Psyllid ID: psy13669

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170--
MAVVLNLATAVKELVENSLDAGATSVEVKLKDYGSELVEVTDNGGGVHEDNYEGLTLKHHTSKLREFTDLTSVETFGFRGEALSSLCALSSVVIVTRHKLSGVGHWLEFDHHGHIKTKTLVSRQVGTTVSLHNIFSTLPVRQKEFHRHLKKEFAKMTQVLYGYCLVALGVKR
ccEEEcHHHHHHHHHHHHccccccEEEEEEccccccEEEEEEcccccccccHHHHHHHcccccccccccccccccccccHHHHHHHHHHccEEEEEEccccccEEEEEEEccccEEcccccccccccEEEEcccccccccccHHHHcccHHHHHHHHHHHHHHHHccccccc
ccHcccHHHHHHHHHHHHHHccccEEEEEEEHHHccEEEEEEccccccHHHHHHHHccccccccccHHHHHccccccccccHHHHHHHccEEEEEEEcccHHHHHEHEHcccccEEEEcccccccccEEEEEHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc
MAVVLNLATAVKELVENSLDAGATSVEVKLKDYGSELvevtdngggvhednyegltlkhhtsklreftdltsvetfGFRGEALSSLCALSSVVIVTRhklsgvghwlefdhhghiktkTLVSRQVGTTVSLHNIFSTLPVRQKEFHRHLKKEFAKMTQVLYGYCLVALGVKR
MAVVLNLATAVKELVensldagatsvevklkdYGSELVEVtdngggvheDNYEGLTLKHHTSKLREFTDLTSVETFGFRGEALSSLCALSSVVIVTRHKLSGVGHWLEFDHHGHIKTKTLVSRQVGTTVSLHNIFSTLPVRQKEFHRHLKKEFAKMTQVLYGYCLVALGVKR
MAVVLNLATAVKELVENSLDAGATSVEVKLKDYGSELVEVTDNGGGVHEDNYEGLTLKHHTSKLREFTDLTSVETFGFRGEalsslcalssVVIVTRHKLSGVGHWLEFDHHGHIKTKTLVSRQVGTTVSLHNIFSTLPVRQKEFHRHLKKEFAKMTQVLYGYCLVALGVKR
**VVLNLATAVKELVENSLDAGATSVEVKLKDYGSELVEVTDNGGGVHEDNYEGLTLKHHTSKLREFTDLTSVETFGFRGEALSSLCALSSVVIVTRHKLSGVGHWLEFDHHGHIKTKTLVSRQVGTTVSLHNIFSTLPVRQKEFHRHLKKEFAKMTQVLYGYCLVALGV**
MAVVLNLATAVKELVENSLDAGATSVEVKLKDYGSELVEVTDNGGGVHEDNYEGLTLKHHTSKLREFTDLTSVETFGFRGEALSSLCALSSVVIVTRHKLSGVGHWLEFD***************GTTVSLHNIFSTLPVRQKEFHRHLKKEFAKMTQVLYGYCLVALGVK*
MAVVLNLATAVKELVENSLDAGATSVEVKLKDYGSELVEVTDNGGGVHEDNYEGLTLKHHTSKLREFTDLTSVETFGFRGEALSSLCALSSVVIVTRHKLSGVGHWLEFDHHGHIKTKTLVSRQVGTTVSLHNIFSTLPVRQKEFHRHLKKEFAKMTQVLYGYCLVALGVKR
*****NLATAVKELVENSLDAGATSVEVKLKDYGSELVEVTDNGGGVHEDNYEGLTLKHHTSKLREFTDLTSVETFGFRGEALSSLCALSSVVIVTRHKLSGVGHWLEFDHHGHIKTKTLVSRQVGTTVSLHNIFSTLPVRQKEFHRHLKKEFAKMTQVLYGYCLVALG***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAVVLNLATAVKELVENSLDAGATSVEVKLKDYGSELVEVTDNGGGVHEDNYEGLTLKHHTSKLREFTDLTSVETFGFRGEALSSLCALSSVVIVTRHKLSGVGHWLEFDHHGHIKTKTLVSRQVGTTVSLHNIFSTLPVRQKEFHRHLKKEFAKMTQVLYGYCLVALGVKR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query172 2.2.26 [Sep-21-2011]
P54278 862 Mismatch repair endonucle yes N/A 0.982 0.196 0.668 2e-61
P54279 859 Mismatch repair endonucle no N/A 0.982 0.196 0.633 1e-58
Q54QA0 1022 Mismatch repair endonucle yes N/A 0.982 0.165 0.550 6e-51
A4D2B8440 Putative postmeiotic segr no N/A 0.930 0.363 0.607 2e-49
O95744297 Putative postmeiotic segr no N/A 0.930 0.538 0.590 4e-48
P14242 873 DNA mismatch repair prote yes N/A 0.976 0.192 0.479 2e-40
P54280 794 DNA mismatch repair prote yes N/A 0.959 0.207 0.463 2e-38
P54277 932 PMS1 protein homolog 1 OS no N/A 0.930 0.171 0.402 3e-27
P70754 426 DNA mismatch repair prote N/A N/A 0.889 0.359 0.4 1e-23
Q9JYT2 658 DNA mismatch repair prote yes N/A 0.976 0.255 0.367 3e-23
>sp|P54278|PMS2_HUMAN Mismatch repair endonuclease PMS2 OS=Homo sapiens GN=PMS2 PE=1 SV=2 Back     alignment and function desciption
 Score =  234 bits (597), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 113/169 (66%), Positives = 139/169 (82%)

Query: 3   VVLNLATAVKELVENSLDAGATSVEVKLKDYGSELVEVTDNGGGVHEDNYEGLTLKHHTS 62
           VVL+L+TAVKELVENSLDAGAT++++KLKDYG +L+EV+DNG GV E+N+EGLTLKHHTS
Sbjct: 31  VVLSLSTAVKELVENSLDAGATNIDLKLKDYGVDLIEVSDNGCGVEEENFEGLTLKHHTS 90

Query: 63  KLREFTDLTSVETFGFRGEALSSLCALSSVVIVTRHKLSGVGHWLEFDHHGHIKTKTLVS 122
           K++EF DLT VETFGFRGEALSSLCALS V I T H  + VG  L FDH+G I  KT   
Sbjct: 91  KIQEFADLTQVETFGFRGEALSSLCALSDVTISTCHASAKVGTRLMFDHNGKIIQKTPYP 150

Query: 123 RQVGTTVSLHNIFSTLPVRQKEFHRHLKKEFAKMTQVLYGYCLVALGVK 171
           R  GTTVS+  +FSTLPVR KEF R++KKE+AKM QVL+ YC+++ G++
Sbjct: 151 RPRGTTVSVQQLFSTLPVRHKEFQRNIKKEYAKMVQVLHAYCIISAGIR 199
Component of the post-replicative DNA mismatch repair system (MMR). Heterodimerizes with MLH1 to form MutL alpha. DNA repair is initiated by MutS alpha (MSH2-MSH6) or MutS beta (MSH2-MSH6) binding to a dsDNA mismatch, then MutL alpha is recruited to the heteroduplex. Assembly of the MutL-MutS-heteroduplex ternary complex in presence of RFC and PCNA is sufficient to activate endonuclease activity of PMS2. It introduces single-strand breaks near the mismatch and thus generates new entry points for the exonuclease EXO1 to degrade the strand containing the mismatch. DNA methylation would prevent cleavage and therefore assure that only the newly mutated DNA strand is going to be corrected. MulL alpha (MLH1-PMS2) interacts physically with the clamp loader subunits of DNA polymerase III, suggesting that it may play a role to recruit the DNA polymerase III to the site of the MMR. Also implicated in DNA damage signaling, a process which induces cell cycle arrest and can lead to apoptosis in case of major DNA damages.
Homo sapiens (taxid: 9606)
EC: 3EC: .EC: 1EC: .EC: -EC: .EC: -
>sp|P54279|PMS2_MOUSE Mismatch repair endonuclease PMS2 OS=Mus musculus GN=Pms2 PE=1 SV=1 Back     alignment and function description
>sp|Q54QA0|PMS1_DICDI Mismatch repair endonuclease pms1 OS=Dictyostelium discoideum GN=pms1 PE=3 SV=1 Back     alignment and function description
>sp|A4D2B8|PM2P1_HUMAN Putative postmeiotic segregation increased 2-like protein 1 OS=Homo sapiens GN=PMS2P1 PE=5 SV=1 Back     alignment and function description
>sp|O95744|PM2P2_HUMAN Putative postmeiotic segregation increased 2-like protein 2 OS=Homo sapiens GN=PMS2P2 PE=5 SV=1 Back     alignment and function description
>sp|P14242|PMS1_YEAST DNA mismatch repair protein PMS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMS1 PE=1 SV=3 Back     alignment and function description
>sp|P54280|PMS1_SCHPO DNA mismatch repair protein pms1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pms1 PE=3 SV=1 Back     alignment and function description
>sp|P54277|PMS1_HUMAN PMS1 protein homolog 1 OS=Homo sapiens GN=PMS1 PE=1 SV=1 Back     alignment and function description
>sp|P70754|MUTL_AQUPY DNA mismatch repair protein MutL OS=Aquifex pyrophilus GN=mutL PE=3 SV=1 Back     alignment and function description
>sp|Q9JYT2|MUTL_NEIMB DNA mismatch repair protein MutL OS=Neisseria meningitidis serogroup B (strain MC58) GN=mutL PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query172
328723290 364 PREDICTED: mismatch repair endonuclease 0.982 0.464 0.715 1e-64
301604746 848 PREDICTED: mismatch repair endonuclease 0.982 0.199 0.680 3e-61
17942770 364 Chain A, N-Terminal 40kda Fragment Of Nh 0.982 0.464 0.668 5e-61
58737035 461 postmeiotic segregation increased 2 nirs 0.982 0.366 0.668 5e-61
17942778 365 Chain A, Hpms2-atpgs gi|17942779|pdb|1H7 0.982 0.463 0.668 5e-61
170063399 860 DNA mismatch repair protein pms1 [Culex 0.982 0.196 0.680 5e-61
157136917 926 DNA mismatch repair protein pms2 [Aedes 0.982 0.182 0.668 9e-61
17942780 365 Chain A, N-Terminal 40kda Fragment Of Hu 0.982 0.463 0.662 2e-60
114612035 862 PREDICTED: mismatch repair endonuclease 0.982 0.196 0.668 4e-60
157124912 874 DNA mismatch repair protein pms2 [Aedes 0.982 0.193 0.662 6e-60
>gi|328723290|ref|XP_001947410.2| PREDICTED: mismatch repair endonuclease PMS2-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  250 bits (639), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 121/169 (71%), Positives = 140/169 (82%)

Query: 3   VVLNLATAVKELVENSLDAGATSVEVKLKDYGSELVEVTDNGGGVHEDNYEGLTLKHHTS 62
           VVLNLATAVKEL+ENSLDAGATSV +KLK++G +LVEVTDNG GVH DN+EGL LKHHTS
Sbjct: 21  VVLNLATAVKELIENSLDAGATSVGIKLKEFGKDLVEVTDNGSGVHPDNFEGLALKHHTS 80

Query: 63  KLREFTDLTSVETFGFRGEALSSLCALSSVVIVTRHKLSGVGHWLEFDHHGHIKTKTLVS 122
           K+++F DLTSVETFGFRGEALSSLCALS V + TRH     G  L FDH G+IK K  V+
Sbjct: 81  KIKDFADLTSVETFGFRGEALSSLCALSDVTVTTRHSSQECGTKLVFDHTGNIKLKVPVA 140

Query: 123 RQVGTTVSLHNIFSTLPVRQKEFHRHLKKEFAKMTQVLYGYCLVALGVK 171
           +QVGT V+L N+FS+LPVR KEFHR+LKK+F KM QV+ GYCLVA  VK
Sbjct: 141 KQVGTAVTLSNLFSSLPVRHKEFHRNLKKDFGKMIQVVTGYCLVATQVK 189

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|301604746|ref|XP_002932025.1| PREDICTED: mismatch repair endonuclease PMS2-like [Xenopus (Silurana) tropicalis] Back     alignment and taxonomy information
>gi|17942770|pdb|1EA6|A Chain A, N-Terminal 40kda Fragment Of Nhpms2 Complexed With Adp gi|17942771|pdb|1EA6|B Chain B, N-Terminal 40kda Fragment Of Nhpms2 Complexed With Adp Back     alignment and taxonomy information
>gi|58737035|dbj|BAD89426.1| postmeiotic segregation increased 2 nirs variant 2 [Homo sapiens] Back     alignment and taxonomy information
>gi|17942778|pdb|1H7U|A Chain A, Hpms2-atpgs gi|17942779|pdb|1H7U|B Chain B, Hpms2-atpgs Back     alignment and taxonomy information
>gi|170063399|ref|XP_001867088.1| DNA mismatch repair protein pms1 [Culex quinquefasciatus] gi|167881032|gb|EDS44415.1| DNA mismatch repair protein pms1 [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|157136917|ref|XP_001663861.1| DNA mismatch repair protein pms2 [Aedes aegypti] gi|108869823|gb|EAT34048.1| AAEL013690-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|17942780|pdb|1H7S|A Chain A, N-Terminal 40kda Fragment Of Human Pms2 gi|17942781|pdb|1H7S|B Chain B, N-Terminal 40kda Fragment Of Human Pms2 Back     alignment and taxonomy information
>gi|114612035|ref|XP_001141671.1| PREDICTED: mismatch repair endonuclease PMS2 isoform 2 [Pan troglodytes] Back     alignment and taxonomy information
>gi|157124912|ref|XP_001660584.1| DNA mismatch repair protein pms2 [Aedes aegypti] gi|108873824|gb|EAT38049.1| AAEL010033-PA [Aedes aegypti] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query172
UNIPROTKB|P54278 862 PMS2 "Mismatch repair endonucl 0.982 0.196 0.615 3.7e-51
UNIPROTKB|E1BA65 675 PMS2 "Uncharacterized protein" 0.982 0.250 0.621 6.5e-51
UNIPROTKB|F1NQJ2 878 Gga.22468 "Uncharacterized pro 0.982 0.192 0.603 1.1e-50
UNIPROTKB|F1RFM9 852 PMS2 "Uncharacterized protein" 0.982 0.198 0.603 5.6e-50
UNIPROTKB|D3ZZF0 850 Pms2 "Protein Pms2" [Rattus no 0.982 0.198 0.591 9.1e-50
UNIPROTKB|F1PNW0 866 PMS2 "Uncharacterized protein" 0.982 0.195 0.591 1.7e-49
UNIPROTKB|F1PNU2 897 PMS2 "Uncharacterized protein" 0.982 0.188 0.591 2e-49
MGI|MGI:104288 859 Pms2 "postmeiotic segregation 0.982 0.196 0.579 5.7e-49
FB|FBgn0011660 899 Pms2 "Pms2" [Drosophila melano 0.982 0.187 0.609 1.5e-48
ZFIN|ZDB-GENE-030131-686 851 pms2 "PMS2 postmeiotic segrega 0.982 0.198 0.603 2.5e-48
UNIPROTKB|P54278 PMS2 "Mismatch repair endonuclease PMS2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 537 (194.1 bits), Expect = 3.7e-51, P = 3.7e-51
 Identities = 104/169 (61%), Positives = 130/169 (76%)

Query:     3 VVLNLATAVKELVENSLDAGATSVEVKLKDYGSELVEVTDNGGGVHEDNYEGLTLKHHTS 62
             VVL+L+TAVKELVENSLDAGAT++++KLKDYG +L+EV+DNG GV E+N+EGLTLKHHTS
Sbjct:    31 VVLSLSTAVKELVENSLDAGATNIDLKLKDYGVDLIEVSDNGCGVEEENFEGLTLKHHTS 90

Query:    63 KLREFTDLTSVETFGFRGEXXXXXXXXXXVVIVTRHKLSGVGHWLEFDHHGHIKTKTLVS 122
             K++EF DLT VETFGFRGE          V I T H  + VG  L FDH+G I  KT   
Sbjct:    91 KIQEFADLTQVETFGFRGEALSSLCALSDVTISTCHASAKVGTRLMFDHNGKIIQKTPYP 150

Query:   123 RQVGTTVSLHNIFSTLPVRQKEFHRHLKKEFAKMTQVLYGYCLVALGVK 171
             R  GTTVS+  +FSTLPVR KEF R++KKE+AKM QVL+ YC+++ G++
Sbjct:   151 RPRGTTVSVQQLFSTLPVRHKEFQRNIKKEYAKMVQVLHAYCIISAGIR 199
GO:0005524 "ATP binding" evidence=IEA
GO:0004519 "endonuclease activity" evidence=IEA
GO:0016447 "somatic recombination of immunoglobulin gene segments" evidence=IEA
GO:0042493 "response to drug" evidence=IEA
GO:0007131 "reciprocal meiotic recombination" evidence=IBA
GO:0016446 "somatic hypermutation of immunoglobulin genes" evidence=IBA
GO:0016887 "ATPase activity" evidence=IBA
GO:0032300 "mismatch repair complex" evidence=IBA
GO:0032389 "MutLalpha complex" evidence=IBA
GO:0005515 "protein binding" evidence=IPI
GO:0032407 "MutSalpha complex binding" evidence=IDA
GO:0003677 "DNA binding" evidence=IDA
GO:0005634 "nucleus" evidence=IC
GO:0006298 "mismatch repair" evidence=IDA
GO:0032138 "single base insertion or deletion binding" evidence=IDA
GO:0003697 "single-stranded DNA binding" evidence=IDA
GO:0006200 "ATP catabolic process" evidence=IBA
UNIPROTKB|E1BA65 PMS2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1NQJ2 Gga.22468 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1RFM9 PMS2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|D3ZZF0 Pms2 "Protein Pms2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1PNW0 PMS2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1PNU2 PMS2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:104288 Pms2 "postmeiotic segregation increased 2 (S. cerevisiae)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
FB|FBgn0011660 Pms2 "Pms2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-686 pms2 "PMS2 postmeiotic segregation increased 2 (S. cerevisiae)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P54278PMS2_HUMAN3, ., 1, ., -, ., -0.66860.98250.1960yesN/A
Q54QA0PMS1_DICDINo assigned EC number0.55020.98250.1653yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query172
TIGR00585 312 TIGR00585, mutl, DNA mismatch repair protein MutL 1e-62
COG0323 638 COG0323, MutL, DNA mismatch repair enzyme (predict 2e-48
PRK00095 617 PRK00095, mutL, DNA mismatch repair protein; Revie 3e-41
pfam13589134 pfam13589, HATPase_c_3, Histidine kinase-, DNA gyr 9e-12
cd00075103 cd00075, HATPase_c, Histidine kinase-like ATPases; 9e-06
PRK04184 535 PRK04184, PRK04184, DNA topoisomerase VI subunit B 4e-05
pfam02518111 pfam02518, HATPase_c, Histidine kinase-, DNA gyras 8e-05
COG3290537 COG3290, CitA, Signal transduction histidine kinas 0.003
PRK09470461 PRK09470, cpxA, two-component sensor protein; Prov 0.004
>gnl|CDD|233035 TIGR00585, mutl, DNA mismatch repair protein MutL Back     alignment and domain information 
 Score =  195 bits (497), Expect = 1e-62
 Identities = 68/164 (41%), Positives = 103/164 (62%), Gaps = 1/164 (0%)

Query: 3   VVLNLATAVKELVENSLDAGATSVEVKLKDYGSELVEVTDNGGGVHEDNYEGLTLKHHTS 62
           V+   A+ VKELVENSLDAGAT ++V++++ G +L+EV+DNG G+ +++      +H TS
Sbjct: 19  VIERPASVVKELVENSLDAGATRIDVEIEEGGLKLIEVSDNGSGIDKEDLPLACERHATS 78

Query: 63  KLREFTDLTSVETFGFRGEALSSLCALSSVVIVTRHKLSGVGHWLEFDHHGHIKTKTLVS 122
           K++ F DL  +ET GFRGEAL+S+ ++S + I T+   +    +      G I++     
Sbjct: 79  KIQSFEDLERIETLGFRGEALASISSVSRLTITTKTSAADGLAYQALLEGGMIESIKPAP 138

Query: 123 RQVGTTVSLHNIFSTLPVRQKEFHRHLKKEFAKMTQVLYGYCLV 166
           R VGTTV + ++F  LPVR+K      KKEF K+  VL  Y L+
Sbjct: 139 RPVGTTVEVRDLFYNLPVRRKFLKSP-KKEFRKILDVLQRYALI 181

All proteins in this family for which the functions are known are involved in the process of generalized mismatch repair. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University) [DNA metabolism, DNA replication, recombination, and repair]. Length = 312
>gnl|CDD|223400 COG0323, MutL, DNA mismatch repair enzyme (predicted ATPase) [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|234630 PRK00095, mutL, DNA mismatch repair protein; Reviewed Back     alignment and domain information
>gnl|CDD|222246 pfam13589, HATPase_c_3, Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase Back     alignment and domain information
>gnl|CDD|238030 cd00075, HATPase_c, Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins Back     alignment and domain information
>gnl|CDD|235246 PRK04184, PRK04184, DNA topoisomerase VI subunit B; Validated Back     alignment and domain information
>gnl|CDD|217081 pfam02518, HATPase_c, Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase Back     alignment and domain information
>gnl|CDD|225827 COG3290, CitA, Signal transduction histidine kinase regulating citrate/malate metabolism [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|236532 PRK09470, cpxA, two-component sensor protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 172
COG0323 638 MutL DNA mismatch repair enzyme (predicted ATPase) 100.0
PRK00095 617 mutL DNA mismatch repair protein; Reviewed 100.0
TIGR00585 312 mutl DNA mismatch repair protein MutL. All protein 100.0
KOG1979|consensus 694 100.0
KOG1978|consensus 672 100.0
KOG1977|consensus 1142 99.92
PRK14868 795 DNA topoisomerase VI subunit B; Provisional 99.89
TIGR01052 488 top6b DNA topoisomerase VI, B subunit. This model 99.88
TIGR01055 625 parE_Gneg DNA topoisomerase IV, B subunit, proteob 99.88
PRK05559 631 DNA topoisomerase IV subunit B; Reviewed 99.86
smart00433 594 TOP2c TopoisomeraseII. Eukaryotic DNA topoisomeras 99.84
PRK14939 756 gyrB DNA gyrase subunit B; Provisional 99.84
PRK05644 638 gyrB DNA gyrase subunit B; Validated 99.84
TIGR01059 654 gyrB DNA gyrase, B subunit. This model describes t 99.84
PRK04184 535 DNA topoisomerase VI subunit B; Validated 99.84
PRK14867 659 DNA topoisomerase VI subunit B; Provisional 99.81
PRK05218 613 heat shock protein 90; Provisional 99.8
COG0326 623 HtpG Molecular chaperone, HSP90 family [Posttransl 99.76
PRK14083 601 HSP90 family protein; Provisional 99.76
COG1389 538 DNA topoisomerase VI, subunit B [DNA replication, 99.75
PF13589137 HATPase_c_3: Histidine kinase-, DNA gyrase B-, and 99.73
PTZ00130 814 heat shock protein 90; Provisional 99.71
PTZ00272 701 heat shock protein 83 kDa (Hsp83); Provisional 99.67
TIGR01058 637 parE_Gpos DNA topoisomerase IV, B subunit, Gram-po 99.64
COG0187 635 GyrB Type IIA topoisomerase (DNA gyrase/topo II, t 99.64
PTZ00109 903 DNA gyrase subunit b; Provisional 99.55
PHA02569 602 39 DNA topoisomerase II large subunit; Provisional 99.5
PTZ00108 1388 DNA topoisomerase 2-like protein; Provisional 99.43
PLN03128 1135 DNA topoisomerase 2; Provisional 99.4
PF02518111 HATPase_c: Histidine kinase-, DNA gyrase B-, and H 99.38
PLN03237 1465 DNA topoisomerase 2; Provisional 99.34
COG4191603 Signal transduction histidine kinase regulating C4 99.31
PRK10604433 sensor protein RstB; Provisional 99.23
TIGR02938494 nifL_nitrog nitrogen fixation negative regulator N 99.23
PRK11006430 phoR phosphate regulon sensor protein; Provisional 99.16
PRK09303380 adaptive-response sensory kinase; Validated 99.15
PRK10364457 sensor protein ZraS; Provisional 99.14
COG3290537 CitA Signal transduction histidine kinase regulati 99.14
PRK15053545 dpiB sensor histidine kinase DpiB; Provisional 99.13
TIGR01386457 cztS_silS_copS heavy metal sensor kinase. Members 99.1
KOG0019|consensus 656 99.1
PRK10815485 sensor protein PhoQ; Provisional 99.1
PRK10549466 signal transduction histidine-protein kinase BaeS; 99.07
PRK09467435 envZ osmolarity sensor protein; Provisional 99.06
PRK09470461 cpxA two-component sensor protein; Provisional 99.06
PRK10755356 sensor protein BasS/PmrB; Provisional 99.05
COG2205890 KdpD Osmosensitive K+ channel histidine kinase [Si 99.04
KOG0020|consensus 785 99.03
PRK15347 921 two component system sensor kinase SsrA; Provision 99.03
PRK11086542 sensory histidine kinase DcuS; Provisional 99.02
TIGR02916679 PEP_his_kin putative PEP-CTERM system histidine ki 98.96
PRK11091 779 aerobic respiration control sensor protein ArcB; P 98.94
PRK11100475 sensory histidine kinase CreC; Provisional 98.93
PRK10337449 sensor protein QseC; Provisional 98.92
PRK10618 894 phosphotransfer intermediate protein in two-compon 98.92
PRK10490895 sensor protein KdpD; Provisional 98.91
PRK13837828 two-component VirA-like sensor kinase; Provisional 98.9
TIGR02956 968 TMAO_torS TMAO reductase sytem sensor TorS. This p 98.87
PRK09835482 sensor kinase CusS; Provisional 98.87
COG0642336 BaeS Signal transduction histidine kinase [Signal 98.87
PRK11466 914 hybrid sensory histidine kinase TorS; Provisional 98.87
TIGR02966333 phoR_proteo phosphate regulon sensor kinase PhoR. 98.84
PRK11073348 glnL nitrogen regulation protein NR(II); Provision 98.84
PRK11360607 sensory histidine kinase AtoS; Provisional 98.83
PRK10841 924 hybrid sensory kinase in two-component regulatory 98.82
TIGR03785703 marine_sort_HK proteobacterial dedicated sortase s 98.81
PRK11107 919 hybrid sensory histidine kinase BarA; Provisional 98.76
COG3852363 NtrB Signal transduction histidine kinase, nitroge 98.75
PRK09959 1197 hybrid sensory histidine kinase in two-component r 98.73
PRK13557540 histidine kinase; Provisional 98.73
COG5002459 VicK Signal transduction histidine kinase [Signal 98.67
TIGR01925137 spIIAB anti-sigma F factor. This model describes t 98.65
cd00075103 HATPase_c Histidine kinase-like ATPases; This fami 98.64
smart00387111 HATPase_c Histidine kinase-like ATPases. Histidine 98.62
COG0643716 CheA Chemotaxis protein histidine kinase and relat 98.59
PRK10547670 chemotaxis protein CheA; Provisional 98.57
COG5000712 NtrY Signal transduction histidine kinase involved 98.51
PRK04069161 serine-protein kinase RsbW; Provisional 98.45
COG4192673 Signal transduction histidine kinase regulating ph 98.44
TIGR01924159 rsbW_low_gc serine-protein kinase RsbW. This model 98.39
PRK03660146 anti-sigma F factor; Provisional 98.35
PRK13560807 hypothetical protein; Provisional 98.27
PRK11644495 sensory histidine kinase UhpB; Provisional 98.24
PF13581125 HATPase_c_2: Histidine kinase-like ATPase domain 98.18
PRK10600569 nitrate/nitrite sensor protein NarX; Provisional 98.17
COG2972456 Predicted signal transduction protein with a C-ter 98.06
COG4251750 Bacteriophytochrome (light-regulated signal transd 98.06
COG4585365 Signal transduction histidine kinase [Signal trans 98.06
COG3851497 UhpB Signal transduction histidine kinase, glucose 97.79
PRK10935565 nitrate/nitrite sensor protein NarQ; Provisional 97.78
COG2172146 RsbW Anti-sigma regulatory factor (Ser/Thr protein 97.72
COG3850574 NarQ Signal transduction histidine kinase, nitrate 97.54
KOG0787|consensus414 97.49
COG3920221 Signal transduction histidine kinase [Signal trans 97.28
KOG0355|consensus 842 97.0
PRK13559361 hypothetical protein; Provisional 96.95
COG4564459 Signal transduction histidine kinase [Signal trans 96.93
COG3275557 LytS Putative regulator of cell autolysis [Signal 96.6
PF14501100 HATPase_c_5: GHKL domain 96.03
>COG0323 MutL DNA mismatch repair enzyme (predicted ATPase) [DNA replication, recombination, and repair] Back     alignment and domain information 
Probab=100.00  E-value=1.2e-38  Score=280.97  Aligned_cols=169  Identities=36%  Similarity=0.583  Sum_probs=157.8

Q ss_pred             CceeccHHHHHHHHHHhHhhcCCCeEEEEEEeCCceEEEEEeCCCCCChhhHHhhhccCccCCcccccccccccccCccc
Q psy13669          1 MAVVLNLATAVKELVENSLDAGATSVEVKLKDYGSELVEVTDNGGGVHEDNYEGLTLKHHTSKLREFTDLTSVETFGFRG   80 (172)
Q Consensus         1 ~~~i~~~~~~l~eLi~Na~da~a~~i~i~~~~~~~~~i~V~DnG~Gi~~~~l~~~~~~~~~sk~~~~~~~~~~~~~G~~G   80 (172)
                      +|+|.+|..+|+|||+||+||+|+.|.|.+..++...|.|.|||+||++++++.++.+|+|||..+..|+....++||||
T Consensus        18 GEVIerPaSVVKELVENSlDAGAt~I~I~ve~gG~~~I~V~DNG~Gi~~~Dl~la~~rHaTSKI~~~~DL~~I~TlGFRG   97 (638)
T COG0323          18 GEVIERPASVVKELVENSLDAGATRIDIEVEGGGLKLIRVRDNGSGIDKEDLPLALLRHATSKIASLEDLFRIRTLGFRG   97 (638)
T ss_pred             cceeecHHHHHHHHHhcccccCCCEEEEEEccCCccEEEEEECCCCCCHHHHHHHHhhhccccCCchhHHHHhhccCccH
Confidence            58999999999999999999999999999988888889999999999999999999999999999999999999999999


Q ss_pred             chhcccccccceEEEEeecCCCceEEEEEecCCeEE-EeeeecCCCceEEEEcccccCChHhHHHHhHhHHHHHHHHHHH
Q psy13669         81 EALSSLCALSSVVIVTRHKLSGVGHWLEFDHHGHIK-TKTLVSRQVGTTVSLHNIFSTLPVRQKEFHRHLKKEFAKMTQV  159 (172)
Q Consensus        81 ~gl~s~~~~~~v~i~T~~~~~~~~~~~~~~~~g~~~-~~~~~~~~~GT~V~i~~lf~~~p~r~~~~~~~~~~~~~~i~~~  159 (172)
                      .+|+|++.+|+++|+||+.+...+|++.++ .|.+. ...+...+.||+|+|+|||+|+|+|++ |+++.+.++..|.++
T Consensus        98 EAL~SIasVsrlti~Srt~~~~~~~~~~~~-g~~~~~~~~p~a~~~GTtVeV~dLF~NtPaRrK-flks~~~E~~~i~~v  175 (638)
T COG0323          98 EALASIASVSRLTITSRTAEASEGTQIYAE-GGGMEVTVKPAAHPVGTTVEVRDLFYNTPARRK-FLKSEKTEFGHITEL  175 (638)
T ss_pred             HHHHHHHhhheeEEEeecCCcCceEEEEec-CCcccccccCCCCCCCCEEEehHhhccChHHHH-hhcccHHHHHHHHHH
Confidence            999999999999999998887888999987 55554 556667788999999999999999999 889999999999999


Q ss_pred             HHHhhhhcCCCC
Q psy13669        160 LYGYCLVALGVK  171 (172)
Q Consensus       160 l~~~a~~~p~i~  171 (172)
                      +++||++||+|+
T Consensus       176 v~r~ALahp~I~  187 (638)
T COG0323         176 INRYALAHPDIS  187 (638)
T ss_pred             HHHHHhcCCCeE
Confidence            999999999985

>PRK00095 mutL DNA mismatch repair protein; Reviewed Back     alignment and domain information
>TIGR00585 mutl DNA mismatch repair protein MutL Back     alignment and domain information
>KOG1979|consensus Back     alignment and domain information
>KOG1978|consensus Back     alignment and domain information
>KOG1977|consensus Back     alignment and domain information
>PRK14868 DNA topoisomerase VI subunit B; Provisional Back     alignment and domain information
>TIGR01052 top6b DNA topoisomerase VI, B subunit Back     alignment and domain information
>TIGR01055 parE_Gneg DNA topoisomerase IV, B subunit, proteobacterial Back     alignment and domain information
>PRK05559 DNA topoisomerase IV subunit B; Reviewed Back     alignment and domain information
>smart00433 TOP2c TopoisomeraseII Back     alignment and domain information
>PRK14939 gyrB DNA gyrase subunit B; Provisional Back     alignment and domain information
>PRK05644 gyrB DNA gyrase subunit B; Validated Back     alignment and domain information
>TIGR01059 gyrB DNA gyrase, B subunit Back     alignment and domain information
>PRK04184 DNA topoisomerase VI subunit B; Validated Back     alignment and domain information
>PRK14867 DNA topoisomerase VI subunit B; Provisional Back     alignment and domain information
>PRK05218 heat shock protein 90; Provisional Back     alignment and domain information
>COG0326 HtpG Molecular chaperone, HSP90 family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14083 HSP90 family protein; Provisional Back     alignment and domain information
>COG1389 DNA topoisomerase VI, subunit B [DNA replication, recombination, and repair] Back     alignment and domain information
>PF13589 HATPase_c_3: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase; PDB: 3IED_A 2XCM_B 2JKI_B 3OPD_A 2O1V_B 2GQP_A 2O1W_C 1YT2_A 1TC6_A 2H8M_B Back     alignment and domain information
>PTZ00130 heat shock protein 90; Provisional Back     alignment and domain information
>PTZ00272 heat shock protein 83 kDa (Hsp83); Provisional Back     alignment and domain information
>TIGR01058 parE_Gpos DNA topoisomerase IV, B subunit, Gram-positive Back     alignment and domain information
>COG0187 GyrB Type IIA topoisomerase (DNA gyrase/topo II, topoisomerase IV), B subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PTZ00109 DNA gyrase subunit b; Provisional Back     alignment and domain information
>PHA02569 39 DNA topoisomerase II large subunit; Provisional Back     alignment and domain information
>PTZ00108 DNA topoisomerase 2-like protein; Provisional Back     alignment and domain information
>PLN03128 DNA topoisomerase 2; Provisional Back     alignment and domain information
>PF02518 HATPase_c: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase; InterPro: IPR003594 This domain is found in several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases [], heat shock protein HSP90 [, , ], phytochrome-like ATPases and DNA mismatch repair proteins Back     alignment and domain information
>PLN03237 DNA topoisomerase 2; Provisional Back     alignment and domain information
>COG4191 Signal transduction histidine kinase regulating C4-dicarboxylate transport system [Signal transduction mechanisms] Back     alignment and domain information
>PRK10604 sensor protein RstB; Provisional Back     alignment and domain information
>TIGR02938 nifL_nitrog nitrogen fixation negative regulator NifL Back     alignment and domain information
>PRK11006 phoR phosphate regulon sensor protein; Provisional Back     alignment and domain information
>PRK09303 adaptive-response sensory kinase; Validated Back     alignment and domain information
>PRK10364 sensor protein ZraS; Provisional Back     alignment and domain information
>COG3290 CitA Signal transduction histidine kinase regulating citrate/malate metabolism [Signal transduction mechanisms] Back     alignment and domain information
>PRK15053 dpiB sensor histidine kinase DpiB; Provisional Back     alignment and domain information
>TIGR01386 cztS_silS_copS heavy metal sensor kinase Back     alignment and domain information
>KOG0019|consensus Back     alignment and domain information
>PRK10815 sensor protein PhoQ; Provisional Back     alignment and domain information
>PRK10549 signal transduction histidine-protein kinase BaeS; Provisional Back     alignment and domain information
>PRK09467 envZ osmolarity sensor protein; Provisional Back     alignment and domain information
>PRK09470 cpxA two-component sensor protein; Provisional Back     alignment and domain information
>PRK10755 sensor protein BasS/PmrB; Provisional Back     alignment and domain information
>COG2205 KdpD Osmosensitive K+ channel histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0020|consensus Back     alignment and domain information
>PRK15347 two component system sensor kinase SsrA; Provisional Back     alignment and domain information
>PRK11086 sensory histidine kinase DcuS; Provisional Back     alignment and domain information
>TIGR02916 PEP_his_kin putative PEP-CTERM system histidine kinase Back     alignment and domain information
>PRK11091 aerobic respiration control sensor protein ArcB; Provisional Back     alignment and domain information
>PRK11100 sensory histidine kinase CreC; Provisional Back     alignment and domain information
>PRK10337 sensor protein QseC; Provisional Back     alignment and domain information
>PRK10618 phosphotransfer intermediate protein in two-component regulatory system with RcsBC; Provisional Back     alignment and domain information
>PRK10490 sensor protein KdpD; Provisional Back     alignment and domain information
>PRK13837 two-component VirA-like sensor kinase; Provisional Back     alignment and domain information
>TIGR02956 TMAO_torS TMAO reductase sytem sensor TorS Back     alignment and domain information
>PRK09835 sensor kinase CusS; Provisional Back     alignment and domain information
>COG0642 BaeS Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK11466 hybrid sensory histidine kinase TorS; Provisional Back     alignment and domain information
>TIGR02966 phoR_proteo phosphate regulon sensor kinase PhoR Back     alignment and domain information
>PRK11073 glnL nitrogen regulation protein NR(II); Provisional Back     alignment and domain information
>PRK11360 sensory histidine kinase AtoS; Provisional Back     alignment and domain information
>PRK10841 hybrid sensory kinase in two-component regulatory system with RcsB and YojN; Provisional Back     alignment and domain information
>TIGR03785 marine_sort_HK proteobacterial dedicated sortase system histidine kinase Back     alignment and domain information
>PRK11107 hybrid sensory histidine kinase BarA; Provisional Back     alignment and domain information
>COG3852 NtrB Signal transduction histidine kinase, nitrogen specific [Signal transduction mechanisms] Back     alignment and domain information
>PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional Back     alignment and domain information
>PRK13557 histidine kinase; Provisional Back     alignment and domain information
>COG5002 VicK Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>TIGR01925 spIIAB anti-sigma F factor Back     alignment and domain information
>cd00075 HATPase_c Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins Back     alignment and domain information
>smart00387 HATPase_c Histidine kinase-like ATPases Back     alignment and domain information
>COG0643 CheA Chemotaxis protein histidine kinase and related kinases [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>PRK10547 chemotaxis protein CheA; Provisional Back     alignment and domain information
>COG5000 NtrY Signal transduction histidine kinase involved in nitrogen fixation and metabolism regulation [Signal transduction mechanisms] Back     alignment and domain information
>PRK04069 serine-protein kinase RsbW; Provisional Back     alignment and domain information
>COG4192 Signal transduction histidine kinase regulating phosphoglycerate transport system [Signal transduction mechanisms] Back     alignment and domain information
>TIGR01924 rsbW_low_gc serine-protein kinase RsbW Back     alignment and domain information
>PRK03660 anti-sigma F factor; Provisional Back     alignment and domain information
>PRK13560 hypothetical protein; Provisional Back     alignment and domain information
>PRK11644 sensory histidine kinase UhpB; Provisional Back     alignment and domain information
>PF13581 HATPase_c_2: Histidine kinase-like ATPase domain Back     alignment and domain information
>PRK10600 nitrate/nitrite sensor protein NarX; Provisional Back     alignment and domain information
>COG2972 Predicted signal transduction protein with a C-terminal ATPase domain [Signal transduction mechanisms] Back     alignment and domain information
>COG4251 Bacteriophytochrome (light-regulated signal transduction histidine kinase) [Signal transduction mechanisms] Back     alignment and domain information
>COG4585 Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>COG3851 UhpB Signal transduction histidine kinase, glucose-6-phosphate specific [Signal transduction mechanisms] Back     alignment and domain information
>PRK10935 nitrate/nitrite sensor protein NarQ; Provisional Back     alignment and domain information
>COG2172 RsbW Anti-sigma regulatory factor (Ser/Thr protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>COG3850 NarQ Signal transduction histidine kinase, nitrate/nitrite-specific [Signal transduction mechanisms] Back     alignment and domain information
>KOG0787|consensus Back     alignment and domain information
>COG3920 Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0355|consensus Back     alignment and domain information
>PRK13559 hypothetical protein; Provisional Back     alignment and domain information
>COG4564 Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>COG3275 LytS Putative regulator of cell autolysis [Signal transduction mechanisms] Back     alignment and domain information
>PF14501 HATPase_c_5: GHKL domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query172
1h7u_A 365 Hpms2-atpgs Length = 365 9e-58
1ea6_A 364 N-Terminal 40kda Fragment Of Nhpms2 Complexed With 9e-58
1h7s_A 365 N-Terminal 40kda Fragment Of Human Pms2 Length = 36 5e-57
3h4l_A 367 Crystal Structure Of N Terminal Domain Of A Dna Rep 6e-38
3na3_A 348 Mutl Protein Homolog 1 Isoform 1 From Homo Sapiens 2e-18
1b62_A 355 Mutl Complexed With Adp Length = 355 9e-18
1bkn_A 352 Crystal Structure Of An N-Terminal 40kd Fragment Of 1e-17
1b63_A 333 Mutl Complexed With Adpnp Length = 333 1e-17
1nhj_A 333 Crystal Structure Of N-Terminal 40kd MutlA100P MUTA 1e-17
>pdb|1H7U|A Chain A, Hpms2-atpgs Length = 365 Back     alignment and structure 
Iteration: 1

 Score =  218 bits (556), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 104/169 (61%), Positives = 130/169 (76%)
Query: 3   VVLNLATAVKELVENSLDAGATSVEVKLKDYGSELVEVTDNGGGVHEDNYEGLTLKHHTS 62
           VVL+L+TAVKELVENSLDAGAT++++KLKDYG +L+EV+DNG GV E+N+EGLTLKHHTS
Sbjct: 31  VVLSLSTAVKELVENSLDAGATNIDLKLKDYGVDLIEVSDNGCGVEEENFEGLTLKHHTS 90
Query: 63  KLREFTDLTSVETFGFRGEXXXXXXXXXXVVIVTRHKLSGVGHWLEFDHHGHIKTKTLVS 122
           K++EF DLT VETFGFRGE          V I T H  + VG  L FDH+G I  KT   
Sbjct: 91  KIQEFADLTQVETFGFRGEALSSLCALSDVTISTCHASAKVGTRLMFDHNGKIIQKTPYP 150
Query: 123 RQVGTTVSLHNIFSTLPVRQKEFHRHLKKEFAKMTQVLYGYCLVALGVK 171
           R  GTTVS+  +FSTLPVR KEF R++KKE+AKM QVL+ YC+++ G++
Sbjct: 151 RPRGTTVSVQQLFSTLPVRHKEFQRNIKKEYAKMVQVLHAYCIISAGIR 199
>pdb|1EA6|A Chain A, N-Terminal 40kda Fragment Of Nhpms2 Complexed With Adp Length = 364 Back     alignment and structure
>pdb|1H7S|A Chain A, N-Terminal 40kda Fragment Of Human Pms2 Length = 365 Back     alignment and structure
>pdb|3H4L|A Chain A, Crystal Structure Of N Terminal Domain Of A Dna Repair Prote Length = 367 Back     alignment and structure
>pdb|3NA3|A Chain A, Mutl Protein Homolog 1 Isoform 1 From Homo Sapiens Length = 348 Back     alignment and structure
>pdb|1B62|A Chain A, Mutl Complexed With Adp Length = 355 Back     alignment and structure
>pdb|1BKN|A Chain A, Crystal Structure Of An N-Terminal 40kd Fragment Of E. Coli Dna Mismatch Repair Protein Mutl Length = 352 Back     alignment and structure
>pdb|1B63|A Chain A, Mutl Complexed With Adpnp Length = 333 Back     alignment and structure
>pdb|1NHJ|A Chain A, Crystal Structure Of N-Terminal 40kd MutlA100P MUTANT PROTEIN COMPLEX With Adpnp And One Sodium Length = 333 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query172
1h7s_A 365 PMS1 protein homolog 2; DNA repair, GHL ATPase, mi 7e-85
3h4l_A 367 DNA mismatch repair protein PMS1; ATP binding, DNA 1e-82
3na3_A 348 DNA mismatch repair protein MLH1; MUTL protein hom 1e-39
1b63_A 333 MUTL; DNA mismatch repair, ATPase; HET: ANP; 1.90A 3e-39
>1h7s_A PMS1 protein homolog 2; DNA repair, GHL ATPase, mismatch repair, HNPCC; 1.95A {Homo sapiens} SCOP: d.14.1.3 d.122.1.2 PDB: 1h7u_A* 1ea6_A* Length = 365 Back     alignment and structure
 Score =  252 bits (647), Expect = 7e-85
 Identities = 113/169 (66%), Positives = 139/169 (82%)

Query: 3   VVLNLATAVKELVENSLDAGATSVEVKLKDYGSELVEVTDNGGGVHEDNYEGLTLKHHTS 62
           VVL+L+TAVKELVENSLDAGAT++++KLKDYG +L+EV+DNG GV E+N+EGLTLKHHTS
Sbjct: 31  VVLSLSTAVKELVENSLDAGATNIDLKLKDYGVDLIEVSDNGCGVEEENFEGLTLKHHTS 90

Query: 63  KLREFTDLTSVETFGFRGEALSSLCALSSVVIVTRHKLSGVGHWLEFDHHGHIKTKTLVS 122
           K++EF DLT VETFGFRGEALSSLCALS V I T H  + VG  L FDH+G I  KT   
Sbjct: 91  KIQEFADLTQVETFGFRGEALSSLCALSDVTISTCHASAKVGTRLMFDHNGKIIQKTPYP 150

Query: 123 RQVGTTVSLHNIFSTLPVRQKEFHRHLKKEFAKMTQVLYGYCLVALGVK 171
           R  GTTVS+  +FSTLPVR KEF R++KKE+AKM QVL+ YC+++ G++
Sbjct: 151 RPRGTTVSVQQLFSTLPVRHKEFQRNIKKEYAKMVQVLHAYCIISAGIR 199
>3h4l_A DNA mismatch repair protein PMS1; ATP binding, DNA repair, DNA damage, nucleus, phosphop DNA binding protein, protein binding; HET: DNA ANP; 2.50A {Saccharomyces cerevisiae} Length = 367 Back     alignment and structure
>3na3_A DNA mismatch repair protein MLH1; MUTL protein homolog 1, DNA damag repair, structural genomics consortium, SGC, protein bindin; HET: DNA ATP; 2.50A {Homo sapiens} Length = 348 Back     alignment and structure
>1b63_A MUTL; DNA mismatch repair, ATPase; HET: ANP; 1.90A {Escherichia coli K12} SCOP: d.14.1.3 d.122.1.2 PDB: 1nhh_A* 1nhi_A* 1bkn_A 1nhj_A* 1b62_A* Length = 333 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query172
3h4l_A 367 DNA mismatch repair protein PMS1; ATP binding, DNA 100.0
3na3_A 348 DNA mismatch repair protein MLH1; MUTL protein hom 100.0
1h7s_A 365 PMS1 protein homolog 2; DNA repair, GHL ATPase, mi 100.0
1b63_A 333 MUTL; DNA mismatch repair, ATPase; HET: ANP; 1.90A 100.0
3fv5_A201 DNA topoisomerase 4 subunit B; topoisomerase IV B 99.95
3t0h_A228 Heat shock protein HSP 90-alpha; chaperone, ATPase 99.92
4duh_A220 DNA gyrase subunit B; structure-based drug design, 99.91
2ior_A235 Chaperone protein HTPG; heat shock protein, HSP90; 99.91
3o0i_A256 HSP90AA1 protein; HSP90 heat-shock proteins, chape 99.9
1ei1_A 391 DNA gyrase B, GYRB; ATPase domain, dimer, isomeras 99.9
1s16_A 390 Topoisomerase IV subunit B; two-domain protein com 99.9
1zxm_A 400 TOPO IIA ATPase, DNA topoisomerase II, alpha isozy 99.89
4emv_A226 DNA topoisomerase IV, B subunit; protein-inhibitor 99.88
2wer_A220 ATP-dependent molecular chaperone HSP82; ATPase, A 99.88
3cwv_A 369 DNA gyrase, B subunit, truncated; structural genom 99.87
1yc1_A264 HSP 86, heat shock protein HSP 90-alpha; cell-cycl 99.87
1kij_A 390 DNA gyrase subunit B; topoisomerase, gyrase B-coum 99.85
1y4s_A 559 Chaperone protein HTPG; HSP90, molecular chaperone 99.85
2gqp_A236 Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, 99.84
3lnu_A 408 Topoisomerase IV subunit B; PARE, ATP-binding, nuc 99.84
2ioq_A 624 Chaperone protein HTPG; heat shock protein, HSP90; 99.83
1qy5_A269 Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: N 99.82
3ttz_A198 DNA gyrase subunit B; protein-inhibitor complex, A 99.82
3nmq_A239 Heat shock protein HSP 90-beta; ATPase, chaperone- 99.8
3peh_A281 Endoplasmin homolog; structural genomics, structur 99.8
1mu5_A 471 Type II DNA topoisomerase VI subunit B; GHKL ATPas 99.79
2zbk_B 530 Type 2 DNA topoisomerase 6 subunit B; DNA binding 99.77
2o1u_A 666 Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, 99.76
2cg9_A 677 ATP-dependent molecular chaperone HSP82; chaperone 99.75
1pvg_A 418 DNA topoisomerase II; GHKL ATPase domain; HET: DNA 99.74
3ied_A272 Heat shock protein; HSP90, chaperone, structural g 99.74
2q2e_B 621 Type 2 DNA topoisomerase 6 subunit B; DNA-binding, 99.73
4gfh_A 1177 DNA topoisomerase 2; topoisomerase, protein-DNA co 99.42
2c2a_A258 Sensor histidine kinase; phosphotransfer, PHOQ, se 99.34
1id0_A152 PHOQ histidine kinase; PHOQ/PHOP, signal transduct 99.34
1bxd_A161 ENVZ(290-450), protein (osmolarity sensor protein 99.31
1ysr_A150 Sensor-type histidine kinase PRRB; ATP-binding dom 99.27
1i58_A189 Chemotaxis protein CHEA; beta-alpha sandwich, sign 99.22
1th8_A145 Anti-sigma F factor; SPOIIAB, SPOIIAA, anti-ANTI-s 99.22
3d36_A244 Sporulation kinase B; GHKL ATPase, four helix bund 99.22
2q8g_A407 [pyruvate dehydrogenase [lipoamide]] kinase isozy; 99.21
3jz3_A222 Sensor protein QSEC; helix-turn-helix, kinase doma 99.2
3a0y_A152 Sensor protein; ATP-LID, kinase, phosphoprotein, t 99.2
1y8o_A419 [pyruvate dehydrogenase [lipoamide]] kinase isozy; 99.18
2e0a_A394 Pyruvate dehydrogenase kinase isozyme 4; PDK4, ATP 99.18
2btz_A394 Pyruvate dehydrogenase kinase isoenzyme 2; GHKL mo 99.18
4ew8_A268 Sensor protein DIVL; signal transduction, two-comp 99.18
1gkz_A388 [3-methyl-2-oxobutanoate dehydrogenase [lipoamide] 99.16
1b3q_A379 Protein (chemotaxis protein CHEA); histine kinase, 99.14
3a0r_A349 Sensor protein; four helix bundle, PAS fold, kinas 99.12
3sl2_A177 Sensor histidine kinase YYCG; ATP binding, intact 99.11
1r62_A160 Nitrogen regulation protein NR(II); PII, histidine 99.06
3ehg_A128 Sensor kinase (YOCF protein); GHL ATPase domain, t 98.96
4fpp_A247 Phosphotransferase; four helix bundle, bergerat fo 98.95
3zxo_A129 Redox sensor histidine kinase response regulator; 98.88
3ehh_A218 Sensor kinase (YOCF protein); four-helix bundle, G 98.84
3zxq_A124 Hypoxia sensor histidine kinase response regulato; 98.81
3ke6_A399 Protein RV1364C/MT1410; anti-sigma factor, anti-si 97.89
1ixm_A192 SPO0B, protein (sporulation response regulatory pr 97.22
>3h4l_A DNA mismatch repair protein PMS1; ATP binding, DNA repair, DNA damage, nucleus, phosphop DNA binding protein, protein binding; HET: DNA ANP; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
Probab=100.00  E-value=5.5e-40  Score=272.49  Aligned_cols=170  Identities=48%  Similarity=0.772  Sum_probs=150.3

Q ss_pred             CceeccHHHHHHHHHHhHhhcCCCeEEEEEEeCCceEEEEEeCCCCCChhhHHhhhccCccCCcccccccccccccCccc
Q psy13669          1 MAVVLNLATAVKELVENSLDAGATSVEVKLKDYGSELVEVTDNGGGVHEDNYEGLTLKHHTSKLREFTDLTSVETFGFRG   80 (172)
Q Consensus         1 ~~~i~~~~~~l~eLi~Na~da~a~~i~i~~~~~~~~~i~V~DnG~Gi~~~~l~~~~~~~~~sk~~~~~~~~~~~~~G~~G   80 (172)
                      +|+|.++.++|.|||+||+||+|+.|.|.+.+++...|+|.|||+||++++++.+|++|++||..+.+|+....++|++|
T Consensus        20 gevi~~~~~vv~eLv~NaiDA~a~~I~I~i~~~~~~~i~V~DnG~Gi~~~~l~~~~~~~~tsK~~~~~Dl~~i~t~GfrG   99 (367)
T 3h4l_A           20 GQVITDLTTAVKELVDNSIDANANQIEIIFKDYGLESIECSDNGDGIDPSNYEFLALKHYTSKIAKFQDVAKVQTLGFRG   99 (367)
T ss_dssp             HHHCCSHHHHHHHHHHHHHHTTCSEEEEEEETTTTSEEEEEECSCCCCGGGTTTTTCCEEC---------CCCCEEEETT
T ss_pred             CCcccCHHHHHHHHHHHHHHCCCCEEEEEEEeCCEEEEEEEECCCCcChhHhccceeccccCcCCchhhhhhhhccCccc
Confidence            37899999999999999999999999999976667789999999999999999999999999998887888888999999


Q ss_pred             chhcccccccceEEEEeecCCCceEEEEEecCCeEEEeeeecCCCceEEEEcccccCChHhHHHHhHhHHHHHHHHHHHH
Q psy13669         81 EALSSLCALSSVVIVTRHKLSGVGHWLEFDHHGHIKTKTLVSRQVGTTVSLHNIFSTLPVRQKEFHRHLKKEFAKMTQVL  160 (172)
Q Consensus        81 ~gl~s~~~~~~v~i~T~~~~~~~~~~~~~~~~g~~~~~~~~~~~~GT~V~i~~lf~~~p~r~~~~~~~~~~~~~~i~~~l  160 (172)
                      +||+|++++|+|+|+|++.+ ..+|++.++.+|.+....++..++||+|+|+|||+|+|+|+++|+++.+.++..+.+++
T Consensus       100 eaL~Si~avS~l~V~sr~~~-~~~~~~~~~~~G~~~~~~~~~~~~GTtV~v~~LF~n~P~R~k~flk~~~~e~~~i~~~l  178 (367)
T 3h4l_A          100 EALSSLCGIAKLSVITTTSP-PKADKLEYDMVGHITSKTTTSRNKGTTVLVSQLFHNLPVRQKEFSKTFKRQFTKCLTVI  178 (367)
T ss_dssp             HHHHHHHHSSEEEEEEESST-TCEEEEEECTTCCEEEEEEECCSSEEEEEEESTTTTCHHHHHHHHTTHHHHHHHHHHHH
T ss_pred             hHHHHhhccCEEEEEEEECC-CCEEEEEEcCCCcEEeeccccCCCCeEEEEchhhccCchhhhhhccchHHHHHHHHHHH
Confidence            99999999999999999988 77899999767888777777889999999999999999999989899999999999999


Q ss_pred             HHhhhhcCCCC
Q psy13669        161 YGYCLVALGVK  171 (172)
Q Consensus       161 ~~~a~~~p~i~  171 (172)
                      ++||++||+|+
T Consensus       179 ~~~Al~~p~v~  189 (367)
T 3h4l_A          179 QGYAIINAAIK  189 (367)
T ss_dssp             HHHHHHCTTCE
T ss_pred             HHHHhhCCCeE
Confidence            99999999985
>3na3_A DNA mismatch repair protein MLH1; MUTL protein homolog 1, DNA damag repair, structural genomics consortium, SGC, protein bindin; HET: DNA ATP; 2.50A {Homo sapiens} Back     alignment and structure
>1h7s_A PMS1 protein homolog 2; DNA repair, GHL ATPase, mismatch repair, HNPCC; 1.95A {Homo sapiens} SCOP: d.14.1.3 d.122.1.2 PDB: 1h7u_A* 1ea6_A* Back     alignment and structure
>1b63_A MUTL; DNA mismatch repair, ATPase; HET: ANP; 1.90A {Escherichia coli K12} SCOP: d.14.1.3 d.122.1.2 PDB: 1nhh_A* 1nhi_A* 1bkn_A 1nhj_A* 1b62_A* Back     alignment and structure
>3fv5_A DNA topoisomerase 4 subunit B; topoisomerase IV B subunit complex, antibiotic resistance, ATP-binding, nucleotide-binding; HET: DNA 1EU; 1.80A {Escherichia coli} PDB: 1s14_A* Back     alignment and structure
>3t0h_A Heat shock protein HSP 90-alpha; chaperone, ATPase; 1.20A {Homo sapiens} SCOP: d.122.1.1 PDB: 3r4m_A 3t0z_A* 3t10_A* 3t1k_A* 3t2s_A* 1uyl_A 1uy7_A* 1uy8_A* 1uy9_A* 1uyc_A* 1uyd_A* 1uye_A* 1uyf_A* 1uyg_A* 1uyh_A* 1uyk_A* 1uy6_A 2cdd_A* 2uwd_A* 2vci_A* ... Back     alignment and structure
>4duh_A DNA gyrase subunit B; structure-based drug design, antibacterial, DNA gyrase B, GY isomerase-isomerase inhibitor complex; HET: DNA RLI; 1.50A {Escherichia coli} PDB: 1aj6_A* 1kzn_A* 3g7e_A* Back     alignment and structure
>2ior_A Chaperone protein HTPG; heat shock protein, HSP90; HET: ADP; 1.65A {Escherichia coli} Back     alignment and structure
>3o0i_A HSP90AA1 protein; HSP90 heat-shock proteins, chaperone-inhibitor complex; HET: P54; 1.47A {Homo sapiens} PDB: 2fwz_A* 2fwy_A* 2h55_A* Back     alignment and structure
>1ei1_A DNA gyrase B, GYRB; ATPase domain, dimer, isomerase; HET: DNA ANP; 2.30A {Escherichia coli} SCOP: d.14.1.3 d.122.1.2 Back     alignment and structure
>1s16_A Topoisomerase IV subunit B; two-domain protein complexed with ADPNP; HET: ANP; 2.10A {Escherichia coli} SCOP: d.14.1.3 d.122.1.2 Back     alignment and structure
>1zxm_A TOPO IIA ATPase, DNA topoisomerase II, alpha isozyme; GHKL nucleotide-binding fold; HET: DNA ANP; 1.87A {Homo sapiens} PDB: 1zxn_A* Back     alignment and structure
>4emv_A DNA topoisomerase IV, B subunit; protein-inhibitor complex, ATP binding, structure-based drug antimicrobial, virtual screen; HET: DNA 0R9; 1.70A {Streptococcus pneumoniae GA47373} PDB: 4em7_A* Back     alignment and structure
>2wer_A ATP-dependent molecular chaperone HSP82; ATPase, ATP-binding, phosphoprotein, stress respo nucleotide-binding; HET: RDC; 1.60A {Saccharomyces cerevisiae} PDB: 2weq_A* 2wep_A* 1zwh_A* 1zw9_A* 2fxs_A* 3c11_A* 3c0e_A* 2yge_A* 2ygf_A* 2akp_A Back     alignment and structure
>3cwv_A DNA gyrase, B subunit, truncated; structural genomics, unknown function, B-subunit binding, isomerase, nucleotide-binding, topoisomerase; HET: DNA; 1.95A {Myxococcus xanthus} Back     alignment and structure
>1yc1_A HSP 86, heat shock protein HSP 90-alpha; cell-cycle, cancer, drug design, cell cycle; HET: 4BC; 1.70A {Homo sapiens} SCOP: d.122.1.1 PDB: 1yc3_A* 1yc4_A* Back     alignment and structure
>1kij_A DNA gyrase subunit B; topoisomerase, gyrase B-coumarin complex, isomerase; HET: DNA NOV; 2.30A {Thermus thermophilus} SCOP: d.14.1.3 d.122.1.2 Back     alignment and structure
>1y4s_A Chaperone protein HTPG; HSP90, molecular chaperone, ATPase; HET: ADP; 2.90A {Escherichia coli} PDB: 1y4u_A Back     alignment and structure
>2gqp_A Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, ligand, NECA, NPCA, adenosine; HET: PA7 PG4 1PE; 1.50A {Canis lupus familiaris} SCOP: d.122.1.1 PDB: 1tc0_A* 1tbw_A* 1u0z_A* 1u2o_A* 1ysz_A* 1yt0_A* 1yt1_A* 2exl_A* 2fyp_A* 2gfd_A* 1tc6_A* 2h8m_A* 2hch_A* 2hg1_A* 3o2f_A* 2esa_A* Back     alignment and structure
>3lnu_A Topoisomerase IV subunit B; PARE, ATP-binding, nucleotide-BI topoisomerase; 2.20A {Xanthomonas oryzae PV} PDB: 3lps_A* Back     alignment and structure
>2ioq_A Chaperone protein HTPG; heat shock protein, HSP90; 3.50A {Escherichia coli} PDB: 2iop_A Back     alignment and structure
>1qy5_A Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: NEC; 1.75A {Canis lupus familiaris} SCOP: d.122.1.1 PDB: 1qy8_A* 1qye_A* 1u0y_A* 1yt2_A* Back     alignment and structure
>3ttz_A DNA gyrase subunit B; protein-inhibitor complex, ATP-binding, structure-based drug antimicrobial, isomerase-isomerase inhibitor complex; HET: DNA 07N; 1.63A {Staphylococcus aureus} PDB: 3u2d_A* 3u2k_A* 3g75_A* 3g7b_A* Back     alignment and structure
>3nmq_A Heat shock protein HSP 90-beta; ATPase, chaperone-chaperone inhibitor complex; HET: 7PP; 2.20A {Homo sapiens} SCOP: d.122.1.1 Back     alignment and structure
>3peh_A Endoplasmin homolog; structural genomics, structural genomics consortium, SGC, HE protein, chaperone, ATP binding; HET: IBD; 2.75A {Plasmodium falciparum 3D7} PDB: 3pej_A* Back     alignment and structure
>1mu5_A Type II DNA topoisomerase VI subunit B; GHKL ATPase, helix two-turns helix; 2.00A {Sulfolobus shibatae} SCOP: a.156.1.3 d.14.1.3 d.122.1.2 PDB: 1mx0_A* 1z5b_A* 1z5a_A* 1z59_A* 1z5c_A* 2hkj_A* Back     alignment and structure
>2zbk_B Type 2 DNA topoisomerase 6 subunit B; DNA binding protein, decatenation, ATPase, drug design, DNA-binding, magnesium, metal-binding; HET: RDC; 3.56A {Sulfolobus shibatae} Back     alignment and structure
>2o1u_A Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, AMP-PNP, GP96; HET: ANP; 2.40A {Canis lupus familiaris} PDB: 2o1v_A* 2o1w_A 2o1t_A Back     alignment and structure
>2cg9_A ATP-dependent molecular chaperone HSP82; chaperone complex, HSP90, heat shock protein, ATP-binding, heat shock, nucleotide-binding, acetylation; HET: ATP; 3.1A {Saccharomyces cerevisiae} Back     alignment and structure
>1pvg_A DNA topoisomerase II; GHKL ATPase domain; HET: DNA ANP; 1.80A {Saccharomyces cerevisiae} SCOP: d.14.1.3 d.122.1.2 PDB: 1qzr_A* Back     alignment and structure
>3ied_A Heat shock protein; HSP90, chaperone, structural genomics, structura genomics consortium, SGC, stress response; HET: AN2; 2.01A {Plasmodium falciparum} Back     alignment and structure
>2q2e_B Type 2 DNA topoisomerase 6 subunit B; DNA-binding, SPO11, ATPase; 4.00A {Methanosarcina mazei} Back     alignment and structure
>4gfh_A DNA topoisomerase 2; topoisomerase, protein-DNA complex, DNA supercoiling, DNA replication; HET: DNA PTR TSP ANP; 4.41A {Saccharomyces cerevisiae} Back     alignment and structure
>2c2a_A Sensor histidine kinase; phosphotransfer, PHOQ, selenomethionyl MAD, two-component systems, transferase; HET: ADP; 1.9A {Thermotoga maritima} SCOP: a.30.2.1 d.122.1.3 PDB: 3dge_A* Back     alignment and structure
>1id0_A PHOQ histidine kinase; PHOQ/PHOP, signal transduction, transferase; HET: ANP; 1.60A {Escherichia coli} SCOP: d.122.1.3 PDB: 3cgz_A 3cgy_A Back     alignment and structure
>1bxd_A ENVZ(290-450), protein (osmolarity sensor protein (ENVZ)); histidine kinase, osmosensor, His-Asp phosphorelay system, signal transduction; HET: ANP; NMR {Escherichia coli BL21} SCOP: d.122.1.3 Back     alignment and structure
>1ysr_A Sensor-type histidine kinase PRRB; ATP-binding domain, structural genomics, mycobacterium tuberculosis structural proteomics project; 1.78A {Mycobacterium tuberculosis} SCOP: d.122.1.3 PDB: 1ys3_A Back     alignment and structure
>1i58_A Chemotaxis protein CHEA; beta-alpha sandwich, signaling protein, transferase; HET: ACP ADP; 1.60A {Thermotoga maritima} SCOP: d.122.1.3 PDB: 1i59_A* 1i5a_A* 1i5b_A* 1i5c_A* 1i5d_A* Back     alignment and structure
>1th8_A Anti-sigma F factor; SPOIIAB, SPOIIAA, anti-ANTI-sigma, sporulation, serine kinase, transcription; HET: ADP; 2.40A {Geobacillus stearothermophilus} SCOP: d.122.1.3 PDB: 1thn_A* 1til_A* 1l0o_A* 1tid_A* Back     alignment and structure
>3d36_A Sporulation kinase B; GHKL ATPase, four helix bundle, class I two-component histidine kinase, phosphoprotein; HET: ADP; 2.03A {Geobacillus stearothermophilus} Back     alignment and structure
>2q8g_A [pyruvate dehydrogenase [lipoamide]] kinase isozy; GHKL ATPase/kinase family, pyruvate dehydrogenase complex, mitochondrial kinase; HET: AZX; 1.90A {Homo sapiens} PDB: 2q8f_A* 2q8h_A Back     alignment and structure
>3jz3_A Sensor protein QSEC; helix-turn-helix, kinase domain, ATP-binding, cell inner MEM cell membrane, kinase, membrane, nucleotide-binding; 2.50A {Escherichia coli} Back     alignment and structure
>3a0y_A Sensor protein; ATP-LID, kinase, phosphoprotein, transferase, two-component regulatory system; 1.57A {Thermotoga maritima} PDB: 3a0t_A* 3a0x_A 3a0w_A 3a0z_A Back     alignment and structure
>1y8o_A [pyruvate dehydrogenase [lipoamide]] kinase isozy; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: RED ADP; 2.48A {Homo sapiens} SCOP: a.29.5.1 d.122.1.4 PDB: 1y8n_A* 1y8p_A* 2pnr_A* 2q8i_A* Back     alignment and structure
>2e0a_A Pyruvate dehydrogenase kinase isozyme 4; PDK4, ATP-binding, structural genomics, NPPSFA, NATI project on protein structural and functional analyses; HET: ANP; 1.86A {Homo sapiens} PDB: 2zdx_A* 2zdy_A* 2zkj_A* 3d2r_A* Back     alignment and structure
>2btz_A Pyruvate dehydrogenase kinase isoenzyme 2; GHKL motif regulation, transferase; 2.2A {Homo sapiens} PDB: 2bu2_A* 2bu5_A* 2bu6_A* 2bu7_A* 2bu8_A* 3crk_A* 1jm6_A* 3crl_A* Back     alignment and structure
>4ew8_A Sensor protein DIVL; signal transduction, two-component regulatory system, hiska GHKL domain, structural genomics; 2.50A {Caulobacter crescentus} Back     alignment and structure
>1gkz_A [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase; transferase, mitochondrial protein kinase, potassium; HET: ADP; 2.2A {Rattus norvegicus} SCOP: a.29.5.1 d.122.1.4 PDB: 1gjv_A 1gkx_A* Back     alignment and structure
>1b3q_A Protein (chemotaxis protein CHEA); histine kinase, signal transduction, multi-domai protein, transferase; 2.60A {Thermotoga maritima} SCOP: a.30.2.1 b.40.7.1 d.122.1.3 PDB: 2ch4_A* 3ur1_A Back     alignment and structure
>3a0r_A Sensor protein; four helix bundle, PAS fold, kinase, phosphoprotein, transfe two-component regulatory system; 3.80A {Thermotoga maritima} Back     alignment and structure
>3sl2_A Sensor histidine kinase YYCG; ATP binding, intact ATP, bergerat fold, TR; HET: ATP; 1.61A {Bacillus subtilis} Back     alignment and structure
>1r62_A Nitrogen regulation protein NR(II); PII, histidine kinase, two component system, transfera; 1.60A {Escherichia coli} SCOP: d.122.1.3 Back     alignment and structure
>3ehg_A Sensor kinase (YOCF protein); GHL ATPase domain, transferase; HET: ATP; 1.74A {Bacillus subtilis} Back     alignment and structure
>4fpp_A Phosphotransferase; four helix bundle, bergerat fold, CCKA, CTRA, CPDR, bacterial cytoplasme; 2.20A {Caulobacter crescentus} PDB: 4fmt_A Back     alignment and structure
>3zxo_A Redox sensor histidine kinase response regulator; transferase; HET: MSE; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>3ehh_A Sensor kinase (YOCF protein); four-helix bundle, GHL ATPase domain, transferase; HET: MSE ADP; 2.10A {Bacillus subtilis} PDB: 3ehj_A* 3gie_A* 3gif_A* 3gig_A* 3ehf_A* Back     alignment and structure
>3zxq_A Hypoxia sensor histidine kinase response regulato; transferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>3ke6_A Protein RV1364C/MT1410; anti-sigma factor, anti-sigma factor antagonist, phosphatase serine kinase, ATPase, unknown function; 2.60A {Mycobacterium tuberculosis} Back     alignment and structure
>1ixm_A SPO0B, protein (sporulation response regulatory protein); phosphotransferase, two component system; 2.60A {Bacillus subtilis} SCOP: d.123.1.1 PDB: 2ftk_A* 1f51_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 172
d1h7sa2203 d.122.1.2 (A:29-231) DNA mismatch repair protein P 1e-42
d1b63a2218 d.122.1.2 (A:-2-216) DNA mismatch repair protein M 5e-40
d2hkja3219 d.122.1.2 (A:10-228) Topoisomerase VI-B subunit {A 1e-09
d1uyla_208 d.122.1.1 (A:) HSP90 {Human (Homo sapiens) [TaxId: 0.003
>d1h7sa2 d.122.1.2 (A:29-231) DNA mismatch repair protein PMS2 {Human (Homo sapiens) [TaxId: 9606]} Length = 203 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase
superfamily: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase
family: DNA gyrase/MutL, N-terminal domain
domain: DNA mismatch repair protein PMS2
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  139 bits (350), Expect = 1e-42
 Identities = 113/169 (66%), Positives = 139/169 (82%)

Query: 3   VVLNLATAVKELVENSLDAGATSVEVKLKDYGSELVEVTDNGGGVHEDNYEGLTLKHHTS 62
           VVL+L+TAVKELVENSLDAGAT++++KLKDYG +L+EV+DNG GV E+N+EGLTLKHHTS
Sbjct: 3   VVLSLSTAVKELVENSLDAGATNIDLKLKDYGVDLIEVSDNGCGVEEENFEGLTLKHHTS 62

Query: 63  KLREFTDLTSVETFGFRGEALSSLCALSSVVIVTRHKLSGVGHWLEFDHHGHIKTKTLVS 122
           K++EF DLT VETFGFRGEALSSLCALS V I T H  + VG  L FDH+G I  KT   
Sbjct: 63  KIQEFADLTQVETFGFRGEALSSLCALSDVTISTCHASAKVGTRLMFDHNGKIIQKTPYP 122

Query: 123 RQVGTTVSLHNIFSTLPVRQKEFHRHLKKEFAKMTQVLYGYCLVALGVK 171
           R  GTTVS+  +FSTLPVR KEF R++KKE+AKM QVL+ YC+++ G++
Sbjct: 123 RPRGTTVSVQQLFSTLPVRHKEFQRNIKKEYAKMVQVLHAYCIISAGIR 171
>d1b63a2 d.122.1.2 (A:-2-216) DNA mismatch repair protein MutL {Escherichia coli [TaxId: 562]} Length = 218 Back     information, alignment and structure
>d2hkja3 d.122.1.2 (A:10-228) Topoisomerase VI-B subunit {Archaeon Sulfolobus shibatae [TaxId: 2286]} Length = 219 Back     information, alignment and structure
>d1uyla_ d.122.1.1 (A:) HSP90 {Human (Homo sapiens) [TaxId: 9606]} Length = 208 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query172
d1h7sa2203 DNA mismatch repair protein PMS2 {Human (Homo sapi 100.0
d1b63a2218 DNA mismatch repair protein MutL {Escherichia coli 100.0
d2hkja3219 Topoisomerase VI-B subunit {Archaeon Sulfolobus sh 99.91
d2iwxa1213 HSP90 {Baker's yeast (Saccharomyces cerevisiae) [T 99.79
d2gqpa1227 HSP90 {Dog (Canis familiaris) [TaxId: 9615]} 99.76
d1uyla_208 HSP90 {Human (Homo sapiens) [TaxId: 9606]} 99.75
d1s14a_168 Topoisomerase IV subunit B {Escherichia coli [TaxI 99.71
d1kija2212 DNA gyrase B {Thermus thermophilus [TaxId: 274]} 99.69
d1ei1a2219 DNA gyrase B {Escherichia coli [TaxId: 562]} 99.68
d1id0a_146 Histidine kinase PhoQ domain {Escherichia coli [Ta 99.55
d1bxda_161 Histidine kinase domain of the osmosensor EnvZ {Es 99.55
d1ysra1148 Sensor-type histidine kinase PrrB {Mycobacterium t 99.55
d2c2aa2161 Sensor histidine kinase TM0853 {Thermotoga maritim 99.51
d1jm6a2190 Pyruvate dehydrogenase kinase {Rat (Rattus norvegi 99.47
d1gkza2193 Branched-chain alpha-ketoacid dehydrogenase kinase 99.47
d1pvga2239 DNA topoisomerase II {Baker's yeast (Saccharomyces 99.45
d1r62a_156 Nitrogen regulation protein NtrB, C-terminal domai 99.26
d1th8a_139 Anti-sigma factor spoIIab {Bacillus stearothermoph 99.15
d1y8oa2125 Pyruvate dehydrogenase kinase {Human (Homo sapiens 98.97
d1ixma_179 Sporulation response regulatory protein Spo0B {Bac 98.81
d1i58a_189 Histidine kinase CheA {Thermotoga maritima [TaxId: 93.71
>d1h7sa2 d.122.1.2 (A:29-231) DNA mismatch repair protein PMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase
superfamily: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase
family: DNA gyrase/MutL, N-terminal domain
domain: DNA mismatch repair protein PMS2
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=5.1e-44  Score=273.93  Aligned_cols=171  Identities=66%  Similarity=1.007  Sum_probs=151.8

Q ss_pred             CceeccHHHHHHHHHHhHhhcCCCeEEEEEEeCCceEEEEEeCCCCCChhhHHhhhccCccCCcccccccccccccCccc
Q psy13669          1 MAVVLNLATAVKELVENSLDAGATSVEVKLKDYGSELVEVTDNGGGVHEDNYEGLTLKHHTSKLREFTDLTSVETFGFRG   80 (172)
Q Consensus         1 ~~~i~~~~~~l~eLi~Na~da~a~~i~i~~~~~~~~~i~V~DnG~Gi~~~~l~~~~~~~~~sk~~~~~~~~~~~~~G~~G   80 (172)
                      +|+|.+|.++|+|||+||+||+|+.|.|.+.+.+...|.|.|||+||++++++.++.++++||....++.....++|++|
T Consensus         1 g~vi~~~~~~v~ELi~NsiDA~At~I~i~i~~~g~~~i~V~DnG~Gi~~~dl~~~~~~~~tsk~~~~~~~~~~~t~GfrG   80 (203)
T d1h7sa2           1 GQVVLSLSTAVKELVENSLDAGATNIDLKLKDYGVDLIEVSDNGCGVEEENFEGLTLKHHTSKIQEFADLTQVETFGFRG   80 (203)
T ss_dssp             CEEECCHHHHHHHHHHHHHHTTCSEEEEEEEGGGTSEEEEEECSCCCCGGGSGGGGC----------CCTTCSEEESSSS
T ss_pred             CCEEecHHHHHHHHHHHHHcCCCCEEEEEEEcCCEEEEEEeeCCcccCHHHhhhhhhheeecccccccccccccccCccc
Confidence            68999999999999999999999999999976666789999999999999999999999999998888888889999999


Q ss_pred             chhcccccccceEEEEeecCCCceEEEEEecCCeEEEeeeecCCCceEEEEcccccCChHhHHHHhHhHHHHHHHHHHHH
Q psy13669         81 EALSSLCALSSVVIVTRHKLSGVGHWLEFDHHGHIKTKTLVSRQVGTTVSLHNIFSTLPVRQKEFHRHLKKEFAKMTQVL  160 (172)
Q Consensus        81 ~gl~s~~~~~~v~i~T~~~~~~~~~~~~~~~~g~~~~~~~~~~~~GT~V~i~~lf~~~p~r~~~~~~~~~~~~~~i~~~l  160 (172)
                      .+|++++.++++++.|+..+...+|++.++++|......+...++||+|+|+|||+|+|+|+++|.++.+.++..+.+++
T Consensus        81 eaL~si~~~s~~~i~s~~~~~~~~~~i~~~~~g~~~~~~~~~~~~GTtV~v~~LF~n~PvRrk~f~k~~~~e~~~i~~~l  160 (203)
T d1h7sa2          81 EALSSLCALSDVTISTCHASAKVGTRLMFDHNGKIIQKTPYPRPRGTTVSVQQLFSTLPVRHKEFQRNIKKEYAKMVQVL  160 (203)
T ss_dssp             SHHHHHHHHSEEEEEEECTTCSSCEEEEECTTSCEEEEEECCCCSEEEEEEESTTTTSHHHHHHHHHTHHHHHHHHHHHH
T ss_pred             hhhhhhhhccceEEEeecCCCchhEEEEEeccCceeeeeecccccceEEEeehhhhhHHHHHHHhccchHHHHHHHHHHH
Confidence            99999999999999999999988999999878888887888889999999999999999999989999999999999999


Q ss_pred             HHhhhhcCCCC
Q psy13669        161 YGYCLVALGVK  171 (172)
Q Consensus       161 ~~~a~~~p~i~  171 (172)
                      ++||+.||+|+
T Consensus       161 ~~~al~~p~v~  171 (203)
T d1h7sa2         161 HAYCIISAGIR  171 (203)
T ss_dssp             HHHHHHCTTCE
T ss_pred             HHHHhcCCCcE
Confidence            99999999985
>d2hkja3 d.122.1.2 (A:10-228) Topoisomerase VI-B subunit {Archaeon Sulfolobus shibatae [TaxId: 2286]} Back     information, alignment and structure
>d2iwxa1 d.122.1.1 (A:2-214) HSP90 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gqpa1 d.122.1.1 (A:74-337) HSP90 {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1uyla_ d.122.1.1 (A:) HSP90 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s14a_ d.122.1.2 (A:) Topoisomerase IV subunit B {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kija2 d.122.1.2 (A:9-220) DNA gyrase B {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ei1a2 d.122.1.2 (A:2-220) DNA gyrase B {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1id0a_ d.122.1.3 (A:) Histidine kinase PhoQ domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bxda_ d.122.1.3 (A:) Histidine kinase domain of the osmosensor EnvZ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ysra1 d.122.1.3 (A:299-446) Sensor-type histidine kinase PrrB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2c2aa2 d.122.1.3 (A:321-481) Sensor histidine kinase TM0853 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jm6a2 d.122.1.4 (A:1177-1366) Pyruvate dehydrogenase kinase {Rat (Rattus norvegicus), isozyme 2 [TaxId: 10116]} Back     information, alignment and structure
>d1gkza2 d.122.1.4 (A:186-378) Branched-chain alpha-ketoacid dehydrogenase kinase (BCK) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1pvga2 d.122.1.2 (A:7-245) DNA topoisomerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r62a_ d.122.1.3 (A:) Nitrogen regulation protein NtrB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1th8a_ d.122.1.3 (A:) Anti-sigma factor spoIIab {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1y8oa2 d.122.1.4 (A:177-301) Pyruvate dehydrogenase kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixma_ d.123.1.1 (A:) Sporulation response regulatory protein Spo0B {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1i58a_ d.122.1.3 (A:) Histidine kinase CheA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure