Psyllid ID: psy13759
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 114 | ||||||
| 241149342 | 597 | protein phosphatase 2A regulatory subuni | 0.605 | 0.115 | 0.956 | 7e-32 | |
| 242024239 | 566 | serine/threonine-protein phosphatase PP2 | 0.605 | 0.121 | 0.942 | 1e-31 | |
| 307189141 | 601 | Serine/threonine-protein phosphatase 2A | 0.605 | 0.114 | 0.913 | 4e-31 | |
| 322787434 | 589 | hypothetical protein SINV_04974 [Solenop | 0.605 | 0.117 | 0.913 | 4e-31 | |
| 307201783 | 590 | Serine/threonine-protein phosphatase 2A | 0.605 | 0.116 | 0.913 | 4e-31 | |
| 332020375 | 603 | Serine/threonine-protein phosphatase 2A | 0.605 | 0.114 | 0.913 | 4e-31 | |
| 156547500 | 590 | PREDICTED: serine/threonine-protein phos | 0.605 | 0.116 | 0.927 | 2e-30 | |
| 427789139 | 589 | Putative protein phosphatase 2a regulato | 0.605 | 0.117 | 0.942 | 3e-30 | |
| 86515392 | 590 | protein phosphatase 2, regulatory subuni | 0.605 | 0.116 | 0.913 | 7e-30 | |
| 328782568 | 590 | PREDICTED: serine/threonine-protein phos | 0.728 | 0.140 | 0.746 | 9e-30 |
| >gi|241149342|ref|XP_002406082.1| protein phosphatase 2A regulatory subunit A, putative [Ixodes scapularis] gi|215493805|gb|EEC03446.1| protein phosphatase 2A regulatory subunit A, putative [Ixodes scapularis] | Back alignment and taxonomy information |
|---|
Score = 140 bits (354), Expect = 7e-32, Method: Compositional matrix adjust.
Identities = 66/69 (95%), Positives = 69/69 (100%)
Query: 22 QDLVADPNQHVKSALASVIMGLSPILGKHNTVDHLLPLFLSQLKDECPEVRLNIISNLDC 81
+DLV+DPNQHVKSALASVIMGLSPILGKHNTV+HLLPLFLSQLKDECPEVRLNIISNLDC
Sbjct: 333 KDLVSDPNQHVKSALASVIMGLSPILGKHNTVEHLLPLFLSQLKDECPEVRLNIISNLDC 392
Query: 82 VNEVIGIQQ 90
VNEVIGIQQ
Sbjct: 393 VNEVIGIQQ 401
|
Source: Ixodes scapularis Species: Ixodes scapularis Genus: Ixodes Family: Ixodidae Order: Ixodida Class: Arachnida Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|242024239|ref|XP_002432536.1| serine/threonine-protein phosphatase PP2A 65 kDa regulatory subunit, putative [Pediculus humanus corporis] gi|212517988|gb|EEB19798.1| serine/threonine-protein phosphatase PP2A 65 kDa regulatory subunit, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|307189141|gb|EFN73589.1| Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|322787434|gb|EFZ13522.1| hypothetical protein SINV_04974 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|307201783|gb|EFN81456.1| Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|332020375|gb|EGI60796.1| Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|156547500|ref|XP_001600229.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|427789139|gb|JAA60021.1| Putative protein phosphatase 2a regulatory subunit a [Rhipicephalus pulchellus] | Back alignment and taxonomy information |
|---|
| >gi|86515392|ref|NP_001034525.1| protein phosphatase 2, regulatory subunit A, alpha isoform [Tribolium castaneum] gi|60098058|emb|CAI45288.1| phosphatase [Tribolium castaneum] gi|270013845|gb|EFA10293.1| hypothetical protein TcasGA2_TC012508 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|328782568|ref|XP_001120202.2| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform-like [Apis mellifera] gi|380013196|ref|XP_003690652.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform-like [Apis florea] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 114 | ||||||
| UNIPROTKB|B3KQV6 | 410 | PPP2R1A "Serine/threonine-prot | 0.675 | 0.187 | 0.792 | 5e-28 | |
| UNIPROTKB|P30153 | 589 | PPP2R1A "Serine/threonine-prot | 0.675 | 0.130 | 0.792 | 2.5e-27 | |
| UNIPROTKB|F1PX75 | 589 | PPP2R1A "Uncharacterized prote | 0.605 | 0.117 | 0.869 | 3.2e-27 | |
| UNIPROTKB|P54612 | 589 | PPP2R1A "Serine/threonine-prot | 0.605 | 0.117 | 0.869 | 3.2e-27 | |
| MGI|MGI:1926334 | 589 | Ppp2r1a "protein phosphatase 2 | 0.605 | 0.117 | 0.869 | 3.2e-27 | |
| RGD|620907 | 589 | Ppp2r1a "protein phosphatase 2 | 0.605 | 0.117 | 0.869 | 3.2e-27 | |
| UNIPROTKB|A5D973 | 589 | PPP2R1A "Alpha isoform of regu | 0.605 | 0.117 | 0.855 | 1.1e-26 | |
| UNIPROTKB|Q32PI5 | 589 | PPP2R1A "Serine/threonine-prot | 0.605 | 0.117 | 0.855 | 1.1e-26 | |
| ZFIN|ZDB-GENE-040927-20 | 589 | ppp2r1b "protein phosphatase 2 | 0.605 | 0.117 | 0.869 | 1.9e-26 | |
| ZFIN|ZDB-GENE-040426-2700 | 589 | ppp2r1a "protein phosphatase 2 | 0.605 | 0.117 | 0.855 | 2.4e-26 |
| UNIPROTKB|B3KQV6 PPP2R1A "Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Score = 313 (115.2 bits), Expect = 5.0e-28, P = 5.0e-28
Identities = 61/77 (79%), Positives = 71/77 (92%)
Query: 14 VSKSIKRTQDLVADPNQHVKSALASVIMGLSPILGKHNTVDHLLPLFLSQLKDECPEVRL 73
+S+ + ++LV+D NQHVKSALASVIMGLSPILGK NT++HLLPLFL+QLKDECPEVRL
Sbjct: 144 MSQILPCIKELVSDANQHVKSALASVIMGLSPILGKDNTIEHLLPLFLAQLKDECPEVRL 203
Query: 74 NIISNLDCVNEVIGIQQ 90
NIISNLDCVNEVIGI+Q
Sbjct: 204 NIISNLDCVNEVIGIRQ 220
|
|
| UNIPROTKB|P30153 PPP2R1A "Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PX75 PPP2R1A "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P54612 PPP2R1A "Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1926334 Ppp2r1a "protein phosphatase 2 (formerly 2A), regulatory subunit A (PR 65), alpha isoform" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|620907 Ppp2r1a "protein phosphatase 2, regulatory subunit A, alpha" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A5D973 PPP2R1A "Alpha isoform of regulatory subunit A, protein phosphatase 2" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q32PI5 PPP2R1A "Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040927-20 ppp2r1b "protein phosphatase 2 (formerly 2A), regulatory subunit A, beta isoform" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040426-2700 ppp2r1a "protein phosphatase 2 (formerly 2A), regulatory subunit A (PR 65), alpha isoform" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
No hit with e-value below 0.005
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 114 | |||
| KOG0211|consensus | 759 | 99.11 | ||
| KOG0211|consensus | 759 | 99.05 | ||
| PF12755 | 97 | Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region | 98.97 | |
| KOG1240|consensus | 1431 | 98.75 | ||
| PF13513 | 55 | HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O | 98.6 | |
| PF02985 | 31 | HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re | 98.5 | |
| PF13646 | 88 | HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I | 98.49 | |
| PF02985 | 31 | HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re | 98.4 | |
| PF12717 | 178 | Cnd1: non-SMC mitotic condensation complex subunit | 98.36 | |
| cd00020 | 120 | ARM Armadillo/beta-catenin-like repeats. An approx | 98.3 | |
| PRK09687 | 280 | putative lyase; Provisional | 98.18 | |
| KOG2171|consensus | 1075 | 98.14 | ||
| PF13646 | 88 | HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I | 98.09 | |
| PF01602 | 526 | Adaptin_N: Adaptin N terminal region; InterPro: IP | 97.99 | |
| PRK09687 | 280 | putative lyase; Provisional | 97.98 | |
| PF12755 | 97 | Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region | 97.9 | |
| PF12348 | 228 | CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi | 97.86 | |
| KOG2171|consensus | 1075 | 97.85 | ||
| cd00020 | 120 | ARM Armadillo/beta-catenin-like repeats. An approx | 97.76 | |
| KOG1243|consensus | 690 | 97.76 | ||
| KOG2137|consensus | 700 | 97.57 | ||
| KOG1240|consensus | 1431 | 97.57 | ||
| KOG1242|consensus | 569 | 97.47 | ||
| PTZ00429 | 746 | beta-adaptin; Provisional | 97.43 | |
| KOG2023|consensus | 885 | 97.29 | ||
| PRK13800 | 897 | putative oxidoreductase/HEAT repeat-containing pro | 97.26 | |
| PF01602 | 526 | Adaptin_N: Adaptin N terminal region; InterPro: IP | 97.22 | |
| PRK13800 | 897 | putative oxidoreductase/HEAT repeat-containing pro | 97.14 | |
| KOG2137|consensus | 700 | 97.14 | ||
| PF12348 | 228 | CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi | 96.93 | |
| COG5096 | 757 | Vesicle coat complex, various subunits [Intracellu | 96.77 | |
| KOG1242|consensus | 569 | 96.74 | ||
| PF07571 | 92 | DUF1546: Protein of unknown function (DUF1546); In | 96.62 | |
| COG5181 | 975 | HSH155 U2 snRNP spliceosome subunit [RNA processin | 96.41 | |
| PF10508 | 503 | Proteasom_PSMB: Proteasome non-ATPase 26S subunit; | 96.4 | |
| COG1413 | 335 | FOG: HEAT repeat [Energy production and conversion | 96.31 | |
| PF13513 | 55 | HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O | 96.28 | |
| KOG1820|consensus | 815 | 96.21 | ||
| COG1413 | 335 | FOG: HEAT repeat [Energy production and conversion | 96.11 | |
| KOG1241|consensus | 859 | 96.06 | ||
| TIGR02270 | 410 | conserved hypothetical protein. Members are found | 95.96 | |
| PTZ00429 | 746 | beta-adaptin; Provisional | 95.87 | |
| PF00514 | 41 | Arm: Armadillo/beta-catenin-like repeat; InterPro: | 95.84 | |
| KOG0213|consensus | 1172 | 95.75 | ||
| PF12717 | 178 | Cnd1: non-SMC mitotic condensation complex subunit | 95.73 | |
| KOG2023|consensus | 885 | 95.67 | ||
| KOG1949|consensus | 1005 | 95.62 | ||
| KOG1243|consensus | 690 | 95.32 | ||
| PF10363 | 92 | DUF2435: Protein of unknown function (DUF2435) | 95.21 | |
| KOG2032|consensus | 533 | 95.21 | ||
| KOG1060|consensus | 968 | 95.12 | ||
| PF12460 | 415 | MMS19_C: RNAPII transcription regulator C-terminal | 95.03 | |
| smart00567 | 30 | EZ_HEAT E-Z type HEAT repeats. Present in subunits | 95.02 | |
| KOG0212|consensus | 675 | 94.66 | ||
| KOG0166|consensus | 514 | 94.41 | ||
| PF12530 | 234 | DUF3730: Protein of unknown function (DUF3730) ; I | 94.4 | |
| KOG1851|consensus | 1710 | 94.28 | ||
| KOG1061|consensus | 734 | 94.11 | ||
| PF12719 | 298 | Cnd3: Nuclear condensing complex subunits, C-term | 93.84 | |
| PF04826 | 254 | Arm_2: Armadillo-like; InterPro: IPR006911 This en | 93.55 | |
| COG5181 | 975 | HSH155 U2 snRNP spliceosome subunit [RNA processin | 92.95 | |
| TIGR02270 | 410 | conserved hypothetical protein. Members are found | 92.95 | |
| PF08713 | 213 | DNA_alkylation: DNA alkylation repair enzyme; Inte | 92.59 | |
| PF12765 | 42 | Cohesin_HEAT: HEAT repeat associated with sister c | 92.58 | |
| KOG0915|consensus | 1702 | 92.53 | ||
| smart00638 | 574 | LPD_N Lipoprotein N-terminal Domain. | 92.48 | |
| COG5096 | 757 | Vesicle coat complex, various subunits [Intracellu | 92.46 | |
| KOG1241|consensus | 859 | 92.45 | ||
| KOG4224|consensus | 550 | 92.42 | ||
| KOG1248|consensus | 1176 | 92.07 | ||
| KOG0213|consensus | 1172 | 91.94 | ||
| KOG1967|consensus | 1030 | 91.86 | ||
| PF10274 | 183 | ParcG: Parkin co-regulated protein; InterPro: IPR0 | 91.64 | |
| KOG4224|consensus | 550 | 91.61 | ||
| PF12830 | 187 | Nipped-B_C: Sister chromatid cohesion C-terminus | 91.55 | |
| cd06561 | 197 | AlkD_like A new structural DNA glycosylase. This d | 91.29 | |
| PLN03200 | 2102 | cellulose synthase-interactive protein; Provisiona | 91.12 | |
| PLN03200 | 2102 | cellulose synthase-interactive protein; Provisiona | 91.01 | |
| PF03130 | 27 | HEAT_PBS: PBS lyase HEAT-like repeat; InterPro: IP | 90.84 | |
| KOG2062|consensus | 929 | 90.55 | ||
| smart00185 | 41 | ARM Armadillo/beta-catenin-like repeats. Approx. 4 | 90.49 | |
| PF00514 | 41 | Arm: Armadillo/beta-catenin-like repeat; InterPro: | 90.43 | |
| KOG1949|consensus | 1005 | 90.26 | ||
| PF11698 | 119 | V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011 | 90.17 | |
| COG5116 | 926 | RPN2 26S proteasome regulatory complex component [ | 90.15 | |
| KOG0567|consensus | 289 | 90.14 | ||
| KOG0166|consensus | 514 | 90.05 | ||
| PF10274 | 183 | ParcG: Parkin co-regulated protein; InterPro: IPR0 | 89.85 | |
| KOG2956|consensus | 516 | 89.83 | ||
| PF10508 | 503 | Proteasom_PSMB: Proteasome non-ATPase 26S subunit; | 89.83 | |
| KOG1062|consensus | 866 | 89.77 | ||
| PF04826 | 254 | Arm_2: Armadillo-like; InterPro: IPR006911 This en | 89.74 | |
| KOG2259|consensus | 823 | 89.63 | ||
| KOG2259|consensus | 823 | 89.42 | ||
| KOG2062|consensus | 929 | 89.1 | ||
| PF14868 | 559 | DUF4487: Domain of unknown function (DUF4487) | 88.56 | |
| cd07064 | 208 | AlkD_like_1 A new structural DNA glycosylase conta | 88.1 | |
| KOG1824|consensus | 1233 | 88.03 | ||
| KOG1061|consensus | 734 | 87.99 | ||
| PF12765 | 42 | Cohesin_HEAT: HEAT repeat associated with sister c | 87.65 | |
| PF12719 | 298 | Cnd3: Nuclear condensing complex subunits, C-term | 87.12 | |
| KOG0212|consensus | 675 | 87.0 | ||
| PF05918 | 556 | API5: Apoptosis inhibitory protein 5 (API5); Inter | 86.92 | |
| KOG2025|consensus | 892 | 86.89 | ||
| KOG0414|consensus | 1251 | 86.55 | ||
| PF01347 | 618 | Vitellogenin_N: Lipoprotein amino terminal region; | 86.13 | |
| KOG1820|consensus | 815 | 85.94 | ||
| PF01347 | 618 | Vitellogenin_N: Lipoprotein amino terminal region; | 85.73 | |
| smart00185 | 41 | ARM Armadillo/beta-catenin-like repeats. Approx. 4 | 85.21 | |
| COG5116 | 926 | RPN2 26S proteasome regulatory complex component [ | 84.84 | |
| KOG1077|consensus | 938 | 84.67 | ||
| PF08506 | 370 | Cse1: Cse1; InterPro: IPR013713 The exchange of ma | 84.43 | |
| KOG1248|consensus | 1176 | 84.34 | ||
| PF05918 | 556 | API5: Apoptosis inhibitory protein 5 (API5); Inter | 83.94 | |
| KOG2160|consensus | 342 | 83.82 | ||
| PF12460 | 415 | MMS19_C: RNAPII transcription regulator C-terminal | 83.46 | |
| KOG2025|consensus | 892 | 82.12 | ||
| COG5098 | 1128 | Chromosome condensation complex Condensin, subunit | 82.11 | |
| KOG2149|consensus | 393 | 81.96 | ||
| KOG1078|consensus | 865 | 80.79 |
| >KOG0211|consensus | Back alignment and domain information |
|---|
Probab=99.11 E-value=8.6e-11 Score=102.23 Aligned_cols=107 Identities=24% Similarity=0.207 Sum_probs=95.9
Q ss_pred hccCChh-HHHHhhHHHHHHhcCCCCHHHHHHHHHHHHccccccCcchhhhhhHHHHHHhcCCCChHHHHHHHHhHHHHH
Q psy13759 5 LTINSDG-NFVSKSIKRTQDLVADPNQHVKSALASVIMGLSPILGKHNTVDHLLPLFLSQLKDECPEVRLNIISNLDCVN 83 (114)
Q Consensus 5 ~~~~~~~-~~~~~ilP~l~~L~~D~s~~VR~~~a~~l~~la~~lg~e~~~~~llP~~~~LL~D~e~EVR~~a~~~l~~~~ 83 (114)
+..++.+ ...+.+.|.+.++.+|.+|+||+++++.+.++++.+|++.+...+.|.+..+++|+++|+|.+++.+..+++
T Consensus 304 ~~l~~~~~d~~~~~~~~l~~~~~d~~~~v~~~~~~~~~~L~~~~~~~~~~~~~~~~~~~l~~~~~~e~r~a~a~~~~~l~ 383 (759)
T KOG0211|consen 304 LDLLDDDDDVVKSLTESLVQAVEDGSWRVSYMVADKFSELSSAVGPSATRTQLVPPVSNLLKDEEWEVRYAIAKKVQKLA 383 (759)
T ss_pred HHhcCCchhhhhhhhHHHHHHhcChhHHHHHHHhhhhhhHHHHhccccCcccchhhHHHHhcchhhhhhHHhhcchHHHh
Confidence 3344555 778889999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred hhhC----hhhHhhhHhHHHHHHHHHHHHHhh
Q psy13759 84 EVIG----IQQDVSFKLGQVDRTSFLTAVLVK 111 (114)
Q Consensus 84 ~~l~----~~~i~~~iLP~i~~l~~~~~~~~~ 111 (114)
..+. ++...++++|.++.++--.+--|+
T Consensus 384 ~~l~~~~~~~i~~~~ilp~~~~lv~d~~~~vr 415 (759)
T KOG0211|consen 384 CYLNASCYPNIPDSSILPEVQVLVLDNALHVR 415 (759)
T ss_pred hhcCcccccccchhhhhHHHHHHHhcccchHH
Confidence 9999 778889999999998865554443
|
|
| >KOG0211|consensus | Back alignment and domain information |
|---|
| >PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region | Back alignment and domain information |
|---|
| >KOG1240|consensus | Back alignment and domain information |
|---|
| >PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B | Back alignment and domain information |
|---|
| >PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] | Back alignment and domain information |
|---|
| >PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A | Back alignment and domain information |
|---|
| >PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] | Back alignment and domain information |
|---|
| >PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 | Back alignment and domain information |
|---|
| >cd00020 ARM Armadillo/beta-catenin-like repeats | Back alignment and domain information |
|---|
| >PRK09687 putative lyase; Provisional | Back alignment and domain information |
|---|
| >KOG2171|consensus | Back alignment and domain information |
|---|
| >PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A | Back alignment and domain information |
|---|
| >PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >PRK09687 putative lyase; Provisional | Back alignment and domain information |
|---|
| >PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region | Back alignment and domain information |
|---|
| >PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] | Back alignment and domain information |
|---|
| >KOG2171|consensus | Back alignment and domain information |
|---|
| >cd00020 ARM Armadillo/beta-catenin-like repeats | Back alignment and domain information |
|---|
| >KOG1243|consensus | Back alignment and domain information |
|---|
| >KOG2137|consensus | Back alignment and domain information |
|---|
| >KOG1240|consensus | Back alignment and domain information |
|---|
| >KOG1242|consensus | Back alignment and domain information |
|---|
| >PTZ00429 beta-adaptin; Provisional | Back alignment and domain information |
|---|
| >KOG2023|consensus | Back alignment and domain information |
|---|
| >PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >KOG2137|consensus | Back alignment and domain information |
|---|
| >PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] | Back alignment and domain information |
|---|
| >COG5096 Vesicle coat complex, various subunits [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG1242|consensus | Back alignment and domain information |
|---|
| >PF07571 DUF1546: Protein of unknown function (DUF1546); InterPro: IPR011442 These proteins are associated with IPR004823 from INTERPRO in transcription initiation factor TFIID subunit 6 (TAF6) | Back alignment and domain information |
|---|
| >COG5181 HSH155 U2 snRNP spliceosome subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells | Back alignment and domain information |
|---|
| >COG1413 FOG: HEAT repeat [Energy production and conversion] | Back alignment and domain information |
|---|
| >PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B | Back alignment and domain information |
|---|
| >KOG1820|consensus | Back alignment and domain information |
|---|
| >COG1413 FOG: HEAT repeat [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG1241|consensus | Back alignment and domain information |
|---|
| >TIGR02270 conserved hypothetical protein | Back alignment and domain information |
|---|
| >PTZ00429 beta-adaptin; Provisional | Back alignment and domain information |
|---|
| >PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless | Back alignment and domain information |
|---|
| >KOG0213|consensus | Back alignment and domain information |
|---|
| >PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 | Back alignment and domain information |
|---|
| >KOG2023|consensus | Back alignment and domain information |
|---|
| >KOG1949|consensus | Back alignment and domain information |
|---|
| >KOG1243|consensus | Back alignment and domain information |
|---|
| >PF10363 DUF2435: Protein of unknown function (DUF2435) | Back alignment and domain information |
|---|
| >KOG2032|consensus | Back alignment and domain information |
|---|
| >KOG1060|consensus | Back alignment and domain information |
|---|
| >PF12460 MMS19_C: RNAPII transcription regulator C-terminal; InterPro: IPR024687 This domain, approximately 60 amino acids in length, is found in the N-terminal region of MMS19 proteins | Back alignment and domain information |
|---|
| >smart00567 EZ_HEAT E-Z type HEAT repeats | Back alignment and domain information |
|---|
| >KOG0212|consensus | Back alignment and domain information |
|---|
| >KOG0166|consensus | Back alignment and domain information |
|---|
| >PF12530 DUF3730: Protein of unknown function (DUF3730) ; InterPro: IPR022542 This domain is found in eukaryotes, and is typically between 220 and 262 amino acids in length | Back alignment and domain information |
|---|
| >KOG1851|consensus | Back alignment and domain information |
|---|
| >KOG1061|consensus | Back alignment and domain information |
|---|
| >PF12719 Cnd3: Nuclear condensing complex subunits, C-term domain | Back alignment and domain information |
|---|
| >PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function | Back alignment and domain information |
|---|
| >COG5181 HSH155 U2 snRNP spliceosome subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR02270 conserved hypothetical protein | Back alignment and domain information |
|---|
| >PF08713 DNA_alkylation: DNA alkylation repair enzyme; InterPro: IPR014825 These proteins are predicted to be DNA alkylation repair enzymes | Back alignment and domain information |
|---|
| >PF12765 Cohesin_HEAT: HEAT repeat associated with sister chromatid cohesion | Back alignment and domain information |
|---|
| >KOG0915|consensus | Back alignment and domain information |
|---|
| >smart00638 LPD_N Lipoprotein N-terminal Domain | Back alignment and domain information |
|---|
| >COG5096 Vesicle coat complex, various subunits [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG1241|consensus | Back alignment and domain information |
|---|
| >KOG4224|consensus | Back alignment and domain information |
|---|
| >KOG1248|consensus | Back alignment and domain information |
|---|
| >KOG0213|consensus | Back alignment and domain information |
|---|
| >KOG1967|consensus | Back alignment and domain information |
|---|
| >PF10274 ParcG: Parkin co-regulated protein; InterPro: IPR019399 This family of proteins is transcribed anti-sense along the DNA to the Parkin gene product and the two appear to be transcribed under the same promoter | Back alignment and domain information |
|---|
| >KOG4224|consensus | Back alignment and domain information |
|---|
| >PF12830 Nipped-B_C: Sister chromatid cohesion C-terminus | Back alignment and domain information |
|---|
| >cd06561 AlkD_like A new structural DNA glycosylase | Back alignment and domain information |
|---|
| >PLN03200 cellulose synthase-interactive protein; Provisional | Back alignment and domain information |
|---|
| >PLN03200 cellulose synthase-interactive protein; Provisional | Back alignment and domain information |
|---|
| >PF03130 HEAT_PBS: PBS lyase HEAT-like repeat; InterPro: IPR004155 These proteins contain a short bi-helical repeat that is related to HEAT | Back alignment and domain information |
|---|
| >KOG2062|consensus | Back alignment and domain information |
|---|
| >smart00185 ARM Armadillo/beta-catenin-like repeats | Back alignment and domain information |
|---|
| >PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless | Back alignment and domain information |
|---|
| >KOG1949|consensus | Back alignment and domain information |
|---|
| >PF11698 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011987 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane | Back alignment and domain information |
|---|
| >COG5116 RPN2 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0567|consensus | Back alignment and domain information |
|---|
| >KOG0166|consensus | Back alignment and domain information |
|---|
| >PF10274 ParcG: Parkin co-regulated protein; InterPro: IPR019399 This family of proteins is transcribed anti-sense along the DNA to the Parkin gene product and the two appear to be transcribed under the same promoter | Back alignment and domain information |
|---|
| >KOG2956|consensus | Back alignment and domain information |
|---|
| >PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells | Back alignment and domain information |
|---|
| >KOG1062|consensus | Back alignment and domain information |
|---|
| >PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function | Back alignment and domain information |
|---|
| >KOG2259|consensus | Back alignment and domain information |
|---|
| >KOG2259|consensus | Back alignment and domain information |
|---|
| >KOG2062|consensus | Back alignment and domain information |
|---|
| >PF14868 DUF4487: Domain of unknown function (DUF4487) | Back alignment and domain information |
|---|
| >cd07064 AlkD_like_1 A new structural DNA glycosylase containing HEAT-like repeats | Back alignment and domain information |
|---|
| >KOG1824|consensus | Back alignment and domain information |
|---|
| >KOG1061|consensus | Back alignment and domain information |
|---|
| >PF12765 Cohesin_HEAT: HEAT repeat associated with sister chromatid cohesion | Back alignment and domain information |
|---|
| >PF12719 Cnd3: Nuclear condensing complex subunits, C-term domain | Back alignment and domain information |
|---|
| >KOG0212|consensus | Back alignment and domain information |
|---|
| >PF05918 API5: Apoptosis inhibitory protein 5 (API5); InterPro: IPR008383 This family consists of apoptosis inhibitory protein 5 (API5) sequences from several organisms | Back alignment and domain information |
|---|
| >KOG2025|consensus | Back alignment and domain information |
|---|
| >KOG0414|consensus | Back alignment and domain information |
|---|
| >PF01347 Vitellogenin_N: Lipoprotein amino terminal region; InterPro: IPR001747 This entry represents a conserved region found in several lipid transport proteins, including vitellogenin, microsomal triglyceride transfer protein and apolipoprotein B-100 [] | Back alignment and domain information |
|---|
| >KOG1820|consensus | Back alignment and domain information |
|---|
| >PF01347 Vitellogenin_N: Lipoprotein amino terminal region; InterPro: IPR001747 This entry represents a conserved region found in several lipid transport proteins, including vitellogenin, microsomal triglyceride transfer protein and apolipoprotein B-100 [] | Back alignment and domain information |
|---|
| >smart00185 ARM Armadillo/beta-catenin-like repeats | Back alignment and domain information |
|---|
| >COG5116 RPN2 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1077|consensus | Back alignment and domain information |
|---|
| >PF08506 Cse1: Cse1; InterPro: IPR013713 The exchange of macromolecules between the nucleus and cytoplasm takes place through nuclear pore complexes within the nuclear membrane | Back alignment and domain information |
|---|
| >KOG1248|consensus | Back alignment and domain information |
|---|
| >PF05918 API5: Apoptosis inhibitory protein 5 (API5); InterPro: IPR008383 This family consists of apoptosis inhibitory protein 5 (API5) sequences from several organisms | Back alignment and domain information |
|---|
| >KOG2160|consensus | Back alignment and domain information |
|---|
| >PF12460 MMS19_C: RNAPII transcription regulator C-terminal; InterPro: IPR024687 This domain, approximately 60 amino acids in length, is found in the N-terminal region of MMS19 proteins | Back alignment and domain information |
|---|
| >KOG2025|consensus | Back alignment and domain information |
|---|
| >COG5098 Chromosome condensation complex Condensin, subunit D2 [Chromatin structure and dynamics / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG2149|consensus | Back alignment and domain information |
|---|
| >KOG1078|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 114 | ||||
| 3dw8_A | 582 | Structure Of A Protein Phosphatase 2a Holoenzyme Wi | 4e-31 | ||
| 2pkg_A | 580 | Structure Of A Complex Between The A Subunit Of Pro | 4e-31 | ||
| 2iae_A | 589 | Crystal Structure Of A Protein Phosphatase 2a (Pp2a | 4e-31 | ||
| 2ie3_A | 589 | Structure Of The Protein Phosphatase 2a Core Enzyme | 4e-31 | ||
| 1b3u_A | 588 | Crystal Structure Of Constant Regulatory Domain Of | 4e-31 | ||
| 3fga_A | 588 | Structural Basis Of Pp2a And Sgo Interaction Length | 4e-31 | ||
| 2nyl_A | 582 | Crystal Structure Of Protein Phosphatase 2a (Pp2a) | 3e-30 |
| >pdb|3DW8|A Chain A, Structure Of A Protein Phosphatase 2a Holoenzyme With B55 Subunit Length = 582 | Back alignment and structure |
|
| >pdb|2PKG|A Chain A, Structure Of A Complex Between The A Subunit Of Protein Phosphatase 2a And The Small T Antigen Of Sv40 Length = 580 | Back alignment and structure |
| >pdb|2IAE|A Chain A, Crystal Structure Of A Protein Phosphatase 2a (Pp2a) Holoenzyme. Length = 589 | Back alignment and structure |
| >pdb|2IE3|A Chain A, Structure Of The Protein Phosphatase 2a Core Enzyme Bound To Tumor- Inducing Toxins Length = 589 | Back alignment and structure |
| >pdb|1B3U|A Chain A, Crystal Structure Of Constant Regulatory Domain Of Human Pp2a, Pr65alpha Length = 588 | Back alignment and structure |
| >pdb|3FGA|A Chain A, Structural Basis Of Pp2a And Sgo Interaction Length = 588 | Back alignment and structure |
| >pdb|2NYL|A Chain A, Crystal Structure Of Protein Phosphatase 2a (Pp2a) Holoenzyme With The Catalytic Subunit Carboxyl Terminus Truncated Length = 582 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 114 | |||
| 1b3u_A | 588 | Protein (protein phosphatase PP2A); scaffold prote | 2e-18 | |
| 1b3u_A | 588 | Protein (protein phosphatase PP2A); scaffold prote | 7e-07 | |
| 1b3u_A | 588 | Protein (protein phosphatase PP2A); scaffold prote | 3e-06 | |
| 1b3u_A | 588 | Protein (protein phosphatase PP2A); scaffold prote | 3e-05 | |
| 1b3u_A | 588 | Protein (protein phosphatase PP2A); scaffold prote | 1e-04 | |
| 1b3u_A | 588 | Protein (protein phosphatase PP2A); scaffold prote | 2e-04 | |
| 1lrv_A | 244 | LRV, leucine-rich repeat variant; leucine-rich rep | 4e-05 |
| >1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Length = 588 | Back alignment and structure |
|---|
Score = 78.1 bits (192), Expect = 2e-18
Identities = 60/69 (86%), Positives = 67/69 (97%)
Query: 22 QDLVADPNQHVKSALASVIMGLSPILGKHNTVDHLLPLFLSQLKDECPEVRLNIISNLDC 81
++LV+D NQHVKSALASVIMGLSPILGK NT++HLLPLFL+QLKDECPEVRLNIISNLDC
Sbjct: 330 KELVSDANQHVKSALASVIMGLSPILGKDNTIEHLLPLFLAQLKDECPEVRLNIISNLDC 389
Query: 82 VNEVIGIQQ 90
VNEVIGI+Q
Sbjct: 390 VNEVIGIRQ 398
|
| >1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Length = 588 | Back alignment and structure |
|---|
| >1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Length = 588 | Back alignment and structure |
|---|
| >1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Length = 588 | Back alignment and structure |
|---|
| >1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Length = 588 | Back alignment and structure |
|---|
| >1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Length = 588 | Back alignment and structure |
|---|
| >1lrv_A LRV, leucine-rich repeat variant; leucine-rich repeats, repetitive structure, iron sulfur proteins, nitrogen fixation; 2.60A {Azotobacter vinelandii} SCOP: a.118.1.5 Length = 244 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 114 | |||
| 1b3u_A | 588 | Protein (protein phosphatase PP2A); scaffold prote | 99.42 | |
| 1b3u_A | 588 | Protein (protein phosphatase PP2A); scaffold prote | 99.32 | |
| 1ibr_B | 462 | P95, importin beta-1 subunit, nuclear factor; smal | 98.98 | |
| 3l9t_A | 240 | Putative uncharacterized protein SMU.31; hypotheti | 98.86 | |
| 2qk2_A | 242 | LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 | 98.77 | |
| 4fdd_A | 852 | Transportin-1; heat repeats, karyopherin, nuclear | 98.65 | |
| 1qgr_A | 876 | Protein (importin beta subunit); transport recepto | 98.64 | |
| 2qk2_A | 242 | LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 | 98.64 | |
| 4fdd_A | 852 | Transportin-1; heat repeats, karyopherin, nuclear | 98.49 | |
| 2bpt_A | 861 | Importin beta-1 subunit; nuclear transport, nucleo | 98.48 | |
| 2qk1_A | 249 | Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h | 98.48 | |
| 1te4_A | 131 | Conserved protein MTH187; methanobacterium thermoa | 98.33 | |
| 2vgl_B | 591 | AP-2 complex subunit beta-1; cytoplasmic vesicle, | 98.28 | |
| 1ibr_B | 462 | P95, importin beta-1 subunit, nuclear factor; smal | 98.28 | |
| 3ltj_A | 201 | Alpharep-4; protein engineering, heat-like repeat, | 98.27 | |
| 2bpt_A | 861 | Importin beta-1 subunit; nuclear transport, nucleo | 98.24 | |
| 3ltm_A | 211 | Alpha-REP4; protein engineering, heat-like repeat, | 98.24 | |
| 2qk1_A | 249 | Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h | 98.23 | |
| 1u6g_C | 1230 | TIP120 protein, CAND1; cullin repeat, heat repeat, | 98.23 | |
| 1te4_A | 131 | Conserved protein MTH187; methanobacterium thermoa | 98.23 | |
| 1qgr_A | 876 | Protein (importin beta subunit); transport recepto | 98.16 | |
| 3ltm_A | 211 | Alpha-REP4; protein engineering, heat-like repeat, | 98.08 | |
| 3ltj_A | 201 | Alpharep-4; protein engineering, heat-like repeat, | 98.06 | |
| 1oyz_A | 280 | Hypothetical protein YIBA; structural genomics, PS | 98.02 | |
| 1u6g_C | 1230 | TIP120 protein, CAND1; cullin repeat, heat repeat, | 98.0 | |
| 1oyz_A | 280 | Hypothetical protein YIBA; structural genomics, PS | 97.93 | |
| 2jdq_A | 450 | Importin alpha-1 subunit; transport, PB2 subunit, | 97.92 | |
| 4db8_A | 252 | Armadillo-repeat protein; solenoid repeat, de novo | 97.85 | |
| 4hxt_A | 252 | De novo protein OR329; structural genomics, PSI-bi | 97.83 | |
| 4db6_A | 210 | Armadillo repeat protein; solenoid repeat, armadil | 97.82 | |
| 2of3_A | 266 | ZYG-9; multifunctional macromolecule, kinetochore, | 97.82 | |
| 4db6_A | 210 | Armadillo repeat protein; solenoid repeat, armadil | 97.79 | |
| 4db8_A | 252 | Armadillo-repeat protein; solenoid repeat, de novo | 97.74 | |
| 2vgl_B | 591 | AP-2 complex subunit beta-1; cytoplasmic vesicle, | 97.74 | |
| 4hxt_A | 252 | De novo protein OR329; structural genomics, PSI-bi | 97.72 | |
| 1w63_A | 618 | Adapter-related protein complex 1 gamma 1 subunit; | 97.7 | |
| 2jdq_A | 450 | Importin alpha-1 subunit; transport, PB2 subunit, | 97.67 | |
| 2vgl_A | 621 | Adaptor protein complex AP-2, alpha 2 subunit; cyt | 97.66 | |
| 4gmo_A | 684 | Putative uncharacterized protein; ARM, heat, solen | 97.59 | |
| 3l9t_A | 240 | Putative uncharacterized protein SMU.31; hypotheti | 97.57 | |
| 1wa5_B | 530 | Importin alpha subunit; nuclear transport/complex, | 97.56 | |
| 4ffb_C | 278 | Protein STU2; tubulin fold, heat repeats, cytoskel | 97.56 | |
| 1wa5_B | 530 | Importin alpha subunit; nuclear transport/complex, | 97.51 | |
| 1lrv_A | 244 | LRV, leucine-rich repeat variant; leucine-rich rep | 97.47 | |
| 2iw3_A | 986 | Elongation factor 3A; acetylation, ATP-binding, pr | 97.43 | |
| 1wa5_C | 960 | Importin alpha RE-exporter; nuclear transport/comp | 97.43 | |
| 1w63_A | 618 | Adapter-related protein complex 1 gamma 1 subunit; | 97.38 | |
| 1lrv_A | 244 | LRV, leucine-rich repeat variant; leucine-rich rep | 97.36 | |
| 1jdh_A | 529 | Beta-catenin; beta-catenin, protein-protein comple | 97.35 | |
| 4b8j_A | 528 | Importin subunit alpha-1A; transport protein, nucl | 97.26 | |
| 4b8j_A | 528 | Importin subunit alpha-1A; transport protein, nucl | 97.25 | |
| 1xqr_A | 296 | HSPBP1 protein; armadillo repeat, superhelical twi | 97.06 | |
| 2z6h_A | 644 | Catenin beta-1, beta-catenin; C-terminal domain, a | 96.99 | |
| 3tjz_B | 355 | Coatomer subunit gamma; protein trafficking, golgi | 96.91 | |
| 2z6g_A | 780 | B-catenin; FULL-length, beta-catenin, cell adhesio | 96.8 | |
| 3ul1_B | 510 | Importin subunit alpha-2; arm repeat, armadillo re | 96.75 | |
| 3tpo_A | 529 | Importin subunit alpha-2; nuclear import, protein | 96.73 | |
| 3ul1_B | 510 | Importin subunit alpha-2; arm repeat, armadillo re | 96.6 | |
| 4ady_A | 963 | RPN2, 26S proteasome regulatory subunit RPN2; prot | 96.59 | |
| 1jdh_A | 529 | Beta-catenin; beta-catenin, protein-protein comple | 96.58 | |
| 1xqr_A | 296 | HSPBP1 protein; armadillo repeat, superhelical twi | 96.54 | |
| 3now_A | 810 | UNC-45 protein, SD10334P; armadillo repeat, HSP90, | 96.5 | |
| 3tpo_A | 529 | Importin subunit alpha-2; nuclear import, protein | 96.48 | |
| 1wa5_C | 960 | Importin alpha RE-exporter; nuclear transport/comp | 96.48 | |
| 3nmw_A | 354 | APC variant protein; ARMADIILO repeats domain, cel | 96.28 | |
| 2z6h_A | 644 | Catenin beta-1, beta-catenin; C-terminal domain, a | 96.26 | |
| 2z6g_A | 780 | B-catenin; FULL-length, beta-catenin, cell adhesio | 96.24 | |
| 2vgl_A | 621 | Adaptor protein complex AP-2, alpha 2 subunit; cyt | 96.21 | |
| 2x1g_F | 971 | Cadmus; transport protein, developmental protein, | 96.19 | |
| 3gs3_A | 257 | Symplekin, LD45768P; helix-turn-helix heat repeat | 96.18 | |
| 1xm9_A | 457 | Plakophilin 1; armadillo repeat, cell adhesion; 2. | 95.99 | |
| 2x19_B | 963 | Importin-13; nuclear transport, protein transport; | 95.93 | |
| 1xm9_A | 457 | Plakophilin 1; armadillo repeat, cell adhesion; 2. | 95.92 | |
| 2x1g_F | 971 | Cadmus; transport protein, developmental protein, | 95.81 | |
| 3o2t_A | 386 | Symplekin; heat repeat, scaffold, protein binding; | 95.78 | |
| 2x19_B | 963 | Importin-13; nuclear transport, protein transport; | 95.74 | |
| 3ibv_A | 980 | Exportin-T; karyopherin, heat repeat, cytoplasm, n | 95.68 | |
| 3m1i_C | 1049 | Exportin-1; heat repeat, GTP-binding, nucleotide-b | 95.53 | |
| 4hat_C | 1023 | Exportin-1; heat repeat, nuclear export, RAN-ranbp | 95.49 | |
| 1vsy_5 | 997 | Proteasome activator BLM10; 20S proteasome BLM10, | 95.35 | |
| 3now_A | 810 | UNC-45 protein, SD10334P; armadillo repeat, HSP90, | 95.22 | |
| 3opb_A | 778 | SWI5-dependent HO expression protein 4; heat and a | 95.15 | |
| 3nmz_A | 458 | APC variant protein; protein-protein complex, arma | 95.04 | |
| 3tjz_B | 355 | Coatomer subunit gamma; protein trafficking, golgi | 94.76 | |
| 2iw3_A | 986 | Elongation factor 3A; acetylation, ATP-binding, pr | 94.67 | |
| 3tt9_A | 233 | Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} | 94.65 | |
| 4ffb_C | 278 | Protein STU2; tubulin fold, heat repeats, cytoskel | 94.63 | |
| 3nmw_A | 354 | APC variant protein; ARMADIILO repeats domain, cel | 94.48 | |
| 3tt9_A | 233 | Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} | 94.39 | |
| 4hat_C | 1023 | Exportin-1; heat repeat, nuclear export, RAN-ranbp | 94.32 | |
| 3m1i_C | 1049 | Exportin-1; heat repeat, GTP-binding, nucleotide-b | 94.11 | |
| 2of3_A | 266 | ZYG-9; multifunctional macromolecule, kinetochore, | 94.04 | |
| 3l6x_A | 584 | Catenin delta-1; catenin, armadillo, ARM, JMD, CE | 93.83 | |
| 3ibv_A | 980 | Exportin-T; karyopherin, heat repeat, cytoplasm, n | 93.82 | |
| 3l6x_A | 584 | Catenin delta-1; catenin, armadillo, ARM, JMD, CE | 93.64 | |
| 3oc3_A | 800 | Helicase MOT1, MOT1; regulation of transcription, | 93.35 | |
| 3opb_A | 778 | SWI5-dependent HO expression protein 4; heat and a | 92.87 | |
| 3nmz_A | 458 | APC variant protein; protein-protein complex, arma | 92.82 | |
| 2b6c_A | 220 | Hypothetical protein EF3068; structural genomis, D | 92.62 | |
| 3b2a_A | 265 | TON_1937, putative uncharacterized protein; heat-r | 91.56 | |
| 4ady_A | 963 | RPN2, 26S proteasome regulatory subunit RPN2; prot | 91.34 | |
| 2db0_A | 253 | 253AA long hypothetical protein; heat repeats, hel | 90.5 | |
| 3gjx_A | 1073 | Exportin-1; transport, cytoplasm, nucleus, RNA-bin | 88.02 | |
| 4gmo_A | 684 | Putative uncharacterized protein; ARM, heat, solen | 87.57 | |
| 3u0r_A | 507 | Apoptosis inhibitor 5; heat repeat, armadillo repe | 87.21 | |
| 4atg_A | 196 | TAF6; transcription, TFIID; HET: NHE; 1.89A {Anton | 86.8 | |
| 3oc3_A | 800 | Helicase MOT1, MOT1; regulation of transcription, | 86.23 | |
| 3b2a_A | 265 | TON_1937, putative uncharacterized protein; heat-r | 85.85 | |
| 2db0_A | 253 | 253AA long hypothetical protein; heat repeats, hel | 85.46 | |
| 3jxy_A | 232 | Alkylpurine DNA glycosylase ALKD; heat repeat, DNA | 85.08 | |
| 3gjx_A | 1073 | Exportin-1; transport, cytoplasm, nucleus, RNA-bin | 83.41 | |
| 3ut4_A | 134 | CTHE_2751, putative uncharacterized protein; non P | 83.27 | |
| 1lsh_A | 1056 | Lipovitellin (LV-1N, LV-1C); vitellogenin, lipopro | 82.73 |
| >1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A | Back alignment and structure |
|---|
Probab=99.42 E-value=5.8e-13 Score=105.91 Aligned_cols=99 Identities=17% Similarity=0.174 Sum_probs=88.7
Q ss_pred hhccCChhHHHHhhHHHHHHhcCCCCHHHHHHHHHHHHccccccCcchhhhhhHHHHHHhcCCCChHHHHHHHHhHHHHH
Q psy13759 4 LLTINSDGNFVSKSIKRTQDLVADPNQHVKSALASVIMGLSPILGKHNTVDHLLPLFLSQLKDECPEVRLNIISNLDCVN 83 (114)
Q Consensus 4 l~~~~~~~~~~~~ilP~l~~L~~D~s~~VR~~~a~~l~~la~~lg~e~~~~~llP~~~~LL~D~e~EVR~~a~~~l~~~~ 83 (114)
++..++++.....++|.+..+.+|++|+||.++++.++.++..+|++.....++|.+.++++|++++||.+++..+..++
T Consensus 230 l~~~~~~~~~~~~~~~~l~~~~~d~~~~vR~~a~~~l~~l~~~~~~~~~~~~l~~~l~~~l~d~~~~vr~~a~~~l~~~~ 309 (588)
T 1b3u_A 230 IAQLLPQEDLEALVMPTLRQAAEDKSWRVRYMVADKFTELQKAVGPEITKTDLVPAFQNLMKDCEAEVRAAASHKVKEFC 309 (588)
T ss_dssp HHHHSCHHHHHHHTHHHHHHHHTCSSHHHHHHHHHTHHHHHHHHCHHHHHHTHHHHHHHHHTCSSHHHHHHHHHHHHHHH
T ss_pred HHHhCCHHHHHHHHHHHHHHHccCCCHHHHHHHHHHHHHHHHHhCcccchhHHHHHHHHHhCCCcHHHHHHHHHHHHHHH
Confidence 34456777778889999999999999999999999999999999998888899999999999999999999999999999
Q ss_pred hhhChh----hHhhhHhHHHHHH
Q psy13759 84 EVIGIQ----QDVSFKLGQVDRT 102 (114)
Q Consensus 84 ~~l~~~----~i~~~iLP~i~~l 102 (114)
+.+|++ ...+.++|.+.++
T Consensus 310 ~~~~~~~~~~~~~~~l~p~l~~~ 332 (588)
T 1b3u_A 310 ENLSADCRENVIMSQILPCIKEL 332 (588)
T ss_dssp HTSCTTTHHHHHHHTHHHHHHHH
T ss_pred HHhChhhhhhHHHHHHHHHHHHH
Confidence 999876 4567888888654
|
| >1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A | Back alignment and structure |
|---|
| >1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A | Back alignment and structure |
|---|
| >3l9t_A Putative uncharacterized protein SMU.31; hypothetical protein, unknown function; HET: EPE; 2.21A {Streptococcus mutans} | Back alignment and structure |
|---|
| >2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* | Back alignment and structure |
|---|
| >1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A | Back alignment and structure |
|---|
| >2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* | Back alignment and structure |
|---|
| >2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A | Back alignment and structure |
|---|
| >2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 | Back alignment and structure |
|---|
| >2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B | Back alignment and structure |
|---|
| >1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A | Back alignment and structure |
|---|
| >3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} | Back alignment and structure |
|---|
| >2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A | Back alignment and structure |
|---|
| >3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} | Back alignment and structure |
|---|
| >2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A | Back alignment and structure |
|---|
| >1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 | Back alignment and structure |
|---|
| >1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A | Back alignment and structure |
|---|
| >3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} | Back alignment and structure |
|---|
| >3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} | Back alignment and structure |
|---|
| >1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 | Back alignment and structure |
|---|
| >1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A | Back alignment and structure |
|---|
| >1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 | Back alignment and structure |
|---|
| >2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A | Back alignment and structure |
|---|
| >4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} | Back alignment and structure |
|---|
| >4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} | Back alignment and structure |
|---|
| >4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A | Back alignment and structure |
|---|
| >2of3_A ZYG-9; multifunctional macromolecule, kinetochore, microtubule, XMAP215, STU2, DIS1, microtubule associated protein, structural protein; 1.90A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A | Back alignment and structure |
|---|
| >4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} | Back alignment and structure |
|---|
| >2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B | Back alignment and structure |
|---|
| >4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} | Back alignment and structure |
|---|
| >1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 | Back alignment and structure |
|---|
| >2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A | Back alignment and structure |
|---|
| >2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A | Back alignment and structure |
|---|
| >4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A | Back alignment and structure |
|---|
| >3l9t_A Putative uncharacterized protein SMU.31; hypothetical protein, unknown function; HET: EPE; 2.21A {Streptococcus mutans} | Back alignment and structure |
|---|
| >1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A | Back alignment and structure |
|---|
| >4ffb_C Protein STU2; tubulin fold, heat repeats, cytoskeleton, microtubule, tubul domain, hydrolase; HET: GTP; 2.88A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A | Back alignment and structure |
|---|
| >1lrv_A LRV, leucine-rich repeat variant; leucine-rich repeats, repetitive structure, iron sulfur proteins, nitrogen fixation; 2.60A {Azotobacter vinelandii} SCOP: a.118.1.5 | Back alignment and structure |
|---|
| >2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A | Back alignment and structure |
|---|
| >1wa5_C Importin alpha RE-exporter; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1z3h_A | Back alignment and structure |
|---|
| >1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 | Back alignment and structure |
|---|
| >1lrv_A LRV, leucine-rich repeat variant; leucine-rich repeats, repetitive structure, iron sulfur proteins, nitrogen fixation; 2.60A {Azotobacter vinelandii} SCOP: a.118.1.5 | Back alignment and structure |
|---|
| >1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A | Back alignment and structure |
|---|
| >4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A | Back alignment and structure |
|---|
| >4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A | Back alignment and structure |
|---|
| >1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* | Back alignment and structure |
|---|
| >2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus} | Back alignment and structure |
|---|
| >2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} | Back alignment and structure |
|---|
| >3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... | Back alignment and structure |
|---|
| >3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B | Back alignment and structure |
|---|
| >3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... | Back alignment and structure |
|---|
| >4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N | Back alignment and structure |
|---|
| >1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A | Back alignment and structure |
|---|
| >1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* | Back alignment and structure |
|---|
| >3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B | Back alignment and structure |
|---|
| >1wa5_C Importin alpha RE-exporter; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1z3h_A | Back alignment and structure |
|---|
| >3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A | Back alignment and structure |
|---|
| >2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} | Back alignment and structure |
|---|
| >2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A | Back alignment and structure |
|---|
| >2x1g_F Cadmus; transport protein, developmental protein, mRNA processing, nuclear transport, mRNA splicing, mRNA transport; 3.35A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3gs3_A Symplekin, LD45768P; helix-turn-helix heat repeat extended loop, transcription, protein binding; 2.40A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 | Back alignment and structure |
|---|
| >2x19_B Importin-13; nuclear transport, protein transport; HET: GTP; 2.80A {Homo sapiens} PDB: 2xwu_B | Back alignment and structure |
|---|
| >1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 | Back alignment and structure |
|---|
| >2x1g_F Cadmus; transport protein, developmental protein, mRNA processing, nuclear transport, mRNA splicing, mRNA transport; 3.35A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3o2t_A Symplekin; heat repeat, scaffold, protein binding; 1.40A {Homo sapiens} PDB: 3odr_A 3ods_A 4h3k_A* 3o2s_A 3o2q_A* 4h3h_A* | Back alignment and structure |
|---|
| >2x19_B Importin-13; nuclear transport, protein transport; HET: GTP; 2.80A {Homo sapiens} PDB: 2xwu_B | Back alignment and structure |
|---|
| >3ibv_A Exportin-T; karyopherin, heat repeat, cytoplasm, nucleus, RNA- binding, transport, tRNA processing, tRNA-binding, RNA binding protein; 3.10A {Schizosaccharomyces pombe} PDB: 3icq_T* | Back alignment and structure |
|---|
| >3m1i_C Exportin-1; heat repeat, GTP-binding, nucleotide-binding, NUCL protein transport, transport, cytoplasm, GTPase activation; HET: GTP; 2.00A {Saccharomyces cerevisiae} PDB: 2l1l_B | Back alignment and structure |
|---|
| >4hat_C Exportin-1; heat repeat, nuclear export, RAN-ranbp1, LMB, leptomycin B, protein transport-antibiotic complex; HET: GNP LMB; 1.78A {Saccharomyces cerevisiae} PDB: 4hau_C* 4hav_C* 4hb2_C* 4hax_C* 4haw_C* 4hay_C* 4hb3_C* 4haz_C* 4hb4_C* 3m1i_C* 4hb0_C* 4gmx_C* 4gpt_C* 3vyc_A 2l1l_B | Back alignment and structure |
|---|
| >1vsy_5 Proteasome activator BLM10; 20S proteasome BLM10, hydrolase, nucleus, phosphoprotein, PR proteasome, threonine protease; 3.00A {Saccharomyces cerevisiae} PDB: 3l5q_6 | Back alignment and structure |
|---|
| >3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus} | Back alignment and structure |
|---|
| >2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A | Back alignment and structure |
|---|
| >3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >4ffb_C Protein STU2; tubulin fold, heat repeats, cytoskeleton, microtubule, tubul domain, hydrolase; HET: GTP; 2.88A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A | Back alignment and structure |
|---|
| >3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >4hat_C Exportin-1; heat repeat, nuclear export, RAN-ranbp1, LMB, leptomycin B, protein transport-antibiotic complex; HET: GNP LMB; 1.78A {Saccharomyces cerevisiae} PDB: 4hau_C* 4hav_C* 4hb2_C* 4hax_C* 4haw_C* 4hay_C* 4hb3_C* 4haz_C* 4hb4_C* 3m1i_C* 4hb0_C* 4gmx_C* 4gpt_C* 3vyc_A 2l1l_B | Back alignment and structure |
|---|
| >3m1i_C Exportin-1; heat repeat, GTP-binding, nucleotide-binding, NUCL protein transport, transport, cytoplasm, GTPase activation; HET: GTP; 2.00A {Saccharomyces cerevisiae} PDB: 2l1l_B | Back alignment and structure |
|---|
| >2of3_A ZYG-9; multifunctional macromolecule, kinetochore, microtubule, XMAP215, STU2, DIS1, microtubule associated protein, structural protein; 1.90A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A | Back alignment and structure |
|---|
| >3ibv_A Exportin-T; karyopherin, heat repeat, cytoplasm, nucleus, RNA- binding, transport, tRNA processing, tRNA-binding, RNA binding protein; 3.10A {Schizosaccharomyces pombe} PDB: 3icq_T* | Back alignment and structure |
|---|
| >3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A | Back alignment and structure |
|---|
| >3oc3_A Helicase MOT1, MOT1; regulation of transcription, hydrolase-transc complex; HET: MES; 3.10A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >2b6c_A Hypothetical protein EF3068; structural genomis, DNA repair enzyme, structural genomics, protein structure initiative; HET: SO4; 2.10A {Enterococcus faecalis} SCOP: a.118.1.17 | Back alignment and structure |
|---|
| >3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} | Back alignment and structure |
|---|
| >4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N | Back alignment and structure |
|---|
| >2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3gjx_A Exportin-1; transport, cytoplasm, nucleus, RNA-binding, acetylation, GTP-binding, HOST-virus interaction, nucleotide-binding, phosphoprotein; HET: GTP; 2.50A {Mus musculus} PDB: 3nby_A* 3nbz_A* 3nc0_A* 3nc1_A* 3gb8_A | Back alignment and structure |
|---|
| >4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A | Back alignment and structure |
|---|
| >3u0r_A Apoptosis inhibitor 5; heat repeat, armadillo repeat, lysine acetylation; 2.50A {Homo sapiens} PDB: 3v6a_A | Back alignment and structure |
|---|
| >4atg_A TAF6; transcription, TFIID; HET: NHE; 1.89A {Antonospora locustae} | Back alignment and structure |
|---|
| >3oc3_A Helicase MOT1, MOT1; regulation of transcription, hydrolase-transc complex; HET: MES; 3.10A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} | Back alignment and structure |
|---|
| >2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3jxy_A Alkylpurine DNA glycosylase ALKD; heat repeat, DNA binding, DNA glycosylase, DNA alkylation, L complex, hydrolase-DNA complex; HET: DNA; 1.50A {Bacillus cereus} SCOP: a.118.1.0 PDB: 3jx7_A* 3bvs_A 3jy1_A* 3jxz_A* | Back alignment and structure |
|---|
| >3gjx_A Exportin-1; transport, cytoplasm, nucleus, RNA-binding, acetylation, GTP-binding, HOST-virus interaction, nucleotide-binding, phosphoprotein; HET: GTP; 2.50A {Mus musculus} PDB: 3nby_A* 3nbz_A* 3nc0_A* 3nc1_A* 3gb8_A | Back alignment and structure |
|---|
| >3ut4_A CTHE_2751, putative uncharacterized protein; non PFAM singleton, helical fold, unknown function; 2.03A {Clostridium thermocellum} PDB: 3ut8_A 3ut7_A | Back alignment and structure |
|---|
| >1lsh_A Lipovitellin (LV-1N, LV-1C); vitellogenin, lipoprotein, plasma apolipoprote apolipoprotein B, APOB; HET: PLD UPL; 1.90A {Ichthyomyzon unicuspis} SCOP: a.118.4.1 f.7.1.1 f.7.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 114 | ||||
| d1b3ua_ | 588 | a.118.1.2 (A:) Constant regulatory domain of prote | 6e-07 | |
| d1b3ua_ | 588 | a.118.1.2 (A:) Constant regulatory domain of prote | 6e-05 | |
| d1b3ua_ | 588 | a.118.1.2 (A:) Constant regulatory domain of prote | 0.003 | |
| d1lrva_ | 233 | a.118.1.5 (A:) Leucine-rich repeat variant {Azotob | 1e-05 | |
| d1lrva_ | 233 | a.118.1.5 (A:) Leucine-rich repeat variant {Azotob | 0.002 |
| >d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 588 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: alpha-alpha superhelix superfamily: ARM repeat family: HEAT repeat domain: Constant regulatory domain of protein phosphatase 2a, pr65alpha species: Human (Homo sapiens) [TaxId: 9606]
Score = 44.0 bits (102), Expect = 6e-07
Identities = 20/87 (22%), Positives = 34/87 (39%)
Query: 1 MKLLLTINSDGNFVSKSIKRTQDLVADPNQHVKSALASVIMGLSPILGKHNTVDHLLPLF 60
+K L+ + I + + DPN + I LS + G+ T H+LP
Sbjct: 465 LKKLVEKFGKEWAHATIIPKVLAMSGDPNYLHRMTTLFCINVLSEVCGQDITTKHMLPTV 524
Query: 61 LSQLKDECPEVRLNIISNLDCVNEVIG 87
L D VR N+ +L + ++
Sbjct: 525 LRMAGDPVANVRFNVAKSLQKIGPILD 551
|
| >d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 588 | Back information, alignment and structure |
|---|
| >d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 588 | Back information, alignment and structure |
|---|
| >d1lrva_ a.118.1.5 (A:) Leucine-rich repeat variant {Azotobacter vinelandii [TaxId: 354]} Length = 233 | Back information, alignment and structure |
|---|
| >d1lrva_ a.118.1.5 (A:) Leucine-rich repeat variant {Azotobacter vinelandii [TaxId: 354]} Length = 233 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 114 | |||
| d1b3ua_ | 588 | Constant regulatory domain of protein phosphatase | 99.39 | |
| d1b3ua_ | 588 | Constant regulatory domain of protein phosphatase | 99.27 | |
| d1ibrb_ | 458 | Importin beta {Human (Homo sapiens) [TaxId: 9606]} | 98.96 | |
| d1te4a_ | 111 | MTH187 {Archaeon Methanobacterium thermoautotrophi | 98.57 | |
| d2vglb_ | 579 | Adaptin beta subunit N-terminal fragment {Human (H | 98.48 | |
| d1te4a_ | 111 | MTH187 {Archaeon Methanobacterium thermoautotrophi | 98.47 | |
| d1qbkb_ | 888 | Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 | 98.26 | |
| d1oyza_ | 276 | Hypothetical protein YibA {Escherichia coli [TaxId | 98.03 | |
| d1oyza_ | 276 | Hypothetical protein YibA {Escherichia coli [TaxId | 98.0 | |
| d2vglb_ | 579 | Adaptin beta subunit N-terminal fragment {Human (H | 97.95 | |
| d1qgra_ | 876 | Importin beta {Human (Homo sapiens) [TaxId: 9606]} | 97.9 | |
| d1ibrb_ | 458 | Importin beta {Human (Homo sapiens) [TaxId: 9606]} | 97.88 | |
| d2bpta1 | 861 | Importin beta {Baker's yeast (Saccharomyces cerevi | 97.88 | |
| d1u6gc_ | 1207 | Cullin-associated NEDD8-dissociated protein 1 (Tip | 97.87 | |
| d1qbkb_ | 888 | Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 | 97.86 | |
| d1lrva_ | 233 | Leucine-rich repeat variant {Azotobacter vinelandi | 97.76 | |
| d2vgla_ | 584 | Adaptin alpha C subunit N-terminal fragment {Mouse | 97.72 | |
| d2bpta1 | 861 | Importin beta {Baker's yeast (Saccharomyces cerevi | 97.61 | |
| d1xm9a1 | 457 | Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} | 97.56 | |
| d1u6gc_ | 1207 | Cullin-associated NEDD8-dissociated protein 1 (Tip | 97.53 | |
| d1q1sc_ | 434 | Importin alpha {Mouse (Mus musculus) [TaxId: 10090 | 97.02 | |
| d1xqra1 | 264 | Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi | 96.93 | |
| d1qgra_ | 876 | Importin beta {Human (Homo sapiens) [TaxId: 9606]} | 96.93 | |
| d1q1sc_ | 434 | Importin alpha {Mouse (Mus musculus) [TaxId: 10090 | 96.67 | |
| d1lrva_ | 233 | Leucine-rich repeat variant {Azotobacter vinelandi | 96.65 | |
| d1xqra1 | 264 | Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi | 96.32 | |
| d1xm9a1 | 457 | Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} | 96.31 | |
| d1wa5c_ | 959 | Exportin Cse1p {Baker's yeast (Saccharomyces cerev | 96.12 | |
| d1jdha_ | 529 | beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} | 96.01 | |
| d1wa5b_ | 503 | Karyopherin alpha {Baker's yeast (Saccharomyces ce | 95.76 | |
| d1wa5b_ | 503 | Karyopherin alpha {Baker's yeast (Saccharomyces ce | 95.69 | |
| d1jdha_ | 529 | beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} | 95.64 | |
| d2vgla_ | 584 | Adaptin alpha C subunit N-terminal fragment {Mouse | 95.27 | |
| d1wa5c_ | 959 | Exportin Cse1p {Baker's yeast (Saccharomyces cerev | 93.35 | |
| d1lsha1 | 336 | Lipovitellin-phosvitin complex, superhelical domai | 92.91 | |
| d2b6ca1 | 213 | Hypothetical protein EF3068 {Enterococcus faecalis | 80.54 |
| >d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: alpha-alpha superhelix superfamily: ARM repeat family: HEAT repeat domain: Constant regulatory domain of protein phosphatase 2a, pr65alpha species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.39 E-value=6.2e-13 Score=104.25 Aligned_cols=99 Identities=17% Similarity=0.159 Sum_probs=88.2
Q ss_pred hccCChhHHHHhhHHHHHHhcCCCCHHHHHHHHHHHHccccccCcchhhhhhHHHHHHhcCCCChHHHHHHHHhHHHHHh
Q psy13759 5 LTINSDGNFVSKSIKRTQDLVADPNQHVKSALASVIMGLSPILGKHNTVDHLLPLFLSQLKDECPEVRLNIISNLDCVNE 84 (114)
Q Consensus 5 ~~~~~~~~~~~~ilP~l~~L~~D~s~~VR~~~a~~l~~la~~lg~e~~~~~llP~~~~LL~D~e~EVR~~a~~~l~~~~~ 84 (114)
+..++++...+.++|.+..+++|++|+||.++++.++++++.+|++...+.++|.+.++++|++++||..++..+..+++
T Consensus 231 ~~~~~~~~~~~~i~~~l~~~~~D~~~~Vr~~~~~~l~~l~~~~~~~~~~~~l~~~l~~ll~d~~~~vr~~a~~~l~~~~~ 310 (588)
T d1b3ua_ 231 AQLLPQEDLEALVMPTLRQAAEDKSWRVRYMVADKFTELQKAVGPEITKTDLVPAFQNLMKDCEAEVRAAASHKVKEFCE 310 (588)
T ss_dssp HHHSCHHHHHHHTHHHHHHHHTCSSHHHHHHHHHTHHHHHHHHCHHHHHHTHHHHHHHHHTCSSHHHHHHHHHHHHHHHH
T ss_pred hccCCHHHHHHHHHHHHHHhcccccHHHHHHHHHhHHHHHHHhhhhhhhhhhhHHHHHHHhccchHHHHHHHHHHHHHHH
Confidence 44567788888899999999999999999999999999999999999989999999999999999999999999999999
Q ss_pred hhChhh----HhhhHhHHHHHHH
Q psy13759 85 VIGIQQ----DVSFKLGQVDRTS 103 (114)
Q Consensus 85 ~l~~~~----i~~~iLP~i~~l~ 103 (114)
.++.+. ..++++|.+.++.
T Consensus 311 ~l~~~~~~~~~~~~i~~~l~~~~ 333 (588)
T d1b3ua_ 311 NLSADCRENVIMSQILPCIKELV 333 (588)
T ss_dssp TSCTTTHHHHHHHTHHHHHHHHH
T ss_pred HHhhhhhhhhhHHHHHHHHHHhh
Confidence 987653 4577888876653
|
| >d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lrva_ a.118.1.5 (A:) Leucine-rich repeat variant {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1lrva_ a.118.1.5 (A:) Leucine-rich repeat variant {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wa5c_ a.118.1.1 (C:) Exportin Cse1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wa5c_ a.118.1.1 (C:) Exportin Cse1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1lsha1 a.118.4.1 (A:285-620) Lipovitellin-phosvitin complex, superhelical domain {Lamprey (Ichthyomyzon unicuspis) [TaxId: 30308]} | Back information, alignment and structure |
|---|
| >d2b6ca1 a.118.1.17 (A:3-215) Hypothetical protein EF3068 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|