry 96.79
PRK03629429 tolB translocation protein TolB; Provisional 96.73
cd01475224 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, 96.7
KOG4659|consensus 1899 96.67
COG2706 346 3-carboxymuconate cyclase [Carbohydrate transport 96.61
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 96.46
smart0018135 EGF Epidermal growth factor-like domain. 96.38
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 96.16
PF07995 331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 96.16
TIGR03606 454 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH 96.09
smart0017939 EGF_CA Calcium-binding EGF-like domain. 96.04
PRK11028330 6-phosphogluconolactonase; Provisional 95.95
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 95.91
PF0906434 Tme5_EGF_like: Thrombomodulin like fifth domain, E 95.67
PF0308889 Str_synth: Strictosidine synthase; InterPro: IPR01 95.52
PRK11028330 6-phosphogluconolactonase; Provisional 95.44
PRK04922433 tolB translocation protein TolB; Provisional 95.4
PF0143628 NHL: NHL repeat; InterPro: IPR001258 The NHL repea 95.31
PRK04792448 tolB translocation protein TolB; Provisional 95.3
PF0173186 Arylesterase: Arylesterase; InterPro: IPR002640 Th 94.78
cd0005336 EGF Epidermal growth factor domain, found in epide 94.73
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 94.58
KOG1520|consensus376 94.38
TIGR03032335 conserved hypothetical protein TIGR03032. This pro 93.54
PF03022287 MRJP: Major royal jelly protein; InterPro: IPR0035 93.31
PRK04043419 tolB translocation protein TolB; Provisional 93.24
PRK02889427 tolB translocation protein TolB; Provisional 92.81
PF0000832 EGF: EGF-like domain This is a sub-family of the P 92.68
PRK05137435 tolB translocation protein TolB; Provisional 92.51
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 92.39
PRK05137435 tolB translocation protein TolB; Provisional 91.96
PF0143628 NHL: NHL repeat; InterPro: IPR001258 The NHL repea 91.64
cd0005438 EGF_CA Calcium-binding EGF-like domain, present in 91.62
COG3391381 Uncharacterized conserved protein [Function unknow 91.33
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 91.26
COG3391381 Uncharacterized conserved protein [Function unknow 90.9
PRK04792448 tolB translocation protein TolB; Provisional 89.78
PRK04043419 tolB translocation protein TolB; Provisional 89.24
PF1266113 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E 88.82
PRK00178430 tolB translocation protein TolB; Provisional 88.6
PRK04922433 tolB translocation protein TolB; Provisional 88.53
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 88.26
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 87.72
KOG4659|consensus 1899 87.21
PRK01742429 tolB translocation protein TolB; Provisional 86.42
PRK00178430 tolB translocation protein TolB; Provisional 85.61
PRK02889427 tolB translocation protein TolB; Provisional 84.57
KOG1219|consensus 4289 83.34
TIGR03032335 conserved hypothetical protein TIGR03032. This pro 82.64
TIGR03606454 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH 82.37
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 82.02
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 81.64
PRK03629429 tolB translocation protein TolB; Provisional 81.35
PF03022287 MRJP: Major royal jelly protein; InterPro: IPR0035 81.12
>KOG1214|consensus Back     alignment and domain information 
Probab=100.00  E-value=5.3e-35  Score=267.15  Aligned_cols=158  Identities=24%  Similarity=0.482  Sum_probs=143.9

Q ss_pred             CEEeecCCCCCCcEEEEecCCCCcEEEEeCC--ccceEEEeccCCEEEEEeCCCCcEEEEeccCCceEEEEcCCCCceEE
Q psy13634          1 MLWSDWGAGNGGTIERSALDGTQRSVLLHKV--KANSLTVNYDEKRVYYVNLLSSSIESIDIEGRNKITIVANIEDKPVT   78 (242)
Q Consensus         1 lyWtd~g~~~~~~I~ra~mDGs~~~~lv~~~--~P~glaiD~~~~rLYW~D~~~~~I~~~~~dG~~~~~l~~~~~~~p~~   78 (242)
                      ||||||+. .+|+|+++.|||+||++|++..  .||||++|+.++.|+|+|+++.+.|+...+|..|++++ +++..||+
T Consensus      1125 LYwtDWnR-enPkIets~mDG~NrRilin~DigLPNGLtfdpfs~~LCWvDAGt~rleC~~p~g~gRR~i~-~~LqYPF~ 1202 (1289)
T KOG1214|consen 1125 LYWTDWNR-ENPKIETSSMDGENRRILINTDIGLPNGLTFDPFSKLLCWVDAGTKRLECTLPDGTGRRVIQ-NNLQYPFS 1202 (1289)
T ss_pred             eeeccccc-cCCcceeeccCCccceEEeecccCCCCCceeCcccceeeEEecCCcceeEecCCCCcchhhh-hcccCcee
Confidence            79999984 7999999999999999999987  99999999999999999999999999999999999755 56999999


Q ss_pred             EEEeCCEEEEEeCCCCeEEEEECCCCc-e-EEEecCCcccccceEEeccccccccccccCcccCCccccccCCCCCCCCc
Q psy13634         79 LTLYKSEIFYSNWDKRSIEKYDKTSHT-R-SVIYRSSEKEINDMLIYHPSRQTGWNKCAVANNECDYLCLATPGRGGGLN  156 (242)
Q Consensus        79 l~v~~d~lYwtd~~~~~i~~~~k~~g~-~-~~~~~~~~~~p~~i~i~~~~~q~~~n~C~~~ng~Cs~lCl~~~~~~~~~~  156 (242)
                      |+-+++.+|||||+.++|.++++..++ . ..+..+ -.+.+||....++...+++||+.+||||+||||+.-++     
T Consensus      1203 itsy~~~fY~TDWk~n~vvsv~~~~~~~td~~~p~~-~s~lyGItav~~~Cp~gstpCSedNGGCqHLCLpgqng----- 1276 (1289)
T KOG1214|consen 1203 ITSYADHFYHTDWKRNGVVSVNKHSGQFTDEYLPEQ-RSHLYGITAVYPYCPTGSTPCSEDNGGCQHLCLPGQNG----- 1276 (1289)
T ss_pred             eeeccccceeeccccCceEEeecccccccccccccc-ccceEEEEeccccCCCCCCcccccCCcceeecccCcCC-----
Confidence            999999999999999999999999888 4 444444 56799999888888889999999999999999998887     


Q ss_pred             eeEecCCCcc
Q psy13634        157 YKCECPTHYT  166 (242)
Q Consensus       157 ~~C~Cp~g~~  166 (242)
                      ..|.||+..+
T Consensus      1277 avcecpdnvk 1286 (1289)
T KOG1214|consen 1277 AVCECPDNVK 1286 (1289)
T ss_pred             ccccCCccce
Confidence            8999998754

>KOG1215|consensus Back     alignment and domain information
>KOG1214|consensus Back     alignment and domain information
>KOG1215|consensus Back     alignment and domain information
>PF00058 Ldl_recept_b: Low-density lipoprotein receptor repeat class B; InterPro: IPR000033 The low-density lipoprotein receptor (LDLR) is the major cholesterol-carrying lipoprotein of plasma, acting to regulate cholesterol homeostasis in mammalian cells Back     alignment and domain information
>PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A Back     alignment and domain information
>PF00058 Ldl_recept_b: Low-density lipoprotein receptor repeat class B; InterPro: IPR000033 The low-density lipoprotein receptor (LDLR) is the major cholesterol-carrying lipoprotein of plasma, acting to regulate cholesterol homeostasis in mammalian cells Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>smart00135 LY Low-density lipoprotein-receptor YWTD domain Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>smart00135 LY Low-density lipoprotein-receptor YWTD domain Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins Back     alignment and domain information
>PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4 Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PF12662 cEGF: Complement Clr-like EGF-like Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1520|consensus Back     alignment and domain information
>PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity Back     alignment and domain information
>KOG4659|consensus Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>smart00181 EGF Epidermal growth factor-like domain Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family Back     alignment and domain information
>smart00179 EGF_CA Calcium-binding EGF-like domain Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PF09064 Tme5_EGF_like: Thrombomodulin like fifth domain, EGF-like; InterPro: IPR015149 This domain adopts a fold similar to other EGF domains, with a flat major and a twisted minor beta sheet Back     alignment and domain information
>PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4 Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF01436 NHL: NHL repeat; InterPro: IPR001258 The NHL repeat, named after NCL-1, HT2A and Lin-41, is found largely in a large number of eukaryotic and prokaryotic proteins Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF01731 Arylesterase: Arylesterase; InterPro: IPR002640 The serum paraoxonases/arylesterases are enzymes that catalyse the hydrolysis of the toxic metabolites of a variety of organophosphorus insecticides Back     alignment and domain information
>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>KOG1520|consensus Back     alignment and domain information
>TIGR03032 conserved hypothetical protein TIGR03032 Back     alignment and domain information
>PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12 Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF01436 NHL: NHL repeat; InterPro: IPR001258 The NHL repeat, named after NCL-1, HT2A and Lin-41, is found largely in a large number of eukaryotic and prokaryotic proteins Back     alignment and domain information
>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG4659|consensus Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>TIGR03032 conserved hypothetical protein TIGR03032 Back     alignment and domain information
>TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query242
4a0p_A 628 Crystal Structure Of Lrp6p3e3p4e4 Length = 628 4e-50
4a0p_A 628 Crystal Structure Of Lrp6p3e3p4e4 Length = 628 8e-04
3s8v_A 623 Crystal Structure Of Lrp6-Dkk1 Complex Length = 623 5e-50
3s2k_A 629 Structural Basis Of Wnt Signaling Inhibition By Dic 5e-50
4dg6_A 616 Crystal Structure Of Domains 1 And 2 Of Lrp6 Length 8e-25
3s94_A 619 Crystal Structure Of Lrp6-E1e2 Length = 619 8e-25
3v64_C349 Crystal Structure Of Agrin And Lrp4 Length = 349 1e-18
3v65_B386 Crystal Structure Of Agrin And Lrp4 Complex Length 2e-18
3sob_B316 The Structure Of The First Ywtd Beta Propeller Doma 2e-14
3soq_A318 The Structure Of The First Ywtd Beta Propeller Doma 5e-14
1ijq_A316 Crystal Structure Of The Ldl Receptor Ywtd-Egf Doma 7e-07
3p5b_L400 The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE 1e-06
3p5c_L440 The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE 2e-06
3m0c_C791 The X-Ray Crystal Structure Of Pcsk9 In Complex Wit 3e-06
1n7d_A699 Extracellular Domain Of The Ldl Receptor Length = 6 6e-06
>pdb|4A0P|A Chain A, Crystal Structure Of Lrp6p3e3p4e4 Length = 628 Back     alignment and structure 
Iteration: 1

 Score =  194 bits (492), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 90/244 (36%), Positives = 157/244 (64%), Gaps = 10/244 (4%)
Query: 1   MLWSDWGAGNGGTIERSALDGTQRSVLLHKV-KANSLTVNYDEKRVYYVNLLXXXXXXXX 59
           M W++WG      I+R+A+DG++R+ L+  V +AN LT++Y ++R+Y+ +L         
Sbjct: 137 MYWTEWGGKP--KIDRAAMDGSERTTLVPNVGRANGLTIDYAKRRLYWTDLDTNLIESSN 194
Query: 60  XXGRNKITIVANIEDKPVTLTLYKSEIFYSNWDKRSIEKYDKTSHTRSVIYRSSEKEIND 119
             G N+  ++A+    P  LT Y+  I++++W +RSIE+ +KTS     I +     + D
Sbjct: 195 MLGLNR-EVIADDLPHPFGLTQYQDYIYWTDWSRRSIERANKTSGQNRTIIQGHLDYVMD 253
Query: 120 MLIYHPSRQTGWNKCAVANNECDYLCLATPGRGGGLNYKCECPTHYTM--VNGTCMAPSS 177
           +L++H SRQ+GWN+CA +N  C +LCLA P  G    + C CP HY++   N TC AP++
Sbjct: 254 ILVFHSSRQSGWNECASSNGHCSHLCLAVPVGG----FVCGCPAHYSLNADNRTCSAPTT 309
Query: 178 FLIYAQRNILSRLITDPTQCPDSPYEIPNVKNIKALDYDPVARQIYWIDSKLQAIKRASE 237
           FL+++Q++ ++R++ D  Q PD    I +++N++A+DYDP+ +Q+YWIDS+   I++A E
Sbjct: 310 FLLFSQKSAINRMVIDEQQSPDIILPIHSLRNVRAIDYDPLDKQLYWIDSRQNMIRKAQE 369
Query: 238 NATR 241
           + ++
Sbjct: 370 DGSQ 373
>pdb|4A0P|A Chain A, Crystal Structure Of Lrp6p3e3p4e4 Length = 628 Back     alignment and structure
>pdb|3S8V|A Chain A, Crystal Structure Of Lrp6-Dkk1 Complex Length = 623 Back     alignment and structure
>pdb|3S2K|A Chain A, Structural Basis Of Wnt Signaling Inhibition By Dickkopf Binding To Lrp56. Length = 629 Back     alignment and structure
>pdb|4DG6|A Chain A, Crystal Structure Of Domains 1 And 2 Of Lrp6 Length = 616 Back     alignment and structure
>pdb|3S94|A Chain A, Crystal Structure Of Lrp6-E1e2 Length = 619 Back     alignment and structure
>pdb|3V64|C Chain C, Crystal Structure Of Agrin And Lrp4 Length = 349 Back     alignment and structure
>pdb|3V65|B Chain B, Crystal Structure Of Agrin And Lrp4 Complex Length = 386 Back     alignment and structure
>pdb|3SOB|B Chain B, The Structure Of The First Ywtd Beta Propeller Domain Of Lrp6 In Complex With A Fab Length = 316 Back     alignment and structure
>pdb|3SOQ|A Chain A, The Structure Of The First Ywtd Beta Propeller Domain Of Lrp6 In Complex With A Dkk1 Peptide Length = 318 Back     alignment and structure
>pdb|1IJQ|A Chain A, Crystal Structure Of The Ldl Receptor Ywtd-Egf Domain Pair Length = 316 Back     alignment and structure
>pdb|3P5B|L Chain L, The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE RECEPTOR IN AN Extended Conformation Length = 400 Back     alignment and structure
>pdb|3P5C|L Chain L, The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE RECEPTOR IN AN Extended Conformation Length = 440 Back     alignment and structure
>pdb|3M0C|C Chain C, The X-Ray Crystal Structure Of Pcsk9 In Complex With The Ldl Receptor Length = 791 Back     alignment and structure
>pdb|1N7D|A Chain A, Extracellular Domain Of The Ldl Receptor Length = 699 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query242
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 3e-40
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 2e-36
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 1e-27
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 5e-09
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 9e-08
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 9e-08
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 1e-05
3s94_A 619 LRP-6, low-density lipoprotein receptor-related pr 3e-33
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 6e-31
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 4e-07
3s94_A 619 LRP-6, low-density lipoprotein receptor-related pr 9e-07
3s94_A 619 LRP-6, low-density lipoprotein receptor-related pr 1e-06
3v65_B386 Low-density lipoprotein receptor-related protein; 1e-32
3v65_B386 Low-density lipoprotein receptor-related protein; 3e-07
3v65_B 386 Low-density lipoprotein receptor-related protein; 2e-06
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 2e-32
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 2e-31
3sov_A 318 LRP-6, low-density lipoprotein receptor-related pr 6e-07
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 4e-06
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 3e-30
3v64_C 349 Agrin; beta propeller, laminin-G, signaling, prote 4e-08
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 3e-07
3p5b_L400 Low density lipoprotein receptor variant; B-propel 4e-30
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 5e-04
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 1e-29
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 4e-07
1ijq_A 316 LDL receptor, low-density lipoprotein receptor; be 2e-06
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 4e-05
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 2e-23
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 1e-08
1npe_A 267 Nidogen, entactin; glycoprotein, basement membrane 3e-08
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 6e-08
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 7e-06
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 4e-08
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 1e-06
2bz6_L53 Blood coagulation factor VIIA; serine protease, en 2e-04
2wph_E59 Coagulation factor IXA light chain; serine proteas 4e-04
1kli_L69 Factor VIIA; extrinsic coagulation pathway, serine 4e-04
1kig_L51 Factor XA; glycoprotein, serine protease, plasma, 9e-04
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 Back     alignment and structure
 Score =  146 bits (368), Expect = 3e-40
 Identities = 52/249 (20%), Positives = 102/249 (40%), Gaps = 22/249 (8%)

Query: 1   MLWSDWGAGNGGTIERSALDGTQRSVLLHK--VKANSLTVNYDEKRVYYVNLLSSSIESI 58
           M W+DWG      I++  L+G     L+ +     N +T++    R+Y+V+    SI SI
Sbjct: 528 MYWTDWG--TPAKIKKGGLNGVDIYSLVTENIQWPNGITLDLLSGRLYWVDSKLHSISSI 585

Query: 59  DIEGRNKITIVANIEDK--PVTLTLYKSEIFYSNWDKRSIEKYDKTSHTRSVIYRSSEKE 116
           D+ G N+ TI+ + +    P +L +++ ++F+++    +I   ++ + +   +   +   
Sbjct: 586 DVNGGNRKTILEDEKRLAHPFSLAVFEDKVFWTDIINEAIFSANRLTGSDVNLLAENLLS 645

Query: 117 INDMLIYHPSRQ-TGWNKCA---VANNECDYLCLATPGRGGGLN-YKCECPTHYTMVNG- 170
             DM+++H   Q  G N C    ++N  C YLCL  P        + C CP    +    
Sbjct: 646 PEDMVLFHNLTQPRGVNWCERTTLSNGGCQYLCLPAPQINPHSPKFTCACPDGMLLARDM 705

Query: 171 -TCMAPSSFLIYAQRNILSRLITDPTQCPDSPYEIPNVKNIKALDYDPVARQIYWIDSKL 229
            +C+  +   +  Q     RL    T           V         P   ++      L
Sbjct: 706 RSCLTEAEAAVATQETSTVRLKVSSTAVRTQHTTTRPV---------PDTSRLPGATPGL 756

Query: 230 QAIKRASEN 238
             ++  + +
Sbjct: 757 TTVEIVTMS 765
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Length = 628 Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Length = 628 Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Length = 628 Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Length = 628 Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Length = 628 Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Length = 628 Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} Length = 619 Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} Length = 619 Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} Length = 619 Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} Length = 619 Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} Length = 619 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Length = 318 Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Length = 318 Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Length = 318 Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Length = 349 Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Length = 349 Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Length = 349 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Length = 316 Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Length = 316 Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Length = 316 Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Length = 316 Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Length = 267 Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Length = 267 Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Length = 267 Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Length = 267 Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Length = 267 Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Length = 302 Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Length = 302 Back     alignment and structure
>2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* Length = 53 Back     alignment and structure
>2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* Length = 59 Back     alignment and structure
>1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* Length = 69 Back     alignment and structure
>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 Length = 51 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query242
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 100.0
3s94_A 619 LRP-6, low-density lipoprotein receptor-related pr 100.0
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 100.0
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 100.0
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 100.0
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 100.0
3v65_B386 Low-density lipoprotein receptor-related protein; 100.0
3p5b_L400 Low density lipoprotein receptor variant; B-propel 100.0
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 100.0
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 100.0
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 100.0
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 99.9
3p5b_L400 Low density lipoprotein receptor variant; B-propel 99.9
3v65_B386 Low-density lipoprotein receptor-related protein; 99.89
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 99.89
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 99.88
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 99.87
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 99.78
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 99.77
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 99.77
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 99.68
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 99.66
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 99.16
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.07
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 99.07
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.06
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 99.02
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 98.98
1kli_L69 Factor VIIA; extrinsic coagulation pathway, serine 98.92
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 98.91
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 98.85
2bz6_L53 Blood coagulation factor VIIA; serine protease, en 98.79
2wph_E59 Coagulation factor IXA light chain; serine proteas 98.79
3kya_A496 Putative phosphatase; structural genomics, joint c 98.77
1kig_L51 Factor XA; glycoprotein, serine protease, plasma, 98.73
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 98.71
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 98.7
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 98.69
2p4o_A306 Hypothetical protein; putative lactonase, structur 98.68
3kya_A 496 Putative phosphatase; structural genomics, joint c 98.67
2fp8_A322 Strictosidine synthase; six bladed beta propeller 98.65
2jkh_L55 Factor X light chain; plasma, calcium, zymogen, se 98.65
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 98.61
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 98.59
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 98.53
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 98.46
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 98.46
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 98.44
2fp8_A322 Strictosidine synthase; six bladed beta propeller 98.36
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 98.32
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 98.32
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 98.29
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 98.27
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 98.27
2p4o_A306 Hypothetical protein; putative lactonase, structur 98.25
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 98.23
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 98.16
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 98.16
3a9g_A 354 Putative uncharacterized protein; PQQ dependent de 98.14
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 98.11
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 97.96
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 97.95
2g8s_A 353 Glucose/sorbosone dehydrogenases; bladed beta-prop 97.94
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 97.92
3f1s_B 283 Vitamin K-dependent protein Z; PZ, ZPI, complex, s 97.9
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 97.88
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 97.87
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 97.86
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 97.74
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 97.73
2qe8_A343 Uncharacterized protein; structural genomics, join 97.73
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 97.69
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 97.54
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 97.51
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 97.51
1aut_L114 Activated protein C; serine proteinase, plasma cal 97.45
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 97.44
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 97.43
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 97.36
1cru_A 454 Protein (soluble quinoprotein glucose dehydrogena; 97.33
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 97.29
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 97.26
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 97.22
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 97.21
2qe8_A343 Uncharacterized protein; structural genomics, join 97.17
1szb_A170 Mannose binding lectin-associated serine protease- 97.07
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 97.05
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 96.99
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 96.96
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 96.89
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 96.89
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 96.88
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 96.81
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 96.73
2vh0_B134 Activated factor XA light chain; serine protease, 96.69
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 96.65
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 96.62
1cru_A454 Protein (soluble quinoprotein glucose dehydrogena; 96.58
1nzi_A159 Complement C1S component; calcium, innate immunity 96.56
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 96.54
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 96.51
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 96.36
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 96.24
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 96.21
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 96.15
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 96.06
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 96.0
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 95.87
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 95.86
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 95.84
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 95.82
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 95.78
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 95.75
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 95.72
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 95.69
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 95.58
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 95.47
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 95.42
2p9w_A 334 MAL S 1 allergenic protein; beta propeller; 1.35A 95.41
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 95.37
2kl7_A71 Fibulin-4; secreted, calcium, disease mutation, di 95.24
3h5c_B 317 Vitamin K-dependent protein Z; protein Z-protein Z 95.09
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 94.51
1gl4_A 285 Nidogen-1, entactin; immunoglobulin-like domain, e 94.31
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 94.19
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 93.95
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 93.81
1a3p_A45 Epidermal growth factor; disulfide connectivities, 93.69
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 93.58
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 93.25
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 93.2
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 93.1
2bou_A143 EGF-like module containing mucin-like hormone rece 93.1
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 92.72
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 92.52
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 92.51
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 92.1
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 91.97
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 91.92
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 91.86
2k2s_B61 Micronemal protein 6; microneme protein complex, c 91.65
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 91.48
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 91.41
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 91.35
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 90.56
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 90.49
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 90.43
1nql_B53 Epidermal growth factor; cell surface receptor, ty 90.27
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 90.14
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 90.13
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 90.07
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 89.88
3q6k_A381 43.2 kDa salivary protein; beta propeller, binding 89.56
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 89.21
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 89.15
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 88.96
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 87.83
3dem_A278 Complement factor MAsp-3; complement system, innat 87.81
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 87.76
3q6k_A381 43.2 kDa salivary protein; beta propeller, binding 87.43
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 87.42
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 87.41
1n1i_A105 Merozoite surface protein-1; MSP1, malaria, surfac 87.25
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 87.21
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 86.97
1nt0_A286 MAsp2, mannose-binding protein associated serine p 86.92
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 86.54
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 86.48
2bou_A143 EGF-like module containing mucin-like hormone rece 85.27
1ob1_C99 Major merozoite surface protein; immune system, im 85.15
3ca7_A52 Protein spitz; argos, EGF, developmental protein, 85.15
1jmx_B 349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 84.97
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 84.6
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 83.83
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 83.44
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 83.31
3nt1_A 587 Prostaglandin-endoperoxide synthase 2; prostagland 83.17
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 83.14
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 82.98
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 82.6
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 82.2
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 81.78
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 81.74
1q4g_A 553 Prostaglandin G/H synthase 1; cyclooxygenase, non- 81.25
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 80.68
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 80.04
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
Probab=100.00  E-value=1.3e-53  Score=401.06  Aligned_cols=233  Identities=40%  Similarity=0.879  Sum_probs=218.6

Q ss_pred             CEEeecCCCCCCcEEEEecCCCCcEEEEeCC-ccceEEEeccCCEEEEEeCCCCcEEEEeccCCceEEEEcCCCCceEEE
Q psy13634          1 MLWSDWGAGNGGTIERSALDGTQRSVLLHKV-KANSLTVNYDEKRVYYVNLLSSSIESIDIEGRNKITIVANIEDKPVTL   79 (242)
Q Consensus         1 lyWtd~g~~~~~~I~ra~mDGs~~~~lv~~~-~P~glaiD~~~~rLYW~D~~~~~I~~~~~dG~~~~~l~~~~~~~p~~l   79 (242)
                      ||||||+  ..++|+|++|||+++++|++.. +|+||++|+.+++|||+|+..+.|++++++|++++ ++...+.+|+||
T Consensus       137 lY~tD~g--~~~~I~r~~~dG~~~~~l~~~~~~P~GlalD~~~~~LY~aD~~~~~I~~~d~dG~~~~-v~~~~l~~P~gl  213 (628)
T 4a0p_A          137 MYWTEWG--GKPKIDRAAMDGSERTTLVPNVGRANGLTIDYAKRRLYWTDLDTNLIESSNMLGLNRE-VIADDLPHPFGL  213 (628)
T ss_dssp             EEEEECS--SSCEEEEEETTSCSCEEEECSCSSEEEEEEETTTTEEEEEETTTTEEEEEETTSCSCE-EEEECCSCEEEE
T ss_pred             EEEeCCC--CCCEEEEEeCCCCceEEEECCCCCcceEEEccccCEEEEEECCCCEEEEEcCCCCceE-EeeccCCCceEE
Confidence            7999998  6899999999999999999877 99999999999999999999999999999999997 455568999999


Q ss_pred             EEeCCEEEEEeCCCCeEEEEECCCCc-eEEEecCCcccccceEEeccccccccccccCcccCCccccccCCCCCCCCcee
Q psy13634         80 TLYKSEIFYSNWDKRSIEKYDKTSHT-RSVIYRSSEKEINDMLIYHPSRQTGWNKCAVANNECDYLCLATPGRGGGLNYK  158 (242)
Q Consensus        80 ~v~~d~lYwtd~~~~~i~~~~k~~g~-~~~~~~~~~~~p~~i~i~~~~~q~~~n~C~~~ng~Cs~lCl~~~~~~~~~~~~  158 (242)
                      ++++++|||+||..+.|.+++|.+|+ .+++..+ +..|++|+|||+.+|++.|+|+.+||+|+|+|++.|.++    ++
T Consensus       214 av~~~~ly~tD~~~~~I~~~dk~tg~~~~~l~~~-~~~p~~i~v~~~~~q~~~n~C~~~ng~C~~~C~~~~~~~----~~  288 (628)
T 4a0p_A          214 TQYQDYIYWTDWSRRSIERANKTSGQNRTIIQGH-LDYVMDILVFHSSRQSGWNECASSNGHCSHLCLAVPVGG----FV  288 (628)
T ss_dssp             EEETTEEEEEETTTTEEEEEETTTCCSCEEEECS-CCSCCEEEEECGGGSCCCCTTTTTGGGCSSEEEEETTTE----EE
T ss_pred             EEECCEEEEecCCCCEEEEEECCCCCceEEEecC-CCCcceeeeeeecccccceEeccCCCCcchhhhcCCCCC----ee
Confidence            99999999999999999999999999 8888877 788999999999999999999999999999999999443    99


Q ss_pred             EecCCCcccc--CCcccCCceeEEEeeeceEEEEecCCCCCCCccEecCCCCceeeEEEeCCCCEEEEEECCCCcEEEEe
Q psy13634        159 CECPTHYTMV--NGTCMAPSSFLIYAQRNILSRLITDPTQCPDSPYEIPNVKNIKALDYDPVARQIYWIDSKLQAIKRAS  236 (242)
Q Consensus       159 C~Cp~g~~l~--~~~C~~~~~fl~~~~~~~i~~~~~~~~~~~~~~~p~~~~~~~~~l~~d~~~~~iYw~d~~~~~I~r~~  236 (242)
                      |+||.||.|.  +++|.++++||+|+++..|+++.++....++.++|+.+++++.+||||+.+++|||+|...++|+|+.
T Consensus       289 C~C~~g~~l~~d~~~C~~~~~~Ll~s~~~~i~~i~l~~~~~~~~~l~~~~~~~~~~ld~d~~~~~iy~sD~~~~~I~r~~  368 (628)
T 4a0p_A          289 CGCPAHYSLNADNRTCSAPTTFLLFSQKSAINRMVIDEQQSPDIILPIHSLRNVRAIDYDPLDKQLYWIDSRQNMIRKAQ  368 (628)
T ss_dssp             EECSTTCEECTTSSCEECCSSEEEEEETTEEEEECCCTTCCCCEECCCTTCSCEEEEEEETTTTEEEEEETTTTEEEEEE
T ss_pred             EEcCCCcEecccCCcCccccceeeeeccceEEEEecccccCceEEEEehhcCCceEEEEecCCCeEEEEecCcceEEEEE
Confidence            9999999998  89999999999999999999999987666677899999999999999999999999999999999999


Q ss_pred             CCCcc
Q psy13634        237 ENATR  241 (242)
Q Consensus       237 ~dGs~  241 (242)
                      +||+.
T Consensus       369 ~~g~~  373 (628)
T 4a0p_A          369 EDGSQ  373 (628)
T ss_dssp             TTSCS
T ss_pred             cCCCC
Confidence            99975
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* Back     alignment and structure
>2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Back     alignment and structure
>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A* Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3dem_A Complement factor MAsp-3; complement system, innate immunity, calcium binding sites, C pathway, EGF-like domain, glycoprotein, hydrolase; HET: NAG; 2.30A {Homo sapiens} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A* Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>1n1i_A Merozoite surface protein-1; MSP1, malaria, surface antigen, glycoprotein, EGF domain, cell adhesion; HET: HIS; 2.40A {Plasmodium knowlesi strain H} SCOP: g.3.11.4 g.3.11.4 Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1nt0_A MAsp2, mannose-binding protein associated serine proteas; CUB domain, EGF like domain., hydrolase, sugar binding protein; HET: NAG EDO; 2.70A {Rattus norvegicus} SCOP: b.23.1.1 b.23.1.1 g.3.11.1 Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>1ob1_C Major merozoite surface protein; immune system, immunoglobulin/complex, immunoglobulin, antib fragment, MSP1-19, EGF-like domain; 2.90A {Plasmodium falciparum} SCOP: g.3.11.4 g.3.11.4 PDB: 1cej_A 2flg_A Back     alignment and structure
>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 242
d1npea_263 b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId 7e-16
d1npea_ 263 b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId 2e-09
d1npea_263 b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId 6e-05
d1ijqa1266 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) 8e-15
d1ijqa1 266 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) 9e-09
d1ijqa1266 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) 2e-07
d3bpse140 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) 6e-08
d2bz6l153 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human 3e-06
d1rfnb_57 g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens 5e-06
d1ijqa250 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) 1e-05
d2p3ua151 g.3.11.1 (A:87-137) Factor X, N-terminal module {H 2e-05
d1autl250 g.3.11.1 (L:97-146) Activated protein c (autoproth 2e-05
d1kigl_51 g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bo 6e-05
d1emoa143 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sa 1e-04
d1i0ua241 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) r 0.001
d1szba245 g.3.11.1 (A:124-168) Mannose-binding protein assoc 0.002
d1nt0a345 g.3.11.1 (A:120-164) Mannose-binding protein assoc 0.004
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Length = 263 Back     information, alignment and structure

class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: YWTD domain
family: YWTD domain
domain: Nidogen
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 72.6 bits (177), Expect = 7e-16
 Identities = 26/129 (20%), Positives = 53/129 (41%), Gaps = 5/129 (3%)

Query: 1   MLWSDWGAGNGGTIERSALDGTQRSVLL--HKVKANSLTVNYDEKRVYYVNLLSSSIESI 58
           + W+DW   N   IE S +DGT R +L   +    N LT +    ++ +V+  +   E +
Sbjct: 136 LYWTDWNRDNP-KIETSHMDGTNRRILAQDNLGLPNGLTFDAFSSQLCWVDAGTHRAECL 194

Query: 59  DIEGRNKITIVANIEDKPVTLTLYKSEIFYSNWDKRSIEKYDK-TSHTRSVIYRSSEKEI 117
           +     +  ++  +   P  +T Y   ++Y++W   S+   D   S      +   +  +
Sbjct: 195 NPAQPGRRKVLEGL-QYPFAVTSYGKNLYYTDWKTNSVIAMDLAISKEMDTFHPHKQTRL 253

Query: 118 NDMLIYHPS 126
             + I    
Sbjct: 254 YGITIALSQ 262
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Length = 263 Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Length = 263 Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Length = 40 Back     information, alignment and structure
>d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Length = 50 Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 51 Back     information, alignment and structure
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 50 Back     information, alignment and structure
>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Length = 51 Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 45 Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 45 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query242
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 99.96
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 99.95
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 99.93
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 99.92
d1ijqa250 Low density lipoprotein (LDL) receptor, different 99.34
d3bpse140 Low density lipoprotein (LDL) receptor, different 99.3
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 99.3
d2bz6l153 Coagulation factor VIIa {Human (Homo sapiens) [Tax 99.27
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 99.26
d1rfnb_57 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 99.24
d1autl250 Activated protein c (autoprothrombin IIa) {Human ( 99.22
d2p3ua151 Factor X, N-terminal module {Human (Homo sapiens) 99.19
d1kigl_51 Factor X, N-terminal module {Cow (Bos taurus) [Tax 99.14
d1nzia242 Complement C1S component {Human (Homo sapiens) [Ta 98.98
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.96
d1i0ua241 Low density lipoprotein (LDL) receptor, different 98.84
d1nt0a345 Mannose-binding protein associated serine protease 98.77
d1szba245 Mannose-binding protein associated serine protease 98.75
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.65
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 98.63
d1uzka143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.52
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.52
d1dx5i340 Thrombomodulin, different EGF-like domains {Human 98.45
d1lmja242 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.33
d1apqa_53 Complement protease C1R {Human (Homo sapiens) [Tax 98.31
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.31
d1uzka243 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.29
d1emoa143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.28
d1lmja144 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.11
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 98.09
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 98.08
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 97.95
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 97.83
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 97.65
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 96.99
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 96.99
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 96.7
d1gl4a240 EGF-like domain of nidogen-1 {Mouse (Mus musculus) 96.46
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 96.43
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 96.13
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 96.08
d1crua_ 450 Soluble quinoprotein glucose dehydrogenase {Acinet 96.03
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 95.98
d1dx5i143 Thrombomodulin, different EGF-like domains {Human 95.97
d1cvua241 Prostaglandin H2 synthase-1, EGF-like module {Mous 95.97
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 95.63
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 95.6
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 95.59
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 95.4
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 95.39
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 94.97
d1dx5i235 Thrombomodulin, different EGF-like domains {Human 94.81
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 94.77
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 94.47
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 94.0
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 93.86
d1haea_63 Heregulin-alpha, EGF-like domain {Human (Homo sapi 93.48
d1ioxa_50 Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] 92.85
d1jofa_ 365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 91.89
d3egfa_53 Epidermal growth factor, EGF {Mouse (Mus musculus) 90.54
d1moxc_49 Transforming growth factor alpha {Human (Homo sapi 90.39
d1k36a_46 Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI 90.29
d1nqlb_48 Epidermal growth factor, EGF {Human (Homo sapiens) 89.14
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 86.6
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 84.91
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 84.77
d1ob1c251 Merozoite surface protein 1 (MSP-1) {Malaria paras 83.12
d1hzua2 426 C-terminal (heme d1) domain of cytochrome cd1-nitr 83.0
d1emoa239 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 82.77
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 81.82
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: YWTD domain
family: YWTD domain
domain: Low density lipoprotein (LDL) receptor
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.96  E-value=7.4e-29  Score=207.95  Aligned_cols=126  Identities=25%  Similarity=0.499  Sum_probs=117.2

Q ss_pred             CEEeecCCCCCCcEEEEecCCCCcEEEEeCC--ccceEEEeccCCEEEEEeCCCCcEEEEeccCCceEEEEcCC--CCce
Q psy13634          1 MLWSDWGAGNGGTIERSALDGTQRSVLLHKV--KANSLTVNYDEKRVYYVNLLSSSIESIDIEGRNKITIVANI--EDKP   76 (242)
Q Consensus         1 lyWtd~g~~~~~~I~ra~mDGs~~~~lv~~~--~P~glaiD~~~~rLYW~D~~~~~I~~~~~dG~~~~~l~~~~--~~~p   76 (242)
                      |||+|++  ..++|+|++|||+++++|+...  .|+||++|+.+++|||+|.....|+++++||+++++++...  +.+|
T Consensus       134 ly~~~~~--~~~~I~r~~~dGs~~~~l~~~~~~~p~gl~iD~~~~~lYw~d~~~~~I~~~~~dG~~~~~~~~~~~~~~~p  211 (266)
T d1ijqa1         134 MYWTDWG--TPAKIKKGGLNGVDIYSLVTENIQWPNGITLDLLSGRLYWVDSKLHSISSIDVNGGNRKTILEDEKRLAHP  211 (266)
T ss_dssp             EEEEECS--SSCEEEEEETTSCCEEEEECSSCSCEEEEEEETTTTEEEEEETTTTEEEEEETTSCSCEEEEECTTTTSSE
T ss_pred             EEEeccC--CCcceeEeccCCCceecccccccceeeEEEeeccccEEEEecCCcCEEEEEECCCCCEEEEEeCCCccccc
Confidence            7999998  6789999999999999999765  99999999999999999999999999999999998776543  6899


Q ss_pred             EEEEEeCCEEEEEeCCCCeEEEEECCCCc-eEEEecCCcccccceEEecccccc
Q psy13634         77 VTLTLYKSEIFYSNWDKRSIEKYDKTSHT-RSVIYRSSEKEINDMLIYHPSRQT  129 (242)
Q Consensus        77 ~~l~v~~d~lYwtd~~~~~i~~~~k~~g~-~~~~~~~~~~~p~~i~i~~~~~q~  129 (242)
                      ++|++++++|||+||..++|++++|.+|+ .+.+..+ +..|.+|+|||+..||
T Consensus       212 ~~lav~~~~ly~td~~~~~I~~~~~~~g~~~~~~~~~-~~~p~~i~v~~~~~QP  264 (266)
T d1ijqa1         212 FSLAVFEDKVFWTDIINEAIFSANRLTGSDVNLLAEN-LLSPEDMVLFHNLTQP  264 (266)
T ss_dssp             EEEEEETTEEEEEETTTTEEEEEETTTCCCCEEEECS-CSCCCCEEEESGGGSC
T ss_pred             EEEEEECCEEEEEECCCCeEEEEECCCCcceEEEEcC-CCCceEEEEECCccCC
Confidence            99999999999999999999999999998 8888877 8899999999999997
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dx5i1 g.3.11.1 (I:345-387) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dx5i2 g.3.11.1 (I:388-422) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ob1c2 g.3.11.4 (C:46-96) Merozoite surface protein 1 (MSP-1) {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure