Psyllid ID: psy13906

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910----
MQGKEVGSIIGKSGETVKKLREESGSKIYISDSSTPERIVTVIGSMDSLFRAFSLITKNIEEFHKNQNKHLGGNGESQLIQLRLIVPASQCGSIIGKGGSQIKTIRETSGASVYVASDMLPNSTEREVNIKGVPDAVTQAIYQICLIMVDSPPKGATIPYRPLPQNAGGPGLIGNQFGMQNSLMGAPDMGNNPLAGLAALGLGGNSGGGMGGGLNAAALAALASSQLKTNHMPRNQNQNQNQHNRNNRDGPSQKTNQQQNQITKEMTVPNELIGAVIGKGGTKIFEIRKISGAMIRISKSSEEEEDSNDRTITMTGTPDAIALAQYLINMSVELLRANLNGEGGGESNMDDFSSDNNLPSSAPLAGLNASNPLAAALPQLAQILTKPGALNALTSLSALGGLSDLLGGGSSGGGSGNSGGFGGVPQGPNYANIQTTGVQRRMRHIMQGKEVGSIIGKSGETVKKLREESGSKIYISDSSTPERIVTVIGSMDSLFRAFSLITKNIEEFHKNQNKHLGGNGESQLIQLRLIVPASQCGSIIGKGGSQIKTIRETSGASVYVASDMLPNSTEREVNIKGVPDAVTQAIYQICLIMVDSPPKGATIPYRPLPQNAGGPGLIGNQFGMQNSLMGAPDMGNNPLAGLAALGLGGNSGGGMGGGLNAAALAALASSQLKTNHMPRNQNQNQNQHNRNNRDGPSQKTNQQQNQITKEMTVPNELIGAVIGKGGTKIFEIRKISGAMIRISKSSEEEEDSNDRTITMTGTPDAIALAQYLINMSVELLRANLNGEGGGESNMDDFSSDNNLPSSAPLAGLNASNPLAAALPQLAQILTKPAGLNASNPLAAALPQLAQILTKPGALNALTSLSALGGLSDLLGGGSSGGGSGNSGGFGGVPQGPNYANIQTTGVQRRNSLSV
cccccEEEEEccccHHHHHHHHHHccEEEcccccccccEEEEEccHHHHHHHHHHHHHHHHHHHHccccccccccccccEEEEEEEcccccccccccccHHHHHHHHHHcccEEEcccccccccccEEEEEccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccEEEEEEEccccEEEEEcccccHHHHcHHcccccEEEccccccccccccEEEEEEccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEcccccEEEccccHHHHHHHHHHccEEEcccccccccEEEEEccHHHHHHHHHHHHHHHHHHHHHcccccccccccccEEEEEEEcccccccEEccccHHHHHHHHHHccEEEEccccccccccEEEEEEccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccEEEEEcccccccccccccccHHHHHHHHHccEEEEcccccccccccEEEEEEEccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccc
ccccEEEEEEcccccEHHHHHHHcccEEEEccccccccEEEEEccHHHHHHHHHHHHHHHHHHccccccccccccccccEEEEEEEccccEEEEEccccHHHHHHHHHcccEEEEcccccccccccEEEEEccHHHHHHHHHHHHHHHHHccccccccccccccccccccEccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccccEEEEEEEEcccHHHHHccccHHHHHHHHHHccEEEEcccccccccccEEEEEEEEcHHHHHHHHHHHHHHcHHcccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccccccccEcccccccccccccccccccccccccccccccccEEEEEEEEccccEEEEEEccccEHHHHHHHcccEEEEccccccccEEEEEccHHHHHHHHHHHHHHHHHHccccccccccccccccEEEEEEEEccccEEEEccccHHHHHHHHHcccEEEEEccccccccccEEEEEccHHHHHHHHHHHHHHHHHccccccccccccccccccccEccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccccccccccccccccccccccccccEEEEEEEEcccHHHHHccccHHHHHHHHHHccEEEEcccccccccccEEEEEEEEcHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccHHHHHHHcccccHccccccccccccccEccccccccccccccccccccccccccccccccccccccccc
MQGKEVGSIIGKSGETVKKLREEsgskiyisdsstpeRIVTVIGSMDSLFRAFSLITKNIEEFHKNqnkhlggngesQLIQLRLIvpasqcgsiigkggsqiktiretsgasvyvasdmlpnsterevnikgvpDAVTQAIYQICLImvdsppkgatipyrplpqnaggpglignqfgmqnslmgapdmgnnplAGLAALglggnsgggmggGLNAAALAALASSQlktnhmprnqnqnqnqhnrnnrdgpsqktnqQQNQitkemtvpnELIGAVIGKGGTKIFEIRKISGAMIRisksseeeedsndrtitmtGTPDAIALAQYLINMSVELLRANlngegggesnmddfssdnnlpssaplaglnasnplAAALPQLAQILTKPGALNALTSLSALgglsdllgggssgggsgnsggfggvpqgpnyaniqTTGVQRRMRHIMQGKEVGSIIGKSGETVKKLREEsgskiyisdsstpeRIVTVIGSMDSLFRAFSLITKNIEEFHKNqnkhlggngesQLIQLRLIvpasqcgsiigkggsqiktiretsgasvyvasdmlpnsterevnikgvpDAVTQAIYQICLImvdsppkgatipyrplpqnaggpglignqfgmqnslmgapdmgnnplAGLAALglggnsgggmggGLNAAALAALASSQlktnhmprnqnqnqnqhnrnnrdgpsqktnqQQNQitkemtvpnELIGAVIGKGGTKIFEIRKISGAMIRisksseeeedsndrtitmtGTPDAIALAQYLINMSVELLRANlngegggesnmddfssdnnlpssaplaglnasnplAAALPQLAQIltkpaglnasnplAAALPQLAQILTKPGALNALTSLSALgglsdllgggssgggsgnsggfggvpqgpnyaniqttgvqrrnslsv
mqgkevgsiigksgetvKKLREesgskiyisdsstperIVTVIGSMDSLFRAFSLITKNIEEFHKNQNKHLGGNGESQLIQLRLIVPASQCGSIIGKGGSQIKTIRETSGASVYVASDMLPNSTEREVNIKGVPDAVTQAIYQICLIMVDSPPKGATIPYRPLPQNAGGPGLIGNQFGMQNSLMGAPDMGNNPLAGLAALGLGGNSGGGMGGGLNAAALAALASSQLKTNHMPRNQNQNQNQHNRNNRDGPSQKTNQQQNQitkemtvpneligavigkggtkiFEIRKIsgamirisksseeeedsndrtitMTGTPDAIALAQYLINMSVELLRANLNGEGGGESNMDDFSSDNNLPSSAPLAGLNASNPLAAALPQLAQILTKPGALNALTSLSALGGLSDLLGGGSSGGGSGNSGGFGGVPQGPNYANIQTTGVQRRMRHIMqgkevgsiigksgetVKKLREESgskiyisdsstperIVTVIGSMDSLFRAFSLITKNIEEFHKNQNKHLGGNGESQLIQLRLIVPASQCGSIIGKGGSQIKTIRETSGASVYVASDMLPNSTEREVNIKGVPDAVTQAIYQICLIMVDSPPKGATIPYRPLPQNAGGPGLIGNQFGMQNSLMGAPDMGNNPLAGLAALGLGGNSGGGMGGGLNAAALAALASSQLKTNHMPRNQNQNQNQHNRNNRDGPSQKTNQQQNQitkemtvpneligavigkggtkiFEIRKIsgamirisksseeeedsndrtitMTGTPDAIALAQYLINMSVELLRANLNGEGGGESNMDDFSSDNNLPSSAPLAGLNASNPLAAALPQLAQILTKPAGLNASNPLAAALPQLAQILTKPGALNALTSLSALGGLSDLLGGGSSGGGSGNSGGFGGVPQGPnyaniqttgvqrrnslsv
MQGKEVGSIIGKSGETVKKLREESGSKIYISDSSTPERIVTVIGSMDSLFRAFSLITKNIEEFHKNQNKHLGGNGESQLIQLRLIVPASQCgsiigkggsqiktiRETSGASVYVASDMLPNSTEREVNIKGVPDAVTQAIYQICLIMVDSPPKGATIPYRPLPQNAGGPGLIGNQFGMQNSLMGAPDMgnnplaglaalglggnsgggmggglnaaalaalaSSQLKTNHMPrnqnqnqnqhnrnnrDGPSqktnqqqnqitkEMTVPNELIGAVIGKGGTKIFEIRKISGAMIRIsksseeeedsNDRTITMTGTPDAIALAQYLINMSVELLRANLNGEGGGESNMDDFSSDNNLPSSaplaglnasnplaaalpqlaqilTKPgalnaltslsalgglsdllgggssgggsgnsggfggVPQGPNYANIQTTGVQRRMRHIMQGKEVGSIIGKSGETVKKLREESGSKIYISDSSTPERIVTVIGSMDSLFRAFSLITKNIEEFHKNQNKHLGGNGESQLIQLRLIVPASQCgsiigkggsqiktiRETSGASVYVASDMLPNSTEREVNIKGVPDAVTQAIYQICLIMVDSPPKGATIPYRPLPQNAGGPGLIGNQFGMQNSLMGAPDMgnnplaglaalglggnsgggmggglnaaalaalaSSQLKTNHMPrnqnqnqnqhnrnnrDGPSqktnqqqnqitkEMTVPNELIGAVIGKGGTKIFEIRKISGAMIRIsksseeeedsNDRTITMTGTPDAIALAQYLINMSVELLRANLNGEGGGESNMDDFSSDNNLPSSaplaglnasnplaaalpqlaqilTKPAGlnasnplaaalpqlaqilTKPgalnaltslsalgglsdllgggssgggsgnsggfggVPQGPNYANIQTTGVQRRNSLSV
************************************ERIVTVIGSMDSLFRAFSLITKNIEEFHKNQNKHLGGNGESQLIQLRLIVPASQCGSIIGKGGSQIKTIRETSGASVYVASDML*****REVNIKGVPDAVTQAIYQICLIMVDSP***ATIPY***********************************GLAALGL*****************************************************************VPNELIGAVIGKGGTKIFEIRKISGAMI*********************TPDAIALAQYLINMSVELLRAN**************************************LPQLAQILTKPGALNALT***************************************************************************************ERIVTVIGSMDSLFRAFSLITKNIEEFHKNQNKHLGGNGESQLIQLRLIVPASQCGSIIGKGGSQIKTIRETSGASVYVASDML*****REVNIKGVPDAVTQAIYQICLIMVDSP***ATIPY***********************************GLAALGL*****************************************************************VPNELIGAVIGKGGTKIFEIRKISGAMI*********************TPDAIALAQYLINMSVELLRAN**************************************LPQLAQILTKPAGLNASNPLAAALPQLAQILTKPGALNALTS***************************************************
***KEVGSIIGKSGETVKKLREESGSKIYISDSSTPERIVTVIGSMDSLFRAFSLITKNIEE*******************LRLIVPASQCGSIIGKGGSQIKTIRETSGASVYVASDMLPNSTEREVNIKGVPDAVTQAIYQICLIMVDSPP***********************FGMQNSLMGAPDMGNNPLAGLAAL************GLNAAALAALASSQLK***********************************KEMTVPNELIGAVIGKGGTKIF***K*********************TITMTGTPDAIALAQYLINMSVE*****************************************AALPQLA*******************GLSDLLGGGSSGGGSGNS******************GVQRRMRHIMQGKEVGSIIGKSGETVKKLREESGSKIYISDSSTPERIVTVIGSMDSLFRAFSLITKNIEE*******************LRLIVPASQCGSIIGKGGSQIKTIRETSGA*VYVASDMLPNSTEREVNIKGVPDAVTQAIYQICLIMVDSP************************************MGNNPLAGLAALGLGGNSGGGMGGGLNAAALAALASSQ*********************************NQITKEMTVPNELIGAVIGKGGTKIFEIRKISGAMIRI*********SNDRTITMTGTPDAIALAQYLINM*******************************************************************************************************************************************
********IIGKSGETVKKLREESGSKIYISDSSTPERIVTVIGSMDSLFRAFSLITKNIEEFHKNQNKHLGGNGESQLIQLRLIVPASQCGSIIGKGGSQIKTIRETSGASVYVASDMLPNSTEREVNIKGVPDAVTQAIYQICLIMVDSPPKGATIPYRPLPQNAGGPGLIGNQFGMQNSLMGAPDMGNNPLAGLAALGLGGNSGGGMGGGLNAAALAALASSQLKTNHMPRN**************************ITKEMTVPNELIGAVIGKGGTKIFEIRKISGAMIRIS************TITMTGTPDAIALAQYLINMSVELLRANLNGEGGGESNMDDFSSDNNLPSSAPLAGLNASNPLAAALPQLAQILTKPGALNALTSLSALGGLSDLLGGGSSGGGSGNSGGFGGVPQGPNYANIQTTGVQRRMRHIMQGKEVGSIIGKSGETVKKLREESGSKIYISDSSTPERIVTVIGSMDSLFRAFSLITKNIEEFHKNQNKHLGGNGESQLIQLRLIVPASQCGSIIGKGGSQIKTIRETSGASVYVASDMLPNSTEREVNIKGVPDAVTQAIYQICLIMVDSPPKGATIPYRPLPQNAGGPGLIGNQFGMQNSLMGAPDMGNNPLAGLAALGLGGNSGGGMGGGLNAAALAALASSQLKTNHMPRN**************************ITKEMTVPNELIGAVIGKGGTKIFEIRKISGAMIRIS************TITMTGTPDAIALAQYLINMSVELLRANLNGEGGGESNMDDFSSDNNLPSSAPLAGLNASNPLAAALPQLAQILTKPAGLNASNPLAAALPQLAQILTKPGALNALTSLSALGGLSDLLGGGSSGGGSGNSGGFGGVPQGPNYANIQTTGVQRRNSLSV
***KEVGSIIGKSGETVKKLREESGSKIYISDSSTPERIVTVIGSMDSLFRAFSLITKNIEEFHK***********SQLIQLRLIVPASQCGSIIGKGGSQIKTIRETSGASVYVASDMLPNSTEREVNIKGVPDAVTQAIYQICLIMVDSPPKGATIPYRPLPQNAGGPGLIGNQFGMQNSLMGAPDMGNNPLAGLAALGLGGNSGGGMGGGLNAAALAALASSQLKTNHM*RNQNQNQ******************QNQITKEMTVPNELIGAVIGKGGTKIFEIRKISGAMIRISKSSEEEEDSNDRTITMTGTPDAIALAQYLINMSVELLR******************DNNLPSSAPLAGLNASNPLAAALPQLAQILTKPGALNALTSLSALGGLSDLLGG***************************TGVQRRMRHIMQGKEVGSIIGKSGETVKKLREESGSKIYISDSSTPERIVTVIGSMDSLFRAFSLITKNIEEFHK***********SQLIQLRLIVPASQCGSIIGKGGSQIKTIRETSGASVYVASDMLPNSTEREVNIKGVPDAVTQAIYQICLIMVDSPPKGATIPYRPLPQNAGGPGLIGNQFGMQNSLMGAPDMGNNPLAGLAALGLGGNSGGGMGGGLNAAALAALASSQLKTNHMPRNQNQNQNQH***************QNQITKEMTVPNELIGAVIGKGGTKIFEIRKISGAMIRISKSSEEEEDSNDRTITMTGTPDAIALAQYLINMSVE************************LPSSAPLAGLNASNPLAAALPQLAQILTKPAGLNASNPLAAALPQLAQILTKPGALNALTSLSALGGLSDLLGGGSSGGGSGNSGGFGGVPQGP*YA*I*TTGV********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQGKEVGSIIGKSGETVKKLREESGSKIYISDSSTPERIVTVIGSMDSLFRAFSLITKNIEEFHKNQNKHLGGNGESQLIQLRLIVPASQCGSIIGKGGSQIKTIRETSGASVYVASDMLPNSTEREVNIKGVPDAVTQAIYQICLIMVDSPPKGATIPYRPLPQNAGGPGLIGNQFGMQNSLMGAPDMGNNPLAGLAALGLGGNSGGGMGGGLNAAALAALASSQLKTNHMPRNQNQNQNQHNRNNRDGPSQKTNQQQNQITKEMTVPNELIGAVIGKGGTKIFEIRKISGAMIRISKSSEEEEDSNDRTITMTGTPDAIALAQYLINMSVELLRANLNGEGGGESNMDDFSSDNNLPSSAPLAGLNASNPLAAALPQLAQILTKPGALNALTSLSALGGLSDLLGGGSSGGGSGNSGGFGGVPQGPNYANIQTTGVQRRMRHIMQGKEVGSIIGKSGETVKKLREESGSKIYISDSSTPERIVTVIGSMDSLFRAFSLITKNIEEFHKNQNKHLGGNGESQLIQLRLIVPASQCGSIIGKGGSQIKTIRETSGASVYVASDMLPNSTEREVNIKGVPDAVTQAIYQICLIMVDSPPKGATIPYRPLPQNAGGPGLIGNQFGMQNSLMGAPDMGNNPLAGLAALGLGGNSGGGMGGGLNAAALAALASSQLKTNHMPRNQNQNQNQHNRNNRDGPSQKTNQQQNQITKEMTVPNELIGAVIGKGGTKIFEIRKISGAMIRISKSSEEEEDSNDRTITMTGTPDAIALAQYLINMSVELLRANLNGEGGGESNMDDFSSDNNLPSSAPLAGLNASNPLAAALPQLAQILTKPAGLNASNPLAAALPQLAQILTKPGALNALTSLSALGGLSDLLGGGSSGGGSGNSGGFGGVPQGPNYANIQTTGVQRRNSLSV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query914 2.2.26 [Sep-21-2011]
P57722371 Poly(rC)-binding protein yes N/A 0.340 0.838 0.460 2e-69
P57721371 Poly(rC)-binding protein yes N/A 0.340 0.838 0.460 2e-69
Q61990362 Poly(rC)-binding protein no N/A 0.367 0.928 0.409 9e-64
P57723403 Poly(rC)-binding protein no N/A 0.373 0.846 0.394 4e-63
P57724403 Poly(rC)-binding protein no N/A 0.353 0.801 0.403 6e-63
Q0VCU0403 Poly(rC)-binding protein no N/A 0.353 0.801 0.408 1e-62
Q15366365 Poly(rC)-binding protein no N/A 0.359 0.901 0.401 4e-62
O19048356 Poly(rC)-binding protein no N/A 0.343 0.882 0.401 2e-58
P60335356 Poly(rC)-binding protein no N/A 0.343 0.882 0.401 2e-58
Q15365356 Poly(rC)-binding protein no N/A 0.343 0.882 0.401 2e-58
>sp|P57722|PCBP3_MOUSE Poly(rC)-binding protein 3 OS=Mus musculus GN=Pcbp3 PE=2 SV=3 Back     alignment and function desciption
 Score =  264 bits (675), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 157/341 (46%), Positives = 209/341 (61%), Gaps = 30/341 (8%)

Query: 438 VQRRMRHIMQGKEVGSIIGKSGETVKKLREESGSKIYISDSSTPERIVTVIGSMDSLFRA 497
           V   +R +M GKEVGSIIGK GETVKK+REESG++I IS+ + PERIVT+ G  D++F+A
Sbjct: 44  VTLTIRLLMHGKEVGSIIGKKGETVKKMREESGARINISEGNCPERIVTITGPTDAIFKA 103

Query: 498 FSLITKNIEEFHKNQNKHLGGNGESQLIQLRLIVPASQCGSIIGKGGSQIKTIRETSGAS 557
           F++I    EE   N   +     +   + LRL+VPASQCGS+IGKGGS+IK IRE++GA 
Sbjct: 104 FAMIAYKFEEDIINSMSNSPATSKPP-VTLRLVVPASQCGSLIGKGGSKIKEIRESTGAQ 162

Query: 558 VYVASDMLPNSTEREVNIKGVPDAVTQAIYQICLIMVDSPPKGATIPYRPLPQNAGGPGL 617
           V VA DMLPNSTER V I G PDA+ Q + QIC++M++SPPKGATIPYRP P  A  P +
Sbjct: 163 VQVAGDMLPNSTERAVTISGTPDAIIQCVKQICVVMLESPPKGATIPYRPKP--ASTPVI 220

Query: 618 I--GNQFGMQNSL-MGAPDMGNNPLAGLAALGLGGNSGGGMGGGLNAAALAALASSQLKT 674
              G  + +Q    +  PD     L  L  L +       +G                +T
Sbjct: 221 FAGGQAYTIQGQYAIPHPDQ----LTKLHQLAMQQTPFPPLG----------------QT 260

Query: 675 N-HMPRNQNQNQNQHNRNNRDGPSQKTNQQQNQITKEMTVPNELIGAVIGKGGTKIFEIR 733
           N   P  +    +     N  G S   +      T E+T+PN+LIG +IG+ GTKI EIR
Sbjct: 261 NPAFPGEKLPLHSSEEAQNLMGQSSGLDASPPASTHELTIPNDLIGCIIGRQGTKINEIR 320

Query: 734 KISGAMIRISKSSEEEEDSNDRTITMTGTPDAIALAQYLIN 774
           ++SGA I+I+ ++   E S++R IT+TGTP  I+LAQYLIN
Sbjct: 321 QMSGAQIKIANAT---EGSSERQITITGTPANISLAQYLIN 358
Single-stranded nucleic acid binding protein that binds preferentially to oligo dC.
Mus musculus (taxid: 10090)
>sp|P57721|PCBP3_HUMAN Poly(rC)-binding protein 3 OS=Homo sapiens GN=PCBP3 PE=2 SV=2 Back     alignment and function description
>sp|Q61990|PCBP2_MOUSE Poly(rC)-binding protein 2 OS=Mus musculus GN=Pcbp2 PE=1 SV=1 Back     alignment and function description
>sp|P57723|PCBP4_HUMAN Poly(rC)-binding protein 4 OS=Homo sapiens GN=PCBP4 PE=2 SV=1 Back     alignment and function description
>sp|P57724|PCBP4_MOUSE Poly(rC)-binding protein 4 OS=Mus musculus GN=Pcbp4 PE=2 SV=1 Back     alignment and function description
>sp|Q0VCU0|PCBP4_BOVIN Poly(rC)-binding protein 4 OS=Bos taurus GN=PCBP4 PE=2 SV=1 Back     alignment and function description
>sp|Q15366|PCBP2_HUMAN Poly(rC)-binding protein 2 OS=Homo sapiens GN=PCBP2 PE=1 SV=1 Back     alignment and function description
>sp|O19048|PCBP1_RABIT Poly(rC)-binding protein 1 OS=Oryctolagus cuniculus GN=PCBP1 PE=2 SV=1 Back     alignment and function description
>sp|P60335|PCBP1_MOUSE Poly(rC)-binding protein 1 OS=Mus musculus GN=Pcbp1 PE=1 SV=1 Back     alignment and function description
>sp|Q15365|PCBP1_HUMAN Poly(rC)-binding protein 1 OS=Homo sapiens GN=PCBP1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query914
383862493466 PREDICTED: poly(rC)-binding protein 4-li 0.399 0.783 0.567 1e-97
328720738436 PREDICTED: poly(rC)-binding protein 3-li 0.437 0.917 0.462 7e-97
189234912446 PREDICTED: similar to AGAP004942-PA [Tri 0.391 0.802 0.571 2e-96
350405177466 PREDICTED: poly(rC)-binding protein 3-li 0.396 0.776 0.556 6e-95
357621941431 hypothetical protein KGM_22691 [Danaus p 0.403 0.856 0.494 7e-95
340726176466 PREDICTED: poly(rC)-binding protein 3-li 0.396 0.776 0.553 7e-95
328778258466 PREDICTED: poly(rC)-binding protein 3-li 0.396 0.776 0.553 1e-94
307199010469 Poly(rC)-binding protein 3 [Harpegnathos 0.396 0.771 0.556 6e-94
345486914476 PREDICTED: poly(rC)-binding protein 3-li 0.409 0.785 0.565 1e-93
116007842539 mushroom-body expressed, isoform D [Dros 0.351 0.595 0.562 3e-89
>gi|383862493|ref|XP_003706718.1| PREDICTED: poly(rC)-binding protein 4-like isoform 1 [Megachile rotundata] Back     alignment and taxonomy information
 Score =  364 bits (934), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 236/416 (56%), Positives = 283/416 (68%), Gaps = 51/416 (12%)

Query: 1   MQGKEVGSIIGKSGETVKKLREESGSKIYISDSSTPERIVTVIGSMDSLFRAFSLITKNI 60
           MQGKEVGSIIGK GE VK+ REESG+KI ISD S PERIVTV G  +S+F+AF+LI K  
Sbjct: 24  MQGKEVGSIIGKKGEIVKRFREESGAKINISDGSCPERIVTVTGPTNSIFKAFTLICKKF 83

Query: 61  EE----FHKNQNKHLGGNGESQLIQLRLIVPASQCGSIIGKGGSQIKTIRETSGASVYVA 116
           EE    FH  Q+   GG      I LRLIVPASQCGS+IGKGGS+IK IRE +GAS+ VA
Sbjct: 84  EEWCSQFHDIQS---GGGVPRPPITLRLIVPASQCGSLIGKGGSKIKEIREVTGASIQVA 140

Query: 117 SDMLPNSTEREVNIKGVPDAVTQAIYQICLIMVDSPPKGATIPYRPLPQNAGGPGLI--G 174
           S+MLPNSTER V I G  +A+TQ IY IC +M++SPPKGATIPYRP PQ  GGP ++  G
Sbjct: 141 SEMLPNSTERAVTISGTSEAITQCIYHICCVMLESPPKGATIPYRPKPQ-VGGPLILAGG 199

Query: 175 NQFGMQ-------NSLMGAPDMGNNPLAGLAALGLGGNSGGGMGGGLNAAALAALASSQL 227
             + +Q       +S MG   +G+NPLAGLAALGLGG +     GGLN AALAALA SQL
Sbjct: 200 QAYTIQGNYAVPAHSDMG--KLGSNPLAGLAALGLGGLATPANTGGLNPAALAALAGSQL 257

Query: 228 KTNHMPRNQNQNQNQHNRNNRDGPSQKTNQQQNQITKEMTVPNELIGAVIGKGGTKIFEI 287
           +T+      N N+ Q   NN+              T EMTVPNELIG +IGKGGTKI EI
Sbjct: 258 RTS------NTNRQQPAANNQ--------------THEMTVPNELIGCIIGKGGTKIAEI 297

Query: 288 RKISGAMIRISKSSEEEEDSNDRTITMTGTPDAIALAQYLINMSVELLRANLNGEGGGES 347
           R+ISGAMIRIS   E E  + DRTIT+TG PDA+ALAQYLI+MSVEL +ANL      E+
Sbjct: 298 RQISGAMIRISNCEEREGGATDRTITITGNPDAVALAQYLISMSVELQKANL------EA 351

Query: 348 NMDDFSSDNNLP-----SSAPLAGLNASNPLAAALPQLAQILTKPGALNALTSLSA 398
                      P     S++P      ++PLA+A+P LAQ+L+KPGALNAL+SL+A
Sbjct: 352 QNTQTPGSGTTPGATGASASPSNTTTTASPLASAIP-LAQLLSKPGALNALSSLTA 406

Source: Megachile rotundata

Species: Megachile rotundata

Genus: Megachile

Family: Megachilidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|328720738|ref|XP_001949210.2| PREDICTED: poly(rC)-binding protein 3-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|189234912|ref|XP_969611.2| PREDICTED: similar to AGAP004942-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|350405177|ref|XP_003487350.1| PREDICTED: poly(rC)-binding protein 3-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|357621941|gb|EHJ73587.1| hypothetical protein KGM_22691 [Danaus plexippus] Back     alignment and taxonomy information
>gi|340726176|ref|XP_003401437.1| PREDICTED: poly(rC)-binding protein 3-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|328778258|ref|XP_391921.3| PREDICTED: poly(rC)-binding protein 3-like [Apis mellifera] Back     alignment and taxonomy information
>gi|307199010|gb|EFN79734.1| Poly(rC)-binding protein 3 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|345486914|ref|XP_001607400.2| PREDICTED: poly(rC)-binding protein 3-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|116007842|ref|NP_001036619.1| mushroom-body expressed, isoform D [Drosophila melanogaster] gi|113194920|gb|ABI31266.1| mushroom-body expressed, isoform D [Drosophila melanogaster] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query914
FB|FBgn0262737557 mub "mushroom-body expressed" 0.188 0.308 0.564 1.4e-70
UNIPROTKB|E2RCH9370 PCBP3 "Uncharacterized protein 0.182 0.451 0.535 4.2e-59
UNIPROTKB|P57721371 PCBP3 "Poly(rC)-binding protei 0.182 0.450 0.535 3.3e-59
UNIPROTKB|E2QUE1371 PCBP3 "Uncharacterized protein 0.182 0.450 0.535 3.3e-59
MGI|MGI:1890470371 Pcbp3 "poly(rC) binding protei 0.182 0.450 0.535 3.3e-59
UNIPROTKB|D4A1P3371 Pcbp3 "Protein Pcbp3" [Rattus 0.182 0.450 0.535 3.3e-59
UNIPROTKB|F1NPL4326 PCBP3 "Uncharacterized protein 0.185 0.521 0.543 1.8e-58
UNIPROTKB|Q17QV0361 PCBP3 "Uncharacterized protein 0.182 0.462 0.535 3.3e-59
UNIPROTKB|E9PFP8361 PCBP3 "Poly(rC)-binding protei 0.182 0.462 0.535 3.3e-59
RGD|1307430319 Pcbp3 "poly(rC) binding protei 0.182 0.523 0.535 4.2e-59
FB|FBgn0262737 mub "mushroom-body expressed" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 483 (175.1 bits), Expect = 1.4e-70, Sum P(2) = 1.4e-70
 Identities = 101/179 (56%), Positives = 127/179 (70%)

Query:   442 MRHIMQGKEVGSIIGKSGETVKKLREESGSKIYISDSSTPERIVTVIGSMDSLFRAFSLI 501
             +R IMQGKEVGSIIGK GE V + REESG+KI ISD S PERIVTV G+ +++F AF+LI
Sbjct:    26 IRLIMQGKEVGSIIGKKGEIVNRFREESGAKINISDGSCPERIVTVSGTTNAIFSAFTLI 85

Query:   502 TKNIEEFHKNQNKHLGGNGESQLIQLRLIVPASQCXXXXXXXXXXXXXXRETSGASVYVA 561
             TK  EEF+      +G  G++Q I +RLIVPASQC              R+T+G S+ VA
Sbjct:    86 TKKFEEFND-----VGKVGKTQ-IPIRLIVPASQCGSLIGKSGSKIKEIRQTTGCSIQVA 139

Query:   562 SDMLPNSTEREVNIKGVPDAVTQAIYQICLIMVDSPPKGATIPYRPLPQNAGGPGLIGN 620
             S+MLPNSTER V + G  + +TQ IYQICL+M++SPP+GATIPYRP PQ   GP ++ N
Sbjct:   140 SEMLPNSTERAVTLSGSAEQITQCIYQICLVMLESPPRGATIPYRPKPQ-VTGPVILAN 197
GO:0017130 "poly(C) RNA binding" evidence=ISS
GO:0005634 "nucleus" evidence=IC
GO:0000381 "regulation of alternative mRNA splicing, via spliceosome" evidence=IMP
UNIPROTKB|E2RCH9 PCBP3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P57721 PCBP3 "Poly(rC)-binding protein 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2QUE1 PCBP3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1890470 Pcbp3 "poly(rC) binding protein 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|D4A1P3 Pcbp3 "Protein Pcbp3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1NPL4 PCBP3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q17QV0 PCBP3 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E9PFP8 PCBP3 "Poly(rC)-binding protein 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1307430 Pcbp3 "poly(rC) binding protein 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query914
cd0239665 cd02396, PCBP_like_KH, K homology RNA-binding doma 8e-22
cd0239665 cd02396, PCBP_like_KH, K homology RNA-binding doma 8e-22
cd0239665 cd02396, PCBP_like_KH, K homology RNA-binding doma 1e-15
cd0010564 cd00105, KH-I, K homology RNA-binding domain, type 3e-15
cd0010564 cd00105, KH-I, K homology RNA-binding domain, type 3e-15
cd0239665 cd02396, PCBP_like_KH, K homology RNA-binding doma 6e-15
cd0010564 cd00105, KH-I, K homology RNA-binding domain, type 2e-13
cd0010564 cd00105, KH-I, K homology RNA-binding domain, type 2e-13
pfam0001359 pfam00013, KH_1, KH domain 2e-13
pfam0001359 pfam00013, KH_1, KH domain 2e-13
smart0032268 smart00322, KH, K homology RNA-binding domain 4e-13
smart0032268 smart00322, KH, K homology RNA-binding domain 4e-13
cd0239665 cd02396, PCBP_like_KH, K homology RNA-binding doma 8e-13
cd0239665 cd02396, PCBP_like_KH, K homology RNA-binding doma 8e-13
cd0010564 cd00105, KH-I, K homology RNA-binding domain, type 4e-12
cd0010564 cd00105, KH-I, K homology RNA-binding domain, type 4e-12
smart0032268 smart00322, KH, K homology RNA-binding domain 3e-11
smart0032268 smart00322, KH, K homology RNA-binding domain 3e-11
pfam0001359 pfam00013, KH_1, KH domain 4e-11
pfam0001359 pfam00013, KH_1, KH domain 4e-11
smart0032268 smart00322, KH, K homology RNA-binding domain 8e-11
smart0032268 smart00322, KH, K homology RNA-binding domain 8e-11
pfam0001359 pfam00013, KH_1, KH domain 7e-09
pfam0001359 pfam00013, KH_1, KH domain 7e-09
pfam1301442 pfam13014, KH_3, KH domain 2e-07
pfam1301442 pfam13014, KH_3, KH domain 2e-07
pfam1301442 pfam13014, KH_3, KH domain 2e-07
pfam1301442 pfam13014, KH_3, KH domain 2e-07
cd0239462 cd02394, vigilin_like_KH, K homology RNA-binding d 5e-07
cd0239462 cd02394, vigilin_like_KH, K homology RNA-binding d 5e-07
pfam1301442 pfam13014, KH_3, KH domain 1e-06
pfam1301442 pfam13014, KH_3, KH domain 1e-06
cd0239462 cd02394, vigilin_like_KH, K homology RNA-binding d 5e-06
cd0239462 cd02394, vigilin_like_KH, K homology RNA-binding d 5e-06
cd0239462 cd02394, vigilin_like_KH, K homology RNA-binding d 7e-05
cd0239462 cd02394, vigilin_like_KH, K homology RNA-binding d 7e-05
PRK13763180 PRK13763, PRK13763, putative RNA-processing protei 8e-05
PRK13763180 PRK13763, PRK13763, putative RNA-processing protei 8e-05
TIGR03665172 TIGR03665, arCOG04150, arCOG04150 universal archae 3e-04
TIGR03665172 TIGR03665, arCOG04150, arCOG04150 universal archae 3e-04
PRK13764602 PRK13764, PRK13764, ATPase; Provisional 0.001
PRK13764602 PRK13764, PRK13764, ATPase; Provisional 0.001
PRK08406140 PRK08406, PRK08406, transcription elongation facto 0.001
PRK08406140 PRK08406, PRK08406, transcription elongation facto 0.001
cd0239361 cd02393, PNPase_KH, Polynucleotide phosphorylase ( 0.001
cd0239361 cd02393, PNPase_KH, Polynucleotide phosphorylase ( 0.001
COG1094194 COG1094, COG1094, Predicted RNA-binding protein (c 0.002
COG1094194 COG1094, COG1094, Predicted RNA-binding protein (c 0.002
COG1855604 COG1855, COG1855, ATPase (PilT family) [General fu 0.002
COG1855604 COG1855, COG1855, ATPase (PilT family) [General fu 0.002
COG0195190 COG0195, NusA, Transcription elongation factor [Tr 0.003
COG0195190 COG0195, NusA, Transcription elongation factor [Tr 0.003
>gnl|CDD|239089 cd02396, PCBP_like_KH, K homology RNA-binding domain, PCBP_like Back     alignment and domain information 
 Score = 89.5 bits (223), Expect = 8e-22
 Identities = 38/65 (58%), Positives = 46/65 (70%)

Query: 81  QLRLIVPASQCGSIIGKGGSQIKTIRETSGASVYVASDMLPNSTEREVNIKGVPDAVTQA 140
            LRL+VP+SQ GSIIGKGGS IK IRE +GA + V+  +LP STER V I G P AV +A
Sbjct: 1   TLRLLVPSSQAGSIIGKGGSTIKEIREETGAKIRVSKSVLPGSTERVVTISGKPSAVQKA 60

Query: 141 IYQIC 145
           +  I 
Sbjct: 61  LLLIL 65

Members of this group possess KH domains in a tandem arrangement. Most members, similar to the poly(C) binding proteins (PCBPs) and Nova, containing three KH domains, with the first and second domains, which are represented here, in tandem arrangement, followed by a large spacer region, with the third domain near the C-terminal end of the protein. The poly(C) binding proteins (PCBPs) can be divided into two groups, hnRNPs K/J and the alphaCPs, which share a triple KH domain configuration and poly(C) binding specificity. They play roles in mRNA stabilization, translational activation, and translational silencing. Nova-1 and Nova-2 are nuclear RNA-binding proteins that regulate splicing. This group also contains plant proteins that seem to have two tandem repeat arrrangements, like Hen4, a protein that plays a role in AGAMOUS (AG) pre-mRNA processing and important step in plant development. In general, KH binds single-stranded RNA or DNA. It is found in a wide variety of proteins including ribosomal proteins, transcription factors and post-transcriptional modifiers of mRNA. Length = 65
>gnl|CDD|239089 cd02396, PCBP_like_KH, K homology RNA-binding domain, PCBP_like Back     alignment and domain information
>gnl|CDD|239089 cd02396, PCBP_like_KH, K homology RNA-binding domain, PCBP_like Back     alignment and domain information
>gnl|CDD|238053 cd00105, KH-I, K homology RNA-binding domain, type I Back     alignment and domain information
>gnl|CDD|238053 cd00105, KH-I, K homology RNA-binding domain, type I Back     alignment and domain information
>gnl|CDD|239089 cd02396, PCBP_like_KH, K homology RNA-binding domain, PCBP_like Back     alignment and domain information
>gnl|CDD|238053 cd00105, KH-I, K homology RNA-binding domain, type I Back     alignment and domain information
>gnl|CDD|238053 cd00105, KH-I, K homology RNA-binding domain, type I Back     alignment and domain information
>gnl|CDD|215657 pfam00013, KH_1, KH domain Back     alignment and domain information
>gnl|CDD|215657 pfam00013, KH_1, KH domain Back     alignment and domain information
>gnl|CDD|197652 smart00322, KH, K homology RNA-binding domain Back     alignment and domain information
>gnl|CDD|197652 smart00322, KH, K homology RNA-binding domain Back     alignment and domain information
>gnl|CDD|239089 cd02396, PCBP_like_KH, K homology RNA-binding domain, PCBP_like Back     alignment and domain information
>gnl|CDD|239089 cd02396, PCBP_like_KH, K homology RNA-binding domain, PCBP_like Back     alignment and domain information
>gnl|CDD|238053 cd00105, KH-I, K homology RNA-binding domain, type I Back     alignment and domain information
>gnl|CDD|238053 cd00105, KH-I, K homology RNA-binding domain, type I Back     alignment and domain information
>gnl|CDD|197652 smart00322, KH, K homology RNA-binding domain Back     alignment and domain information
>gnl|CDD|197652 smart00322, KH, K homology RNA-binding domain Back     alignment and domain information
>gnl|CDD|215657 pfam00013, KH_1, KH domain Back     alignment and domain information
>gnl|CDD|215657 pfam00013, KH_1, KH domain Back     alignment and domain information
>gnl|CDD|197652 smart00322, KH, K homology RNA-binding domain Back     alignment and domain information
>gnl|CDD|197652 smart00322, KH, K homology RNA-binding domain Back     alignment and domain information
>gnl|CDD|215657 pfam00013, KH_1, KH domain Back     alignment and domain information
>gnl|CDD|215657 pfam00013, KH_1, KH domain Back     alignment and domain information
>gnl|CDD|221895 pfam13014, KH_3, KH domain Back     alignment and domain information
>gnl|CDD|221895 pfam13014, KH_3, KH domain Back     alignment and domain information
>gnl|CDD|221895 pfam13014, KH_3, KH domain Back     alignment and domain information
>gnl|CDD|221895 pfam13014, KH_3, KH domain Back     alignment and domain information
>gnl|CDD|239087 cd02394, vigilin_like_KH, K homology RNA-binding domain_vigilin_like Back     alignment and domain information
>gnl|CDD|239087 cd02394, vigilin_like_KH, K homology RNA-binding domain_vigilin_like Back     alignment and domain information
>gnl|CDD|221895 pfam13014, KH_3, KH domain Back     alignment and domain information
>gnl|CDD|221895 pfam13014, KH_3, KH domain Back     alignment and domain information
>gnl|CDD|239087 cd02394, vigilin_like_KH, K homology RNA-binding domain_vigilin_like Back     alignment and domain information
>gnl|CDD|239087 cd02394, vigilin_like_KH, K homology RNA-binding domain_vigilin_like Back     alignment and domain information
>gnl|CDD|239087 cd02394, vigilin_like_KH, K homology RNA-binding domain_vigilin_like Back     alignment and domain information
>gnl|CDD|239087 cd02394, vigilin_like_KH, K homology RNA-binding domain_vigilin_like Back     alignment and domain information
>gnl|CDD|237494 PRK13763, PRK13763, putative RNA-processing protein; Provisional Back     alignment and domain information
>gnl|CDD|237494 PRK13763, PRK13763, putative RNA-processing protein; Provisional Back     alignment and domain information
>gnl|CDD|211858 TIGR03665, arCOG04150, arCOG04150 universal archaeal KH domain protein Back     alignment and domain information
>gnl|CDD|211858 TIGR03665, arCOG04150, arCOG04150 universal archaeal KH domain protein Back     alignment and domain information
>gnl|CDD|184311 PRK13764, PRK13764, ATPase; Provisional Back     alignment and domain information
>gnl|CDD|184311 PRK13764, PRK13764, ATPase; Provisional Back     alignment and domain information
>gnl|CDD|181413 PRK08406, PRK08406, transcription elongation factor NusA-like protein; Validated Back     alignment and domain information
>gnl|CDD|181413 PRK08406, PRK08406, transcription elongation factor NusA-like protein; Validated Back     alignment and domain information
>gnl|CDD|239086 cd02393, PNPase_KH, Polynucleotide phosphorylase (PNPase) K homology RNA-binding domain (KH) Back     alignment and domain information
>gnl|CDD|239086 cd02393, PNPase_KH, Polynucleotide phosphorylase (PNPase) K homology RNA-binding domain (KH) Back     alignment and domain information
>gnl|CDD|224019 COG1094, COG1094, Predicted RNA-binding protein (contains KH domains) [General function prediction only] Back     alignment and domain information
>gnl|CDD|224019 COG1094, COG1094, Predicted RNA-binding protein (contains KH domains) [General function prediction only] Back     alignment and domain information
>gnl|CDD|224768 COG1855, COG1855, ATPase (PilT family) [General function prediction only] Back     alignment and domain information
>gnl|CDD|224768 COG1855, COG1855, ATPase (PilT family) [General function prediction only] Back     alignment and domain information
>gnl|CDD|223273 COG0195, NusA, Transcription elongation factor [Transcription] Back     alignment and domain information
>gnl|CDD|223273 COG0195, NusA, Transcription elongation factor [Transcription] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 914
KOG1676|consensus600 100.0
KOG1676|consensus600 100.0
KOG2193|consensus584 100.0
KOG2192|consensus390 100.0
KOG2193|consensus584 100.0
KOG2192|consensus390 100.0
KOG2190|consensus485 100.0
KOG2190|consensus485 99.98
KOG2191|consensus402 99.92
KOG2191|consensus402 99.89
KOG2208|consensus753 99.79
KOG2208|consensus753 99.64
TIGR03665172 arCOG04150 arCOG04150 universal archaeal KH domain 99.52
TIGR03665172 arCOG04150 arCOG04150 universal archaeal KH domain 99.51
PRK13763180 putative RNA-processing protein; Provisional 99.48
PRK13763180 putative RNA-processing protein; Provisional 99.47
KOG2279|consensus 608 99.24
cd0239665 PCBP_like_KH K homology RNA-binding domain, PCBP_l 99.22
cd0239665 PCBP_like_KH K homology RNA-binding domain, PCBP_l 99.18
cd0239462 vigilin_like_KH K homology RNA-binding domain_vigi 99.14
KOG2279|consensus608 99.11
PF0001360 KH_1: KH domain syndrome, contains KH motifs.; Int 99.08
cd0239361 PNPase_KH Polynucleotide phosphorylase (PNPase) K 99.08
cd0010564 KH-I K homology RNA-binding domain, type I. KH bin 99.01
cd0239462 vigilin_like_KH K homology RNA-binding domain_vigi 98.95
PF0001360 KH_1: KH domain syndrome, contains KH motifs.; Int 98.93
cd0010564 KH-I K homology RNA-binding domain, type I. KH bin 98.82
cd0239361 PNPase_KH Polynucleotide phosphorylase (PNPase) K 98.82
PF1301443 KH_3: KH domain 98.71
PF1301443 KH_3: KH domain 98.69
smart0032269 KH K homology RNA-binding domain. 98.65
COG1094194 Predicted RNA-binding protein (contains KH domains 98.55
COG1094194 Predicted RNA-binding protein (contains KH domains 98.5
smart0032269 KH K homology RNA-binding domain. 98.48
KOG2113|consensus394 98.37
KOG2113|consensus394 98.11
cd02395120 SF1_like-KH Splicing factor 1 (SF1) K homology RNA 98.05
cd02395120 SF1_like-KH Splicing factor 1 (SF1) K homology RNA 97.88
PRK08406140 transcription elongation factor NusA-like protein; 97.42
PRK08406140 transcription elongation factor NusA-like protein; 97.29
TIGR02696719 pppGpp_PNP guanosine pentaphosphate synthetase I/p 97.28
TIGR02696719 pppGpp_PNP guanosine pentaphosphate synthetase I/p 97.19
KOG0119|consensus554 96.99
KOG0336|consensus 629 96.98
KOG0119|consensus554 96.96
TIGR03591684 polynuc_phos polyribonucleotide nucleotidyltransfe 96.85
KOG0336|consensus 629 96.8
TIGR03591684 polynuc_phos polyribonucleotide nucleotidyltransfe 96.73
TIGR01952141 nusA_arch NusA family KH domain protein, archaeal. 96.37
PLN00207891 polyribonucleotide nucleotidyltransferase; Provisi 96.34
TIGR01952141 nusA_arch NusA family KH domain protein, archaeal. 96.32
PLN00207891 polyribonucleotide nucleotidyltransferase; Provisi 96.24
KOG2814|consensus345 96.15
COG0195190 NusA Transcription elongation factor [Transcriptio 96.13
COG1185692 Pnp Polyribonucleotide nucleotidyltransferase (pol 96.12
KOG1588|consensus259 96.02
KOG4369|consensus 2131 96.02
KOG1588|consensus259 95.97
COG1185692 Pnp Polyribonucleotide nucleotidyltransferase (pol 95.89
KOG2814|consensus345 95.57
PRK00106 535 hypothetical protein; Provisional 95.34
TIGR03319 514 YmdA_YtgF conserved hypothetical protein YmdA/YtgF 95.34
PF14611210 SLS: Mitochondrial inner-membrane-bound regulator 95.27
PRK12704 520 phosphodiesterase; Provisional 95.18
COG0195190 NusA Transcription elongation factor [Transcriptio 95.18
PRK04163235 exosome complex RNA-binding protein Rrp4; Provisio 95.16
PF14611210 SLS: Mitochondrial inner-membrane-bound regulator 95.03
cd0213461 NusA_KH NusA_K homology RNA-binding domain (KH). N 94.96
TIGR03319514 YmdA_YtgF conserved hypothetical protein YmdA/YtgF 94.93
PRK00106535 hypothetical protein; Provisional 94.86
PRK11824693 polynucleotide phosphorylase/polyadenylase; Provis 94.76
PRK11824693 polynucleotide phosphorylase/polyadenylase; Provis 94.69
PRK12704520 phosphodiesterase; Provisional 94.47
COG5176269 MSL5 Splicing factor (branch point binding protein 94.46
cd0213461 NusA_KH NusA_K homology RNA-binding domain (KH). N 94.41
PRK04163235 exosome complex RNA-binding protein Rrp4; Provisio 94.04
TIGR01953341 NusA transcription termination factor NusA. This m 93.71
PRK12328374 nusA transcription elongation factor NusA; Provisi 93.49
KOG4369|consensus 2131 93.44
PRK12327362 nusA transcription elongation factor NusA; Provisi 93.27
TIGR01953341 NusA transcription termination factor NusA. This m 93.15
PRK12328374 nusA transcription elongation factor NusA; Provisi 93.1
PRK12327362 nusA transcription elongation factor NusA; Provisi 92.61
PRK12329449 nusA transcription elongation factor NusA; Provisi 92.58
COG5176269 MSL5 Splicing factor (branch point binding protein 92.53
KOG1067|consensus760 92.52
PRK12329449 nusA transcription elongation factor NusA; Provisi 92.01
PRK09202470 nusA transcription elongation factor NusA; Validat 91.83
PRK0046875 hypothetical protein; Provisional 91.56
PRK12705 508 hypothetical protein; Provisional 91.49
COG183776 Predicted RNA-binding protein (contains KH domain) 91.04
COG5166657 Uncharacterized conserved protein [Function unknow 91.01
PRK12705508 hypothetical protein; Provisional 90.92
KOG1067|consensus760 90.91
PRK0282177 hypothetical protein; Provisional 90.59
PRK09202470 nusA transcription elongation factor NusA; Validat 90.5
PRK0046875 hypothetical protein; Provisional 90.5
PRK0282177 hypothetical protein; Provisional 89.98
COG183776 Predicted RNA-binding protein (contains KH domain) 89.02
KOG3273|consensus252 88.7
PRK0106478 hypothetical protein; Provisional 88.18
PRK0106478 hypothetical protein; Provisional 87.6
cd02410145 archeal_CPSF_KH The archaeal cleavage and polyaden 86.72
KOG3273|consensus252 85.47
cd02410145 archeal_CPSF_KH The archaeal cleavage and polyaden 82.39
PF1318469 KH_5: NusA-like KH domain; PDB: 1HH2_P 1L2F_A 2ATW 81.96
COG5166657 Uncharacterized conserved protein [Function unknow 81.63
>KOG1676|consensus Back     alignment and domain information 
Probab=100.00  E-value=5.3e-42  Score=381.49  Aligned_cols=338  Identities=30%  Similarity=0.459  Sum_probs=274.2

Q ss_pred             cceEEEEEecccccccccccCcchHHHHHhhhCCEEEEcCCCCCCCCCCceEEEEEcCHHHHHHHHHHHHHHHHHHHhcc
Q psy13906        260 NQITKEMTVPNELIGAVIGKGGTKIFEIRKISGAMIRISKSSEEEEDSNDRTITMTGTPDAIALAQYLINMSVELLRANL  339 (914)
Q Consensus       260 ~~~~~~i~Ip~~~vg~IIGk~G~~I~~I~~~tga~I~i~~~~~~~~~~~~~~i~I~G~~e~v~~A~~~I~~~ve~~~~~~  339 (914)
                      +.++.+..||+..+++||||+|+.|..|.++|||+|+|...   .....+|.+.|.|.+++|+.|+.||.+++...+   
T Consensus        52 ~~~~~~~~VPd~~VglvIGrgG~qI~~iqq~SgCrvq~~~~---~s~~~~r~~~~~G~pe~v~~aK~li~evv~r~~---  125 (600)
T KOG1676|consen   52 TVQTERYKVPDEAVGLVIGRGGSQIQAIQQKSGCRVQIAAD---PSGIGYRSVDLTGSPENVEVAKQLIGEVVSRGR---  125 (600)
T ss_pred             cccccccCCCchhceeEeeccHHHhhhhhhhcCCccccCCC---CCCcccccccccCCcccHHHHHHhhhhhhhccC---
Confidence            34578889999999999999999999999999999998754   335578999999999999999999998885321   


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCcccCCCCCCchhhhhhhhHHhhcCCCCcCccccccccCCCcCCCCCCCCCCCCCCCC
Q psy13906        340 NGEGGGESNMDDFSSDNNLPSSAPLAGLNASNPLAAALPQLAQILTKPGALNALTSLSALGGLSDLLGGGSSGGGSGNSG  419 (914)
Q Consensus       340 ~~~~~~~~~~~~~~~~~~~p~~~p~~~~~~~~~~~~~~p~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  419 (914)
                                        +|..+|.                                                       
T Consensus       126 ------------------~~~~~~~-------------------------------------------------------  132 (600)
T KOG1676|consen  126 ------------------PPGGFPD-------------------------------------------------------  132 (600)
T ss_pred             ------------------CCCCccc-------------------------------------------------------
Confidence                              1111111                                                       


Q ss_pred             CCCCCCCCCCCCccccccccceeecccCcceEeEEEeCCchhHHHHHHHhCCeEEeeCCC----CCeeEEEEEcChhHHH
Q psy13906        420 GFGGVPQGPNYANIQTTGVQRRMRHIMQGKEVGSIIGKSGETVKKLREESGSKIYISDSS----TPERIVTVIGSMDSLF  495 (914)
Q Consensus       420 ~~~~~~~~~~~~~~~~~~~~~~~ri~vp~~~vg~IIGk~G~~Ik~I~~etga~I~i~~~~----~~ervv~I~G~~e~V~  495 (914)
                                +    ...+..+..|+||...+|+||||+|++||+|++.+||++.+..++    +..+.+.|+|+++.|+
T Consensus       133 ----------~----q~~~~ttqeI~IPa~k~GlIIGKgGETikqlqe~sg~k~i~iqd~~~~~~~~KplritGdp~~ve  198 (600)
T KOG1676|consen  133 ----------N----QGSVETTQEILIPANKCGLIIGKGGETIKQLQEQSGVKMILVQDGSIATGADKPLRITGDPDKVE  198 (600)
T ss_pred             ----------c----CCccceeeeeccCccceeeEeccCccHHHHHHhhcCCceEEEecCCcCCCCCCceeecCCHHHHH
Confidence                      0    013567889999999999999999999999999999998887653    3667899999999999


Q ss_pred             HHHHHHHHHHHHhhhccccc--CCCCCCCcceEEEEEecCCccceeeccCCchHHHHHhhcCceEEEccCCCCCCCcceE
Q psy13906        496 RAFSLITKNIEEFHKNQNKH--LGGNGESQLIQLRLIVPASQCGSIIGKGGSQIKTIRETSGASVYVASDMLPNSTEREV  573 (914)
Q Consensus       496 ~A~~~I~~~i~~~~~~~~~~--~~~~~~~~~~~~~l~VP~~~~G~IIGkgG~~IkeI~~~tga~I~v~~~~~p~~~er~V  573 (914)
                      .|+.++.++|.+..+.....  ..+.+.-...+.+|.||++.||.||||+|++||.|+.+||++|+|.+|..|.+.||++
T Consensus       199 ~a~~lV~dil~e~~~~~~g~~~~~g~~~g~~~~~~V~VPr~~VG~IIGkgGE~IKklq~etG~KIQfkpDd~p~speR~~  278 (600)
T KOG1676|consen  199 QAKQLVADILREEDDEVPGSGGHAGVRGGGSATREVKVPRSKVGIIIGKGGEMIKKLQNETGAKIQFKPDDDPSSPERPA  278 (600)
T ss_pred             HHHHHHHHHHHhcccCCCccccccCcCccccceeEEeccccceeeEEecCchHHHHHhhccCceeEeecCCCCCCcccee
Confidence            99999999999743321111  1111223345899999999999999999999999999999999999998899999999


Q ss_pred             EEecCHHHHHHHHHHHHHHhccCCCCCCCCCCCCCCCCCCCCcccCCcccccCcCCCCCCCCCCccchhcccCCCCCCCC
Q psy13906        574 NIKGVPDAVTQAIYQICLIMVDSPPKGATIPYRPLPQNAGGPGLIGNQFGMQNSLMGAPDMGNNPLAGLAALGLGGNSGG  653 (914)
Q Consensus       574 ~I~G~~e~V~~A~~~I~~~l~e~~~~~~~~py~P~~~~~~~~~~~g~~~~~q~s~~~~~~~~~~p~~~~~~~~~~g~~~~  653 (914)
                      .|.|+.++|+.|.++|.++|++.....      +                                             .
T Consensus       279 ~IiG~~d~ie~Aa~lI~eii~~~~~~~------~---------------------------------------------~  307 (600)
T KOG1676|consen  279 QIIGTVDQIEHAAELINEIIAEAEAGA------G---------------------------------------------G  307 (600)
T ss_pred             eeecCHHHHHHHHHHHHHHHHHHhccC------C---------------------------------------------C
Confidence            999999999999999999998852100      0                                             0


Q ss_pred             CCCCCCChHHHHHhhhcccccCCCCCCCccccccCCCCCCCCCCccccccCCceEEEEEecCccccccccCCcchHHHHH
Q psy13906        654 GMGGGLNAAALAALASSQLKTNHMPRNQNQNQNQHNRNNRDGPSQKTNQQQNQITKEMTVPNELIGAVIGKGGTKIFEIR  733 (914)
Q Consensus       654 ~~~~g~~~~~~~~~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~vp~~~~g~iIG~~G~~I~~I~  733 (914)
                      .+.+|.                                           .......++.||.+.||.||||+|++|+.|.
T Consensus       308 ~~~~G~-------------------------------------------P~~~~~fy~~VPa~KcGLvIGrGGEtIK~in  344 (600)
T KOG1676|consen  308 GMGGGA-------------------------------------------PGLVAQFYMKVPADKCGLVIGRGGETIKQIN  344 (600)
T ss_pred             CcCCCC-------------------------------------------ccceeeEEEeccccccccccCCCccchhhhc
Confidence            000000                                           0112267899999999999999999999999


Q ss_pred             hhhCCEEEEcCCCCCCCCCCceEEEEEcCHHHHHHHHHHHHHHHHHHHhccc
Q psy13906        734 KISGAMIRISKSSEEEEDSNDRTITMTGTPDAIALAQYLINMSVELLRANLN  785 (914)
Q Consensus       734 ~~sga~I~i~~~~~~~~~~~~r~i~I~G~~~~v~~A~~li~~~i~~~~~~~~  785 (914)
                      ++|||++.+.+. .+..+..+++|+|+|++.+|+.|+.||+.+|...-.+..
T Consensus       345 ~qSGA~~el~r~-~p~~~~~ektf~IrG~~~QIdhAk~LIr~kvg~~~~n~~  395 (600)
T KOG1676|consen  345 QQSGARCELSRQ-PPNGNPKEKTFVIRGDKRQIDHAKQLIRDKVGDIAPNTP  395 (600)
T ss_pred             ccCCccccccCC-CCCCCccceEEEEecCcccchHHHHHHHHHhcccCCCCC
Confidence            999999999987 345567889999999999999999999999976544433

>KOG1676|consensus Back     alignment and domain information
>KOG2193|consensus Back     alignment and domain information
>KOG2192|consensus Back     alignment and domain information
>KOG2193|consensus Back     alignment and domain information
>KOG2192|consensus Back     alignment and domain information
>KOG2190|consensus Back     alignment and domain information
>KOG2190|consensus Back     alignment and domain information
>KOG2191|consensus Back     alignment and domain information
>KOG2191|consensus Back     alignment and domain information
>KOG2208|consensus Back     alignment and domain information
>KOG2208|consensus Back     alignment and domain information
>TIGR03665 arCOG04150 arCOG04150 universal archaeal KH domain protein Back     alignment and domain information
>TIGR03665 arCOG04150 arCOG04150 universal archaeal KH domain protein Back     alignment and domain information
>PRK13763 putative RNA-processing protein; Provisional Back     alignment and domain information
>PRK13763 putative RNA-processing protein; Provisional Back     alignment and domain information
>KOG2279|consensus Back     alignment and domain information
>cd02396 PCBP_like_KH K homology RNA-binding domain, PCBP_like Back     alignment and domain information
>cd02396 PCBP_like_KH K homology RNA-binding domain, PCBP_like Back     alignment and domain information
>cd02394 vigilin_like_KH K homology RNA-binding domain_vigilin_like Back     alignment and domain information
>KOG2279|consensus Back     alignment and domain information
>PF00013 KH_1: KH domain syndrome, contains KH motifs Back     alignment and domain information
>cd02393 PNPase_KH Polynucleotide phosphorylase (PNPase) K homology RNA-binding domain (KH) Back     alignment and domain information
>cd00105 KH-I K homology RNA-binding domain, type I Back     alignment and domain information
>cd02394 vigilin_like_KH K homology RNA-binding domain_vigilin_like Back     alignment and domain information
>PF00013 KH_1: KH domain syndrome, contains KH motifs Back     alignment and domain information
>cd00105 KH-I K homology RNA-binding domain, type I Back     alignment and domain information
>cd02393 PNPase_KH Polynucleotide phosphorylase (PNPase) K homology RNA-binding domain (KH) Back     alignment and domain information
>PF13014 KH_3: KH domain Back     alignment and domain information
>PF13014 KH_3: KH domain Back     alignment and domain information
>smart00322 KH K homology RNA-binding domain Back     alignment and domain information
>COG1094 Predicted RNA-binding protein (contains KH domains) [General function prediction only] Back     alignment and domain information
>COG1094 Predicted RNA-binding protein (contains KH domains) [General function prediction only] Back     alignment and domain information
>smart00322 KH K homology RNA-binding domain Back     alignment and domain information
>KOG2113|consensus Back     alignment and domain information
>KOG2113|consensus Back     alignment and domain information
>cd02395 SF1_like-KH Splicing factor 1 (SF1) K homology RNA-binding domain (KH) Back     alignment and domain information
>cd02395 SF1_like-KH Splicing factor 1 (SF1) K homology RNA-binding domain (KH) Back     alignment and domain information
>PRK08406 transcription elongation factor NusA-like protein; Validated Back     alignment and domain information
>PRK08406 transcription elongation factor NusA-like protein; Validated Back     alignment and domain information
>TIGR02696 pppGpp_PNP guanosine pentaphosphate synthetase I/polynucleotide phosphorylase Back     alignment and domain information
>TIGR02696 pppGpp_PNP guanosine pentaphosphate synthetase I/polynucleotide phosphorylase Back     alignment and domain information
>KOG0119|consensus Back     alignment and domain information
>KOG0336|consensus Back     alignment and domain information
>KOG0119|consensus Back     alignment and domain information
>TIGR03591 polynuc_phos polyribonucleotide nucleotidyltransferase Back     alignment and domain information
>KOG0336|consensus Back     alignment and domain information
>TIGR03591 polynuc_phos polyribonucleotide nucleotidyltransferase Back     alignment and domain information
>TIGR01952 nusA_arch NusA family KH domain protein, archaeal Back     alignment and domain information
>PLN00207 polyribonucleotide nucleotidyltransferase; Provisional Back     alignment and domain information
>TIGR01952 nusA_arch NusA family KH domain protein, archaeal Back     alignment and domain information
>PLN00207 polyribonucleotide nucleotidyltransferase; Provisional Back     alignment and domain information
>KOG2814|consensus Back     alignment and domain information
>COG0195 NusA Transcription elongation factor [Transcription] Back     alignment and domain information
>COG1185 Pnp Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1588|consensus Back     alignment and domain information
>KOG4369|consensus Back     alignment and domain information
>KOG1588|consensus Back     alignment and domain information
>COG1185 Pnp Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2814|consensus Back     alignment and domain information
>PRK00106 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF Back     alignment and domain information
>PF14611 SLS: Mitochondrial inner-membrane-bound regulator Back     alignment and domain information
>PRK12704 phosphodiesterase; Provisional Back     alignment and domain information
>COG0195 NusA Transcription elongation factor [Transcription] Back     alignment and domain information
>PRK04163 exosome complex RNA-binding protein Rrp4; Provisional Back     alignment and domain information
>PF14611 SLS: Mitochondrial inner-membrane-bound regulator Back     alignment and domain information
>cd02134 NusA_KH NusA_K homology RNA-binding domain (KH) Back     alignment and domain information
>TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF Back     alignment and domain information
>PRK00106 hypothetical protein; Provisional Back     alignment and domain information
>PRK11824 polynucleotide phosphorylase/polyadenylase; Provisional Back     alignment and domain information
>PRK11824 polynucleotide phosphorylase/polyadenylase; Provisional Back     alignment and domain information
>PRK12704 phosphodiesterase; Provisional Back     alignment and domain information
>COG5176 MSL5 Splicing factor (branch point binding protein) [RNA processing and modification] Back     alignment and domain information
>cd02134 NusA_KH NusA_K homology RNA-binding domain (KH) Back     alignment and domain information
>PRK04163 exosome complex RNA-binding protein Rrp4; Provisional Back     alignment and domain information
>TIGR01953 NusA transcription termination factor NusA Back     alignment and domain information
>PRK12328 nusA transcription elongation factor NusA; Provisional Back     alignment and domain information
>KOG4369|consensus Back     alignment and domain information
>PRK12327 nusA transcription elongation factor NusA; Provisional Back     alignment and domain information
>TIGR01953 NusA transcription termination factor NusA Back     alignment and domain information
>PRK12328 nusA transcription elongation factor NusA; Provisional Back     alignment and domain information
>PRK12327 nusA transcription elongation factor NusA; Provisional Back     alignment and domain information
>PRK12329 nusA transcription elongation factor NusA; Provisional Back     alignment and domain information
>COG5176 MSL5 Splicing factor (branch point binding protein) [RNA processing and modification] Back     alignment and domain information
>KOG1067|consensus Back     alignment and domain information
>PRK12329 nusA transcription elongation factor NusA; Provisional Back     alignment and domain information
>PRK09202 nusA transcription elongation factor NusA; Validated Back     alignment and domain information
>PRK00468 hypothetical protein; Provisional Back     alignment and domain information
>PRK12705 hypothetical protein; Provisional Back     alignment and domain information
>COG1837 Predicted RNA-binding protein (contains KH domain) [General function prediction only] Back     alignment and domain information
>COG5166 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK12705 hypothetical protein; Provisional Back     alignment and domain information
>KOG1067|consensus Back     alignment and domain information
>PRK02821 hypothetical protein; Provisional Back     alignment and domain information
>PRK09202 nusA transcription elongation factor NusA; Validated Back     alignment and domain information
>PRK00468 hypothetical protein; Provisional Back     alignment and domain information
>PRK02821 hypothetical protein; Provisional Back     alignment and domain information
>COG1837 Predicted RNA-binding protein (contains KH domain) [General function prediction only] Back     alignment and domain information
>KOG3273|consensus Back     alignment and domain information
>PRK01064 hypothetical protein; Provisional Back     alignment and domain information
>PRK01064 hypothetical protein; Provisional Back     alignment and domain information
>cd02410 archeal_CPSF_KH The archaeal cleavage and polyadenylation specificity factor (CPSF) contains an N-terminal K homology RNA-binding domain (KH) Back     alignment and domain information
>KOG3273|consensus Back     alignment and domain information
>cd02410 archeal_CPSF_KH The archaeal cleavage and polyadenylation specificity factor (CPSF) contains an N-terminal K homology RNA-binding domain (KH) Back     alignment and domain information
>PF13184 KH_5: NusA-like KH domain; PDB: 1HH2_P 1L2F_A 2ATW_A 1K0R_B 2ASB_A Back     alignment and domain information
>COG5166 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query914
2jzx_A160 Pcbp2 Kh1-Kh2 Domains Length = 160 2e-33
3vke_A76 Contribution Of The First K-Homology Domain Of Poly 2e-15
1ztg_A74 Human Alpha Polyc Binding Protein Kh1 Length = 74 2e-15
2axy_A73 Crystal Structure Of Kh1 Domain Of Human Poly(C)-Bi 2e-13
2p2r_A76 Crystal Structure Of The Third Kh Domain Of Human P 9e-11
2p2r_A76 Crystal Structure Of The Third Kh Domain Of Human P 9e-11
1wvn_A82 Crsytal Structure Of Domain 3 Of Human Alpha Polyc 3e-09
1wvn_A82 Crsytal Structure Of Domain 3 Of Human Alpha Polyc 3e-09
1dtj_A76 Crystal Structure Of Nova-2 Kh3 K-Homology Rna-Bind 2e-08
1dtj_A76 Crystal Structure Of Nova-2 Kh3 K-Homology Rna-Bind 2e-08
1j5k_A89 Complex Of The Kh3 Domain Of Hnrnp K With A Single_ 3e-08
1j5k_A89 Complex Of The Kh3 Domain Of Hnrnp K With A Single_ 3e-08
1ec6_A87 Crystal Structure Of Nova-2 Kh3 K-Homology Rna-Bind 4e-08
1ec6_A87 Crystal Structure Of Nova-2 Kh3 K-Homology Rna-Bind 4e-08
1zzi_A82 Crystal Structure Analysis Of The Third Kh Domain O 5e-08
1zzi_A82 Crystal Structure Analysis Of The Third Kh Domain O 5e-08
1dt4_A73 Crystal Structure Of Nova-1 Kh3 K-Homology Rna-Bind 2e-07
1dt4_A73 Crystal Structure Of Nova-1 Kh3 K-Homology Rna-Bind 2e-07
1khm_A89 C-Terminal Kh Domain Of Hnrnp K (Kh3) Length = 89 3e-07
1khm_A89 C-Terminal Kh Domain Of Hnrnp K (Kh3) Length = 89 3e-07
2ann_A178 Crystal Structure (I) Of Nova-1 Kh1KH2 DOMAIN TANDE 2e-04
1x4n_A92 Solution Structure Of Kh Domain In Fuse Binding Pro 2e-04
1x4n_A92 Solution Structure Of Kh Domain In Fuse Binding Pro 2e-04
2anr_A178 Crystal Structure (Ii) Of Nova-1 Kh1KH2 DOMAIN TAND 3e-04
>pdb|2JZX|A Chain A, Pcbp2 Kh1-Kh2 Domains Length = 160 Back     alignment and structure 
Iteration: 1

 Score =  141 bits (355), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 69/155 (44%), Positives = 103/155 (66%), Gaps = 1/155 (0%)
Query: 442 MRHIMQGKEVGSIIGKSGETVKKLREESGSKIYISDSSTPERIVTVIGSMDSLFRAFSLI 501
           +R +M GKEVGSIIGK GE+VKK+REESG++I IS+ + PERI+T+ G  +++F+AF++I
Sbjct: 7   IRLLMHGKEVGSIIGKKGESVKKMREESGARINISEGNCPERIITLAGPTNAIFKAFAMI 66
Query: 502 TKNIEEFHKNQNKHLGGNGESQLIQLRLIVPASQCXXXXXXXXXXXXXXRETSGASVYVA 561
              +EE   +   +         + LRL+VPASQC              RE++GA V VA
Sbjct: 67  IDKLEEDISSSMTNSTAASRPP-VTLRLVVPASQCGSLIGKGGCKIKEIRESTGAQVQVA 125
Query: 562 SDMLPNSTEREVNIKGVPDAVTQAIYQICLIMVDS 596
            DMLPNSTER + I G+P ++ + + QIC++M+++
Sbjct: 126 GDMLPNSTERAITIAGIPQSIIECVKQICVVMLET 160
>pdb|3VKE|A Chain A, Contribution Of The First K-Homology Domain Of Poly(C)-Binding Protein 1 To Its Affinity And Specificity For C-Rich Oligonucleotides Length = 76 Back     alignment and structure
>pdb|1ZTG|A Chain A, Human Alpha Polyc Binding Protein Kh1 Length = 74 Back     alignment and structure
>pdb|2AXY|A Chain A, Crystal Structure Of Kh1 Domain Of Human Poly(C)-Binding Protein-2 With C-Rich Strand Of Human Telomeric Dna Length = 73 Back     alignment and structure
>pdb|2P2R|A Chain A, Crystal Structure Of The Third Kh Domain Of Human Poly(C)- Binding Protein-2 In Complex With C-Rich Strand Of Human Telomeric Dna Length = 76 Back     alignment and structure
>pdb|2P2R|A Chain A, Crystal Structure Of The Third Kh Domain Of Human Poly(C)- Binding Protein-2 In Complex With C-Rich Strand Of Human Telomeric Dna Length = 76 Back     alignment and structure
>pdb|1WVN|A Chain A, Crsytal Structure Of Domain 3 Of Human Alpha Polyc Binding Protein Length = 82 Back     alignment and structure
>pdb|1WVN|A Chain A, Crsytal Structure Of Domain 3 Of Human Alpha Polyc Binding Protein Length = 82 Back     alignment and structure
>pdb|1DTJ|A Chain A, Crystal Structure Of Nova-2 Kh3 K-Homology Rna-Binding Domain Length = 76 Back     alignment and structure
>pdb|1DTJ|A Chain A, Crystal Structure Of Nova-2 Kh3 K-Homology Rna-Binding Domain Length = 76 Back     alignment and structure
>pdb|1J5K|A Chain A, Complex Of The Kh3 Domain Of Hnrnp K With A Single_stranded 10mer Dna Oligonucleotide Length = 89 Back     alignment and structure
>pdb|1J5K|A Chain A, Complex Of The Kh3 Domain Of Hnrnp K With A Single_stranded 10mer Dna Oligonucleotide Length = 89 Back     alignment and structure
>pdb|1EC6|A Chain A, Crystal Structure Of Nova-2 Kh3 K-Homology Rna-Binding Domain Bound To 20-Mer Rna Hairpin Length = 87 Back     alignment and structure
>pdb|1EC6|A Chain A, Crystal Structure Of Nova-2 Kh3 K-Homology Rna-Binding Domain Bound To 20-Mer Rna Hairpin Length = 87 Back     alignment and structure
>pdb|1ZZI|A Chain A, Crystal Structure Analysis Of The Third Kh Domain Of Hnrnp K In Complex With Ssdna Length = 82 Back     alignment and structure
>pdb|1ZZI|A Chain A, Crystal Structure Analysis Of The Third Kh Domain Of Hnrnp K In Complex With Ssdna Length = 82 Back     alignment and structure
>pdb|1DT4|A Chain A, Crystal Structure Of Nova-1 Kh3 K-Homology Rna-Binding Domain Length = 73 Back     alignment and structure
>pdb|1DT4|A Chain A, Crystal Structure Of Nova-1 Kh3 K-Homology Rna-Binding Domain Length = 73 Back     alignment and structure
>pdb|1KHM|A Chain A, C-Terminal Kh Domain Of Hnrnp K (Kh3) Length = 89 Back     alignment and structure
>pdb|1KHM|A Chain A, C-Terminal Kh Domain Of Hnrnp K (Kh3) Length = 89 Back     alignment and structure
>pdb|2ANN|A Chain A, Crystal Structure (I) Of Nova-1 Kh1KH2 DOMAIN TANDEM WITH 25 NT RNA Hairpin Length = 178 Back     alignment and structure
>pdb|1X4N|A Chain A, Solution Structure Of Kh Domain In Fuse Binding Protein 1 Length = 92 Back     alignment and structure
>pdb|1X4N|A Chain A, Solution Structure Of Kh Domain In Fuse Binding Protein 1 Length = 92 Back     alignment and structure
>pdb|2ANR|A Chain A, Crystal Structure (Ii) Of Nova-1 Kh1KH2 DOMAIN TANDEM WITH 25NT RNA Hairpin Length = 178 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query914
2jzx_A160 Poly(RC)-binding protein 2; PCBP2, KH domains, RNA 2e-48
2jzx_A160 Poly(RC)-binding protein 2; PCBP2, KH domains, RNA 1e-47
2jzx_A160 Poly(RC)-binding protein 2; PCBP2, KH domains, RNA 6e-16
2jzx_A160 Poly(RC)-binding protein 2; PCBP2, KH domains, RNA 6e-16
2jzx_A160 Poly(RC)-binding protein 2; PCBP2, KH domains, RNA 1e-14
2jzx_A160 Poly(RC)-binding protein 2; PCBP2, KH domains, RNA 1e-14
2jzx_A160 Poly(RC)-binding protein 2; PCBP2, KH domains, RNA 4e-13
2jzx_A160 Poly(RC)-binding protein 2; PCBP2, KH domains, RNA 4e-13
2jzx_A160 Poly(RC)-binding protein 2; PCBP2, KH domains, RNA 7e-11
2anr_A178 Neuro-oncological ventral antigen 1; protein-RNA c 8e-43
2anr_A178 Neuro-oncological ventral antigen 1; protein-RNA c 2e-42
2anr_A178 Neuro-oncological ventral antigen 1; protein-RNA c 1e-16
2anr_A178 Neuro-oncological ventral antigen 1; protein-RNA c 1e-16
2anr_A178 Neuro-oncological ventral antigen 1; protein-RNA c 2e-15
2anr_A178 Neuro-oncological ventral antigen 1; protein-RNA c 2e-15
2anr_A178 Neuro-oncological ventral antigen 1; protein-RNA c 4e-15
2anr_A178 Neuro-oncological ventral antigen 1; protein-RNA c 4e-15
3krm_A163 Insulin-like growth factor 2 mRNA-binding protein 4e-42
3krm_A163 Insulin-like growth factor 2 mRNA-binding protein 1e-41
3krm_A163 Insulin-like growth factor 2 mRNA-binding protein 1e-16
3krm_A163 Insulin-like growth factor 2 mRNA-binding protein 1e-16
3krm_A163 Insulin-like growth factor 2 mRNA-binding protein 1e-14
3krm_A163 Insulin-like growth factor 2 mRNA-binding protein 1e-14
3krm_A163 Insulin-like growth factor 2 mRNA-binding protein 1e-13
3krm_A163 Insulin-like growth factor 2 mRNA-binding protein 1e-13
3krm_A163 Insulin-like growth factor 2 mRNA-binding protein 2e-10
3krm_A163 Insulin-like growth factor 2 mRNA-binding protein 2e-10
2jvz_A164 KH type-splicing, FAR upstream element-binding pro 3e-38
2jvz_A164 KH type-splicing, FAR upstream element-binding pro 5e-38
2jvz_A164 KH type-splicing, FAR upstream element-binding pro 3e-15
2jvz_A164 KH type-splicing, FAR upstream element-binding pro 3e-15
2jvz_A164 KH type-splicing, FAR upstream element-binding pro 6e-14
2jvz_A164 KH type-splicing, FAR upstream element-binding pro 6e-14
2jvz_A164 KH type-splicing, FAR upstream element-binding pro 2e-12
2jvz_A164 KH type-splicing, FAR upstream element-binding pro 2e-12
2jvz_A164 KH type-splicing, FAR upstream element-binding pro 9e-11
2jvz_A164 KH type-splicing, FAR upstream element-binding pro 9e-11
1j4w_A174 FUSE binding protein; single-stranded DNA binding 2e-36
1j4w_A174 FUSE binding protein; single-stranded DNA binding 3e-36
1j4w_A174 FUSE binding protein; single-stranded DNA binding 5e-18
1j4w_A174 FUSE binding protein; single-stranded DNA binding 5e-18
1j4w_A174 FUSE binding protein; single-stranded DNA binding 8e-17
1j4w_A174 FUSE binding protein; single-stranded DNA binding 8e-17
1j4w_A174 FUSE binding protein; single-stranded DNA binding 5e-14
1j4w_A174 FUSE binding protein; single-stranded DNA binding 5e-14
1j4w_A174 FUSE binding protein; single-stranded DNA binding 6e-11
1j4w_A174 FUSE binding protein; single-stranded DNA binding 4e-09
1dtj_A76 RNA-binding neurooncological ventral antigen 2; KH 1e-24
1dtj_A76 RNA-binding neurooncological ventral antigen 2; KH 1e-24
1dtj_A76 RNA-binding neurooncological ventral antigen 2; KH 1e-17
1dtj_A76 RNA-binding neurooncological ventral antigen 2; KH 1e-17
1dtj_A76 RNA-binding neurooncological ventral antigen 2; KH 2e-12
1dtj_A76 RNA-binding neurooncological ventral antigen 2; KH 2e-12
1ec6_A87 RNA-binding protein NOVA-2; KH domain, alpha-beta 4e-24
1ec6_A87 RNA-binding protein NOVA-2; KH domain, alpha-beta 4e-24
1ec6_A87 RNA-binding protein NOVA-2; KH domain, alpha-beta 2e-17
1ec6_A87 RNA-binding protein NOVA-2; KH domain, alpha-beta 2e-17
1ec6_A87 RNA-binding protein NOVA-2; KH domain, alpha-beta 4e-12
1ec6_A87 RNA-binding protein NOVA-2; KH domain, alpha-beta 4e-12
2p2r_A76 Poly(RC)-binding protein 2; protein-DNA complex, R 7e-23
2p2r_A76 Poly(RC)-binding protein 2; protein-DNA complex, R 7e-23
2p2r_A76 Poly(RC)-binding protein 2; protein-DNA complex, R 2e-17
2p2r_A76 Poly(RC)-binding protein 2; protein-DNA complex, R 2e-17
2p2r_A76 Poly(RC)-binding protein 2; protein-DNA complex, R 1e-12
2p2r_A76 Poly(RC)-binding protein 2; protein-DNA complex, R 1e-12
1j5k_A89 Heterogeneous nuclear ribonucleoprotein K; single- 2e-22
1j5k_A89 Heterogeneous nuclear ribonucleoprotein K; single- 2e-22
1j5k_A89 Heterogeneous nuclear ribonucleoprotein K; single- 3e-17
1j5k_A89 Heterogeneous nuclear ribonucleoprotein K; single- 3e-17
1j5k_A89 Heterogeneous nuclear ribonucleoprotein K; single- 3e-12
1j5k_A89 Heterogeneous nuclear ribonucleoprotein K; single- 3e-12
1zzk_A82 Heterogeneous nuclear ribonucleoprotein K; KH domi 2e-22
1zzk_A82 Heterogeneous nuclear ribonucleoprotein K; KH domi 2e-22
1zzk_A82 Heterogeneous nuclear ribonucleoprotein K; KH domi 9e-17
1zzk_A82 Heterogeneous nuclear ribonucleoprotein K; KH domi 9e-17
1zzk_A82 Heterogeneous nuclear ribonucleoprotein K; KH domi 3e-12
1zzk_A82 Heterogeneous nuclear ribonucleoprotein K; KH domi 3e-12
1wvn_A82 Poly(RC)-binding protein 1; KH domain, RNA binding 3e-22
1wvn_A82 Poly(RC)-binding protein 1; KH domain, RNA binding 3e-22
1wvn_A82 Poly(RC)-binding protein 1; KH domain, RNA binding 6e-16
1wvn_A82 Poly(RC)-binding protein 1; KH domain, RNA binding 6e-16
1wvn_A82 Poly(RC)-binding protein 1; KH domain, RNA binding 3e-12
1wvn_A82 Poly(RC)-binding protein 1; KH domain, RNA binding 3e-12
2axy_A73 Poly(RC)-binding protein 2; protein-DNA complex, D 7e-22
2axy_A73 Poly(RC)-binding protein 2; protein-DNA complex, D 4e-21
2axy_A73 Poly(RC)-binding protein 2; protein-DNA complex, D 5e-18
2axy_A73 Poly(RC)-binding protein 2; protein-DNA complex, D 5e-18
2axy_A73 Poly(RC)-binding protein 2; protein-DNA complex, D 5e-16
2axy_A73 Poly(RC)-binding protein 2; protein-DNA complex, D 5e-16
1x4n_A92 FAR upstream element binding protein 1; KH domain, 5e-20
1x4n_A92 FAR upstream element binding protein 1; KH domain, 5e-20
1x4n_A92 FAR upstream element binding protein 1; KH domain, 3e-13
1x4n_A92 FAR upstream element binding protein 1; KH domain, 3e-13
1x4n_A92 FAR upstream element binding protein 1; KH domain, 1e-10
1x4n_A92 FAR upstream element binding protein 1; KH domain, 1e-10
2opv_A85 KHSRP protein; KH domain, RNA binding protein, KSR 2e-19
2opv_A85 KHSRP protein; KH domain, RNA binding protein, KSR 2e-19
2opv_A85 KHSRP protein; KH domain, RNA binding protein, KSR 6e-17
2opv_A85 KHSRP protein; KH domain, RNA binding protein, KSR 6e-17
2opv_A85 KHSRP protein; KH domain, RNA binding protein, KSR 1e-10
2opv_A85 KHSRP protein; KH domain, RNA binding protein, KSR 1e-10
2hh2_A107 KH-type splicing regulatory protein; KH-RNA bindin 5e-19
2hh2_A107 KH-type splicing regulatory protein; KH-RNA bindin 5e-19
2hh2_A107 KH-type splicing regulatory protein; KH-RNA bindin 5e-17
2hh2_A107 KH-type splicing regulatory protein; KH-RNA bindin 5e-17
2hh2_A107 KH-type splicing regulatory protein; KH-RNA bindin 1e-09
2hh2_A107 KH-type splicing regulatory protein; KH-RNA bindin 1e-09
1we8_A104 Tudor and KH domain containing protein; structural 4e-18
1we8_A104 Tudor and KH domain containing protein; structural 4e-18
1we8_A104 Tudor and KH domain containing protein; structural 1e-14
1we8_A104 Tudor and KH domain containing protein; structural 1e-14
1we8_A104 Tudor and KH domain containing protein; structural 1e-09
1we8_A104 Tudor and KH domain containing protein; structural 1e-09
1x4m_A94 FAR upstream element binding protein 1; KH domain, 2e-17
1x4m_A94 FAR upstream element binding protein 1; KH domain, 2e-17
1x4m_A94 FAR upstream element binding protein 1; KH domain, 2e-16
1x4m_A94 FAR upstream element binding protein 1; KH domain, 2e-16
1x4m_A94 FAR upstream element binding protein 1; KH domain, 5e-09
1x4m_A94 FAR upstream element binding protein 1; KH domain, 5e-09
2hh3_A106 KH-type splicing regulatory protein; KH-RNA bindin 9e-16
2hh3_A106 KH-type splicing regulatory protein; KH-RNA bindin 9e-16
2hh3_A106 KH-type splicing regulatory protein; KH-RNA bindin 3e-15
2hh3_A106 KH-type splicing regulatory protein; KH-RNA bindin 3e-15
2hh3_A106 KH-type splicing regulatory protein; KH-RNA bindin 2e-13
2hh3_A106 KH-type splicing regulatory protein; KH-RNA bindin 2e-13
2cte_A94 Vigilin; K homology type I domain, RNA-binding, ce 1e-13
2cte_A94 Vigilin; K homology type I domain, RNA-binding, ce 1e-13
2cte_A94 Vigilin; K homology type I domain, RNA-binding, ce 5e-10
2cte_A94 Vigilin; K homology type I domain, RNA-binding, ce 5e-10
2cte_A94 Vigilin; K homology type I domain, RNA-binding, ce 9e-10
2cte_A94 Vigilin; K homology type I domain, RNA-binding, ce 9e-10
2ctk_A104 Vigilin; K homology type I domain, RNA-binding, ce 3e-12
2ctk_A104 Vigilin; K homology type I domain, RNA-binding, ce 3e-12
2ctk_A104 Vigilin; K homology type I domain, RNA-binding, ce 6e-09
2ctk_A104 Vigilin; K homology type I domain, RNA-binding, ce 6e-09
2ctk_A104 Vigilin; K homology type I domain, RNA-binding, ce 4e-08
2ctk_A104 Vigilin; K homology type I domain, RNA-binding, ce 4e-08
2qnd_A144 FMR1 protein; KH domain, eukaryotic KH domains, ta 4e-12
2qnd_A144 FMR1 protein; KH domain, eukaryotic KH domains, ta 4e-12
2qnd_A144 FMR1 protein; KH domain, eukaryotic KH domains, ta 2e-09
2qnd_A144 FMR1 protein; KH domain, eukaryotic KH domains, ta 2e-09
2qnd_A144 FMR1 protein; KH domain, eukaryotic KH domains, ta 3e-06
2qnd_A144 FMR1 protein; KH domain, eukaryotic KH domains, ta 3e-06
2e3u_A219 PH-DIM2P, hypothetical protein PH1566; PRE-ribosom 9e-12
2e3u_A219 PH-DIM2P, hypothetical protein PH1566; PRE-ribosom 9e-12
2e3u_A219 PH-DIM2P, hypothetical protein PH1566; PRE-ribosom 2e-06
2e3u_A219 PH-DIM2P, hypothetical protein PH1566; PRE-ribosom 2e-06
2e3u_A219 PH-DIM2P, hypothetical protein PH1566; PRE-ribosom 1e-04
2e3u_A219 PH-DIM2P, hypothetical protein PH1566; PRE-ribosom 1e-04
2e3u_A219 PH-DIM2P, hypothetical protein PH1566; PRE-ribosom 6e-04
2e3u_A219 PH-DIM2P, hypothetical protein PH1566; PRE-ribosom 6e-04
2ctl_A97 Vigilin; K homology type I domain, RNA-binding, ce 2e-11
2ctl_A97 Vigilin; K homology type I domain, RNA-binding, ce 2e-11
2ctl_A97 Vigilin; K homology type I domain, RNA-binding, ce 2e-08
2ctl_A97 Vigilin; K homology type I domain, RNA-binding, ce 2e-08
2ctl_A97 Vigilin; K homology type I domain, RNA-binding, ce 4e-07
2ctl_A97 Vigilin; K homology type I domain, RNA-binding, ce 4e-07
1tua_A191 Hypothetical protein APE0754; structural genomics, 3e-11
1tua_A191 Hypothetical protein APE0754; structural genomics, 3e-11
1tua_A191 Hypothetical protein APE0754; structural genomics, 1e-04
1tua_A191 Hypothetical protein APE0754; structural genomics, 1e-04
2dgr_A83 Ring finger and KH domain-containing protein 1; st 3e-10
2dgr_A83 Ring finger and KH domain-containing protein 1; st 3e-10
2dgr_A83 Ring finger and KH domain-containing protein 1; st 1e-07
2dgr_A83 Ring finger and KH domain-containing protein 1; st 1e-07
2dgr_A83 Ring finger and KH domain-containing protein 1; st 6e-07
2dgr_A83 Ring finger and KH domain-containing protein 1; st 6e-07
2ctm_A95 Vigilin; K homology type I domain, RNA-binding, ce 1e-09
2ctm_A95 Vigilin; K homology type I domain, RNA-binding, ce 1e-09
2ctm_A95 Vigilin; K homology type I domain, RNA-binding, ce 1e-06
2ctm_A95 Vigilin; K homology type I domain, RNA-binding, ce 1e-06
2ctm_A95 Vigilin; K homology type I domain, RNA-binding, ce 4e-06
2ctm_A95 Vigilin; K homology type I domain, RNA-binding, ce 4e-06
1vig_A71 Vigilin; RNA-binding protein, ribonucleoprotein; N 2e-09
1vig_A71 Vigilin; RNA-binding protein, ribonucleoprotein; N 2e-09
1vig_A71 Vigilin; RNA-binding protein, ribonucleoprotein; N 7e-09
1vig_A71 Vigilin; RNA-binding protein, ribonucleoprotein; N 7e-09
1vig_A71 Vigilin; RNA-binding protein, ribonucleoprotein; N 2e-08
1vig_A71 Vigilin; RNA-binding protein, ribonucleoprotein; N 2e-08
3n89_A376 Defective in GERM LINE development protein 3, ISO; 4e-07
3n89_A376 Defective in GERM LINE development protein 3, ISO; 4e-07
3n89_A376 Defective in GERM LINE development protein 3, ISO; 9e-06
3n89_A 376 Defective in GERM LINE development protein 3, ISO; 8e-05
2ctj_A95 Vigilin; K homology type I domain, RNA-binding, ce 7e-07
2ctj_A95 Vigilin; K homology type I domain, RNA-binding, ce 7e-07
2ctj_A95 Vigilin; K homology type I domain, RNA-binding, ce 2e-05
2ctj_A95 Vigilin; K homology type I domain, RNA-binding, ce 2e-05
2ctj_A95 Vigilin; K homology type I domain, RNA-binding, ce 1e-04
2ctj_A95 Vigilin; K homology type I domain, RNA-binding, ce 1e-04
2cpq_A91 FragIle X mental retardation syndrome related prot 2e-05
2cpq_A91 FragIle X mental retardation syndrome related prot 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 1e-04
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 1e-04
>2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160 Back     alignment and structure
 Score =  168 bits (426), Expect = 2e-48
 Identities = 79/155 (50%), Positives = 115/155 (74%), Gaps = 1/155 (0%)

Query: 442 MRHIMQGKEVGSIIGKSGETVKKLREESGSKIYISDSSTPERIVTVIGSMDSLFRAFSLI 501
           +R +M GKEVGSIIGK GE+VKK+REESG++I IS+ + PERI+T+ G  +++F+AF++I
Sbjct: 7   IRLLMHGKEVGSIIGKKGESVKKMREESGARINISEGNCPERIITLAGPTNAIFKAFAMI 66

Query: 502 TKNIEEFHKNQNKHLGGNGESQLIQLRLIVPASQCGSIIGKGGSQIKTIRETSGASVYVA 561
              +EE   +   +         + LRL+VPASQCGS+IGKGG +IK IRE++GA V VA
Sbjct: 67  IDKLEEDISSSMTN-STAASRPPVTLRLVVPASQCGSLIGKGGCKIKEIRESTGAQVQVA 125

Query: 562 SDMLPNSTEREVNIKGVPDAVTQAIYQICLIMVDS 596
            DMLPNSTER + I G+P ++ + + QIC++M+++
Sbjct: 126 GDMLPNSTERAITIAGIPQSIIECVKQICVVMLET 160
>2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160 Back     alignment and structure
>2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160 Back     alignment and structure
>2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160 Back     alignment and structure
>2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160 Back     alignment and structure
>2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160 Back     alignment and structure
>2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160 Back     alignment and structure
>2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160 Back     alignment and structure
>2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160 Back     alignment and structure
>2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Length = 178 Back     alignment and structure
>2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Length = 178 Back     alignment and structure
>2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Length = 178 Back     alignment and structure
>2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Length = 178 Back     alignment and structure
>2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Length = 178 Back     alignment and structure
>2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Length = 178 Back     alignment and structure
>2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Length = 178 Back     alignment and structure
>2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Length = 178 Back     alignment and structure
>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163 Back     alignment and structure
>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163 Back     alignment and structure
>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163 Back     alignment and structure
>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163 Back     alignment and structure
>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163 Back     alignment and structure
>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163 Back     alignment and structure
>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163 Back     alignment and structure
>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163 Back     alignment and structure
>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163 Back     alignment and structure
>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163 Back     alignment and structure
>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164 Back     alignment and structure
>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164 Back     alignment and structure
>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164 Back     alignment and structure
>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164 Back     alignment and structure
>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164 Back     alignment and structure
>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164 Back     alignment and structure
>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164 Back     alignment and structure
>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164 Back     alignment and structure
>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164 Back     alignment and structure
>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164 Back     alignment and structure
>1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174 Back     alignment and structure
>1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174 Back     alignment and structure
>1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174 Back     alignment and structure
>1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174 Back     alignment and structure
>1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174 Back     alignment and structure
>1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174 Back     alignment and structure
>1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174 Back     alignment and structure
>1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174 Back     alignment and structure
>1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174 Back     alignment and structure
>1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174 Back     alignment and structure
>1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A Length = 76 Back     alignment and structure
>1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A Length = 76 Back     alignment and structure
>1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A Length = 76 Back     alignment and structure
>1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A Length = 76 Back     alignment and structure
>1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A Length = 76 Back     alignment and structure
>1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A Length = 76 Back     alignment and structure
>1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Length = 87 Back     alignment and structure
>1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Length = 87 Back     alignment and structure
>1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Length = 87 Back     alignment and structure
>1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Length = 87 Back     alignment and structure
>1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Length = 87 Back     alignment and structure
>1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Length = 87 Back     alignment and structure
>2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Length = 76 Back     alignment and structure
>2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Length = 76 Back     alignment and structure
>2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Length = 76 Back     alignment and structure
>2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Length = 76 Back     alignment and structure
>2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Length = 76 Back     alignment and structure
>2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Length = 76 Back     alignment and structure
>1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Length = 89 Back     alignment and structure
>1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Length = 89 Back     alignment and structure
>1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Length = 89 Back     alignment and structure
>1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Length = 89 Back     alignment and structure
>1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Length = 89 Back     alignment and structure
>1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Length = 89 Back     alignment and structure
>1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Length = 82 Back     alignment and structure
>1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Length = 82 Back     alignment and structure
>1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Length = 82 Back     alignment and structure
>1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Length = 82 Back     alignment and structure
>1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Length = 82 Back     alignment and structure
>1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Length = 82 Back     alignment and structure
>1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Length = 82 Back     alignment and structure
>1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Length = 82 Back     alignment and structure
>1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Length = 82 Back     alignment and structure
>1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Length = 82 Back     alignment and structure
>1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Length = 82 Back     alignment and structure
>1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Length = 82 Back     alignment and structure
>2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Length = 73 Back     alignment and structure
>2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Length = 73 Back     alignment and structure
>2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Length = 73 Back     alignment and structure
>2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Length = 73 Back     alignment and structure
>2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Length = 73 Back     alignment and structure
>2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Length = 73 Back     alignment and structure
>1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Length = 92 Back     alignment and structure
>1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Length = 92 Back     alignment and structure
>1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Length = 92 Back     alignment and structure
>1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Length = 92 Back     alignment and structure
>1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Length = 92 Back     alignment and structure
>1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Length = 92 Back     alignment and structure
>2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 107 Back     alignment and structure
>2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 107 Back     alignment and structure
>2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 107 Back     alignment and structure
>2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 107 Back     alignment and structure
>2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 107 Back     alignment and structure
>2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 107 Back     alignment and structure
>1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 Length = 104 Back     alignment and structure
>1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 Length = 104 Back     alignment and structure
>1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 Length = 104 Back     alignment and structure
>1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 Length = 104 Back     alignment and structure
>1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 Length = 104 Back     alignment and structure
>1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 Length = 104 Back     alignment and structure
>1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Length = 94 Back     alignment and structure
>1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Length = 94 Back     alignment and structure
>1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Length = 94 Back     alignment and structure
>1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Length = 94 Back     alignment and structure
>1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Length = 94 Back     alignment and structure
>1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Length = 94 Back     alignment and structure
>2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 94 Back     alignment and structure
>2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 94 Back     alignment and structure
>2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 94 Back     alignment and structure
>2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 94 Back     alignment and structure
>2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 94 Back     alignment and structure
>2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 94 Back     alignment and structure
>2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 104 Back     alignment and structure
>2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 104 Back     alignment and structure
>2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 104 Back     alignment and structure
>2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 104 Back     alignment and structure
>2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 104 Back     alignment and structure
>2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 104 Back     alignment and structure
>2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Length = 144 Back     alignment and structure
>2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Length = 144 Back     alignment and structure
>2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Length = 144 Back     alignment and structure
>2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Length = 144 Back     alignment and structure
>2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Length = 144 Back     alignment and structure
>2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Length = 144 Back     alignment and structure
>2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B Length = 219 Back     alignment and structure
>2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B Length = 219 Back     alignment and structure
>2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B Length = 219 Back     alignment and structure
>2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B Length = 219 Back     alignment and structure
>2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B Length = 219 Back     alignment and structure
>2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B Length = 219 Back     alignment and structure
>2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B Length = 219 Back     alignment and structure
>2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B Length = 219 Back     alignment and structure
>2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 97 Back     alignment and structure
>2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 97 Back     alignment and structure
>2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 97 Back     alignment and structure
>2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 97 Back     alignment and structure
>2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 97 Back     alignment and structure
>2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 97 Back     alignment and structure
>1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 Length = 191 Back     alignment and structure
>1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 Length = 191 Back     alignment and structure
>1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 Length = 191 Back     alignment and structure
>1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 Length = 191 Back     alignment and structure
>2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 95 Back     alignment and structure
>2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 95 Back     alignment and structure
>2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 95 Back     alignment and structure
>2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 95 Back     alignment and structure
>2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 95 Back     alignment and structure
>2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 95 Back     alignment and structure
>1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A Length = 71 Back     alignment and structure
>1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A Length = 71 Back     alignment and structure
>1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A Length = 71 Back     alignment and structure
>1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A Length = 71 Back     alignment and structure
>1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A Length = 71 Back     alignment and structure
>1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A Length = 71 Back     alignment and structure
>3n89_A Defective in GERM LINE development protein 3, ISO; KH domains, RNA binding, cell cycle; 2.79A {Caenorhabditis elegans} Length = 376 Back     alignment and structure
>3n89_A Defective in GERM LINE development protein 3, ISO; KH domains, RNA binding, cell cycle; 2.79A {Caenorhabditis elegans} Length = 376 Back     alignment and structure
>3n89_A Defective in GERM LINE development protein 3, ISO; KH domains, RNA binding, cell cycle; 2.79A {Caenorhabditis elegans} Length = 376 Back     alignment and structure
>3n89_A Defective in GERM LINE development protein 3, ISO; KH domains, RNA binding, cell cycle; 2.79A {Caenorhabditis elegans} Length = 376 Back     alignment and structure
>2ctj_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 95 Back     alignment and structure
>2ctj_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 95 Back     alignment and structure
>2ctj_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 95 Back     alignment and structure
>2ctj_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 95 Back     alignment and structure
>2ctj_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 95 Back     alignment and structure
>2ctj_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 95 Back     alignment and structure
>2cpq_A FragIle X mental retardation syndrome related protein 1, isoform B'; KH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 91 Back     alignment and structure
>2cpq_A FragIle X mental retardation syndrome related protein 1, isoform B'; KH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 91 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query914
3krm_A163 Insulin-like growth factor 2 mRNA-binding protein 99.9
2jzx_A160 Poly(RC)-binding protein 2; PCBP2, KH domains, RNA 99.9
3krm_A163 Insulin-like growth factor 2 mRNA-binding protein 99.89
2jvz_A164 KH type-splicing, FAR upstream element-binding pro 99.88
2anr_A178 Neuro-oncological ventral antigen 1; protein-RNA c 99.88
1j4w_A174 FUSE binding protein; single-stranded DNA binding 99.88
3n89_A376 Defective in GERM LINE development protein 3, ISO; 99.88
2anr_A178 Neuro-oncological ventral antigen 1; protein-RNA c 99.88
3n89_A376 Defective in GERM LINE development protein 3, ISO; 99.87
2jzx_A160 Poly(RC)-binding protein 2; PCBP2, KH domains, RNA 99.87
2jvz_A164 KH type-splicing, FAR upstream element-binding pro 99.87
1j4w_A174 FUSE binding protein; single-stranded DNA binding 99.86
2qnd_A144 FMR1 protein; KH domain, eukaryotic KH domains, ta 99.69
2qnd_A144 FMR1 protein; KH domain, eukaryotic KH domains, ta 99.64
2e3u_A219 PH-DIM2P, hypothetical protein PH1566; PRE-ribosom 99.51
2e3u_A219 PH-DIM2P, hypothetical protein PH1566; PRE-ribosom 99.51
1dtj_A76 RNA-binding neurooncological ventral antigen 2; KH 99.45
1zzk_A82 Heterogeneous nuclear ribonucleoprotein K; KH domi 99.44
1ec6_A87 RNA-binding protein NOVA-2; KH domain, alpha-beta 99.42
1x4n_A92 FAR upstream element binding protein 1; KH domain, 99.41
1wvn_A82 Poly(RC)-binding protein 1; KH domain, RNA binding 99.4
2p2r_A76 Poly(RC)-binding protein 2; protein-DNA complex, R 99.39
2hh2_A107 KH-type splicing regulatory protein; KH-RNA bindin 99.37
1j5k_A89 Heterogeneous nuclear ribonucleoprotein K; single- 99.37
1tua_A191 Hypothetical protein APE0754; structural genomics, 99.37
1tua_A191 Hypothetical protein APE0754; structural genomics, 99.34
2axy_A73 Poly(RC)-binding protein 2; protein-DNA complex, D 99.34
2dgr_A83 Ring finger and KH domain-containing protein 1; st 99.3
2ctm_A95 Vigilin; K homology type I domain, RNA-binding, ce 99.3
2hh3_A106 KH-type splicing regulatory protein; KH-RNA bindin 99.3
2hh2_A107 KH-type splicing regulatory protein; KH-RNA bindin 99.29
2axy_A73 Poly(RC)-binding protein 2; protein-DNA complex, D 99.29
1we8_A104 Tudor and KH domain containing protein; structural 99.28
2ctl_A97 Vigilin; K homology type I domain, RNA-binding, ce 99.28
2opv_A85 KHSRP protein; KH domain, RNA binding protein, KSR 99.27
2cte_A94 Vigilin; K homology type I domain, RNA-binding, ce 99.26
1x4m_A94 FAR upstream element binding protein 1; KH domain, 99.26
2p2r_A76 Poly(RC)-binding protein 2; protein-DNA complex, R 99.25
1zzk_A82 Heterogeneous nuclear ribonucleoprotein K; KH domi 99.25
1wvn_A82 Poly(RC)-binding protein 1; KH domain, RNA binding 99.25
1vig_A71 Vigilin; RNA-binding protein, ribonucleoprotein; N 99.23
1dtj_A76 RNA-binding neurooncological ventral antigen 2; KH 99.23
2opv_A85 KHSRP protein; KH domain, RNA binding protein, KSR 99.21
1j5k_A89 Heterogeneous nuclear ribonucleoprotein K; single- 99.21
1ec6_A87 RNA-binding protein NOVA-2; KH domain, alpha-beta 99.19
1x4n_A92 FAR upstream element binding protein 1; KH domain, 99.19
1x4m_A94 FAR upstream element binding protein 1; KH domain, 99.15
2ctk_A104 Vigilin; K homology type I domain, RNA-binding, ce 99.15
2hh3_A106 KH-type splicing regulatory protein; KH-RNA bindin 99.13
2dgr_A83 Ring finger and KH domain-containing protein 1; st 99.1
2ctj_A95 Vigilin; K homology type I domain, RNA-binding, ce 99.09
2ctl_A97 Vigilin; K homology type I domain, RNA-binding, ce 99.09
2ctm_A95 Vigilin; K homology type I domain, RNA-binding, ce 99.08
2ctf_A102 Vigilin; K homology type I domain, RNA-binding, ce 99.07
2cte_A94 Vigilin; K homology type I domain, RNA-binding, ce 99.06
1vig_A71 Vigilin; RNA-binding protein, ribonucleoprotein; N 99.06
2ctf_A102 Vigilin; K homology type I domain, RNA-binding, ce 99.04
1we8_A104 Tudor and KH domain containing protein; structural 99.02
2ctk_A104 Vigilin; K homology type I domain, RNA-binding, ce 98.94
2ctj_A95 Vigilin; K homology type I domain, RNA-binding, ce 98.91
2cpq_A91 FragIle X mental retardation syndrome related prot 98.76
2cpq_A91 FragIle X mental retardation syndrome related prot 98.48
2yqr_A119 KIAA0907 protein; structure genomics, KH domain, s 98.38
1k1g_A131 SF1-BO isoform; splicing, branch point sequence, p 98.27
2yqr_A119 KIAA0907 protein; structure genomics, KH domain, s 98.2
1k1g_A131 SF1-BO isoform; splicing, branch point sequence, p 98.13
3v69_A140 Protein filia; RNA-binding, embryogenesis, KH doma 97.98
3u1k_A630 Polyribonucleotide nucleotidyltransferase 1, MITO; 97.59
2bl5_A140 MGC83862 protein, quaking protein; STAR proteins, 97.53
2bl5_A140 MGC83862 protein, quaking protein; STAR proteins, 97.48
3u1k_A630 Polyribonucleotide nucleotidyltransferase 1, MITO; 97.44
3v69_A140 Protein filia; RNA-binding, embryogenesis, KH doma 96.9
4aid_A726 Polyribonucleotide nucleotidyltransferase; transfe 96.56
4aid_A726 Polyribonucleotide nucleotidyltransferase; transfe 96.49
2cxc_A144 NUSA; transcription termination, RNA binding prote 96.35
2cxc_A144 NUSA; transcription termination, RNA binding prote 96.04
1k0r_A366 NUSA; two component arrangement, S1 domain, two K- 94.24
2asb_A251 Transcription elongation protein NUSA; protein-RNA 94.17
2asb_A251 Transcription elongation protein NUSA; protein-RNA 93.6
3cdi_A723 Polynucleotide phosphorylase; mRNA turnover, RNAse 92.08
3cdi_A723 Polynucleotide phosphorylase; mRNA turnover, RNAse 91.46
1e3p_A757 Guanosine pentaphosphate synthetase; polyribonucle 91.3
1k0r_A366 NUSA; two component arrangement, S1 domain, two K- 90.81
1e3p_A757 Guanosine pentaphosphate synthetase; polyribonucle 89.62
1hh2_P344 NUSA, N utilization substance protein A; transcrip 87.11
1hh2_P344 NUSA, N utilization substance protein A; transcrip 85.11
>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Back     alignment and structure
Probab=99.90  E-value=1.8e-23  Score=208.56  Aligned_cols=160  Identities=25%  Similarity=0.388  Sum_probs=135.4

Q ss_pred             ceEEEEEecCCccceeeccCCchHHHHHhhcCceEEEccCCCCCCCcceEEEecCHHHHHHHHHHHHHHhccCCCCCCCC
Q psy13906        524 LIQLRLIVPASQCGSIIGKGGSQIKTIRETSGASVYVASDMLPNSTEREVNIKGVPDAVTQAIYQICLIMVDSPPKGATI  603 (914)
Q Consensus       524 ~~~~~l~VP~~~~G~IIGkgG~~IkeI~~~tga~I~v~~~~~p~~~er~V~I~G~~e~V~~A~~~I~~~l~e~~~~~~~~  603 (914)
                      +.+++|+||.+++|.||||+|++||+|+++|||+|++.++..+++.+|.|+|+|+++++.+|+.+|.+++.+....    
T Consensus         2 ~~~~~~~ip~~~~g~iIGk~G~~Ik~i~~~tg~~I~i~~~~~~~~~~r~v~I~G~~e~v~~A~~~I~~~~~e~~~~----   77 (163)
T 3krm_A            2 QEMVQVFIPAQAVGAIIGKKGQHIKQLSRFASASIKIAPPETPDSKVRMVIITGPPEAQFKAQGRIYGKLKEENFF----   77 (163)
T ss_dssp             CEEEEEEEEGGGHHHHHCGGGHHHHHHHHHHTCEEEECCCSSTTCSEEEEEEEECHHHHHHHHHHHHHHHHHTTSS----
T ss_pred             ceEEEEEechhhcceeECCCcHHHHHHHHHHCCeEEEcCCCCCCCCceEEEEEcCHHHHHHHHHHHHHHHhccccc----
Confidence            4578999999999999999999999999999999999987778899999999999999999999999999875100    


Q ss_pred             CCCCCCCCCCCCcccCCcccccCcCCCCCCCCCCccchhcccCCCCCCCCCCCCCCChHHHHHhhhcccccCCCCCCCcc
Q psy13906        604 PYRPLPQNAGGPGLIGNQFGMQNSLMGAPDMGNNPLAGLAALGLGGNSGGGMGGGLNAAALAALASSQLKTNHMPRNQNQ  683 (914)
Q Consensus       604 py~P~~~~~~~~~~~g~~~~~q~s~~~~~~~~~~p~~~~~~~~~~g~~~~~~~~g~~~~~~~~~~~s~~~~~~~~~~~~~  683 (914)
                        .|.                                                                           
T Consensus        78 --~~~---------------------------------------------------------------------------   80 (163)
T 3krm_A           78 --GPK---------------------------------------------------------------------------   80 (163)
T ss_dssp             --CSS---------------------------------------------------------------------------
T ss_pred             --ccc---------------------------------------------------------------------------
Confidence              000                                                                           


Q ss_pred             ccccCCCCCCCCCCccccccCCceEEEEEecCccccccccCCcchHHHHHhhhCCEEEEcCCCCCCCCCCceEEEEEcCH
Q psy13906        684 NQNQHNRNNRDGPSQKTNQQQNQITKEMTVPNELIGAVIGKGGTKIFEIRKISGAMIRISKSSEEEEDSNDRTITMTGTP  763 (914)
Q Consensus       684 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~vp~~~~g~iIG~~G~~I~~I~~~sga~I~i~~~~~~~~~~~~r~i~I~G~~  763 (914)
                                         .....+.++.||.+++|+|||++|++|++|++.|||+|.|++...+ ..+.++.|+|+|++
T Consensus        81 -------------------~~~~~~~~i~vp~~~~g~iIGkgG~~I~~i~~~tga~I~i~~~~~~-~~~~~~~v~I~G~~  140 (163)
T 3krm_A           81 -------------------EEVKLETHIRVPASAAGRVIGKGGKTVNELQNLTAAEVVVPRDQTP-DENDQVIVKIIGHF  140 (163)
T ss_dssp             -------------------CCCCEEEEEEEETTTHHHHHCGGGHHHHHHHHHHCCEEECCTTCCC-CTTSEEEEEEEECH
T ss_pred             -------------------cCCceEEEEEcChhheeeEEcCCChHHHHHHHHhCCeEEECCCCCC-CCCCceEEEEEeCH
Confidence                               0124466899999999999999999999999999999999875332 23344589999999


Q ss_pred             HHHHHHHHHHHHHHHHHHhcc
Q psy13906        764 DAIALAQYLINMSVELLRANL  784 (914)
Q Consensus       764 ~~v~~A~~li~~~i~~~~~~~  784 (914)
                      ++|+.|+.+|+++|+..+...
T Consensus       141 ~~v~~A~~~I~~~i~~~~~~~  161 (163)
T 3krm_A          141 YASQMAQRKIRDILAQVKQQH  161 (163)
T ss_dssp             HHHHHHHHHHHHHHHHHTC--
T ss_pred             HHHHHHHHHHHHHHHHHHHhh
Confidence            999999999999998776543
>2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Back     alignment and structure
>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Back     alignment and structure
>2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Back     alignment and structure
>1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Back     alignment and structure
>3n89_A Defective in GERM LINE development protein 3, ISO; KH domains, RNA binding, cell cycle; 2.79A {Caenorhabditis elegans} Back     alignment and structure
>2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Back     alignment and structure
>3n89_A Defective in GERM LINE development protein 3, ISO; KH domains, RNA binding, cell cycle; 2.79A {Caenorhabditis elegans} Back     alignment and structure
>2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Back     alignment and structure
>1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Back     alignment and structure
>2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Back     alignment and structure
>2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Back     alignment and structure
>2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B Back     alignment and structure
>2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B Back     alignment and structure
>1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A Back     alignment and structure
>1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Back     alignment and structure
>1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Back     alignment and structure
>1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Back     alignment and structure
>2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Back     alignment and structure
>1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 Back     alignment and structure
>1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 Back     alignment and structure
>2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Back     alignment and structure
>2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Back     alignment and structure
>1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 Back     alignment and structure
>2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Back     alignment and structure
>2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Back     alignment and structure
>2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Back     alignment and structure
>1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Back     alignment and structure
>1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A Back     alignment and structure
>1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A Back     alignment and structure
>2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Back     alignment and structure
>1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Back     alignment and structure
>1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Back     alignment and structure
>1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Back     alignment and structure
>2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctj_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2ctf_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A Back     alignment and structure
>2ctf_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 Back     alignment and structure
>2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2ctj_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2cpq_A FragIle X mental retardation syndrome related protein 1, isoform B'; KH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2cpq_A FragIle X mental retardation syndrome related protein 1, isoform B'; KH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2yqr_A KIAA0907 protein; structure genomics, KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1k1g_A SF1-BO isoform; splicing, branch point sequence, protein/RNA recognition, complex E, KH domain, QUA2 homology; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2yqr_A KIAA0907 protein; structure genomics, KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1k1g_A SF1-BO isoform; splicing, branch point sequence, protein/RNA recognition, complex E, KH domain, QUA2 homology; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>3v69_A Protein filia; RNA-binding, embryogenesis, KH domain, RNA binding, P binding; 2.20A {Mus musculus} Back     alignment and structure
>3u1k_A Polyribonucleotide nucleotidyltransferase 1, MITO; RNAse PH, KH domain, exoribonuclease; HET: CIT; 2.13A {Homo sapiens} Back     alignment and structure
>2bl5_A MGC83862 protein, quaking protein; STAR proteins, GSG proteins, RNA binding; NMR {Xenopus laevis} SCOP: d.51.1.1 Back     alignment and structure
>2bl5_A MGC83862 protein, quaking protein; STAR proteins, GSG proteins, RNA binding; NMR {Xenopus laevis} SCOP: d.51.1.1 Back     alignment and structure
>3u1k_A Polyribonucleotide nucleotidyltransferase 1, MITO; RNAse PH, KH domain, exoribonuclease; HET: CIT; 2.13A {Homo sapiens} Back     alignment and structure
>3v69_A Protein filia; RNA-binding, embryogenesis, KH domain, RNA binding, P binding; 2.20A {Mus musculus} Back     alignment and structure
>4aid_A Polyribonucleotide nucleotidyltransferase; transferase-peptide complex; 2.60A {Caulobacter vibrioides} PDB: 4aim_A 4am3_A Back     alignment and structure
>4aid_A Polyribonucleotide nucleotidyltransferase; transferase-peptide complex; 2.60A {Caulobacter vibrioides} PDB: 4aim_A 4am3_A Back     alignment and structure
>2cxc_A NUSA; transcription termination, RNA binding protein, archaeal NUS domain, structural genomics, NPPSFA; 2.00A {Aeropyrum pernix} PDB: 2cy1_A Back     alignment and structure
>2cxc_A NUSA; transcription termination, RNA binding protein, archaeal NUS domain, structural genomics, NPPSFA; 2.00A {Aeropyrum pernix} PDB: 2cy1_A Back     alignment and structure
>1k0r_A NUSA; two component arrangement, S1 domain, two K-homology domains., structural genomics, PSI, protein structure initiative; 1.70A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 d.202.1.1 Back     alignment and structure
>2asb_A Transcription elongation protein NUSA; protein-RNA complex, transcription/RNA complex; 1.50A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 PDB: 2atw_A Back     alignment and structure
>2asb_A Transcription elongation protein NUSA; protein-RNA complex, transcription/RNA complex; 1.50A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 PDB: 2atw_A Back     alignment and structure
>3cdi_A Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA degradation, kinase, transferase; 2.60A {Escherichia coli} PDB: 1sro_A Back     alignment and structure
>3cdi_A Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA degradation, kinase, transferase; 2.60A {Escherichia coli} PDB: 1sro_A Back     alignment and structure
>1e3p_A Guanosine pentaphosphate synthetase; polyribonucleotide transferase, ATP-GTP diphosphotransferase RNA processing, RNA degradation; 2.5A {Streptomyces antibioticus} SCOP: a.4.9.1 b.40.4.5 d.14.1.4 d.14.1.4 d.52.3.1 d.101.1.1 d.101.1.1 PDB: 1e3h_A Back     alignment and structure
>1k0r_A NUSA; two component arrangement, S1 domain, two K-homology domains., structural genomics, PSI, protein structure initiative; 1.70A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 d.202.1.1 Back     alignment and structure
>1e3p_A Guanosine pentaphosphate synthetase; polyribonucleotide transferase, ATP-GTP diphosphotransferase RNA processing, RNA degradation; 2.5A {Streptomyces antibioticus} SCOP: a.4.9.1 b.40.4.5 d.14.1.4 d.14.1.4 d.52.3.1 d.101.1.1 d.101.1.1 PDB: 1e3h_A Back     alignment and structure
>1hh2_P NUSA, N utilization substance protein A; transcription regulation, termination; 2.1A {Thermotoga maritima} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 d.202.1.1 PDB: 1l2f_A Back     alignment and structure
>1hh2_P NUSA, N utilization substance protein A; transcription regulation, termination; 2.1A {Thermotoga maritima} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 d.202.1.1 PDB: 1l2f_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 914
d1x4na179 d.51.1.1 (A:8-86) Far upstream binding element, FB 3e-19
d1x4na179 d.51.1.1 (A:8-86) Far upstream binding element, FB 3e-19
d1x4na179 d.51.1.1 (A:8-86) Far upstream binding element, FB 5e-14
d1x4na179 d.51.1.1 (A:8-86) Far upstream binding element, FB 5e-14
d1x4na179 d.51.1.1 (A:8-86) Far upstream binding element, FB 1e-11
d1x4na179 d.51.1.1 (A:8-86) Far upstream binding element, FB 1e-11
d1dtja_74 d.51.1.1 (A:) Neuro-oncological ventral antigen 2, 1e-18
d1dtja_74 d.51.1.1 (A:) Neuro-oncological ventral antigen 2, 1e-18
d1dtja_74 d.51.1.1 (A:) Neuro-oncological ventral antigen 2, 2e-14
d1dtja_74 d.51.1.1 (A:) Neuro-oncological ventral antigen 2, 2e-14
d1dtja_74 d.51.1.1 (A:) Neuro-oncological ventral antigen 2, 2e-09
d1dtja_74 d.51.1.1 (A:) Neuro-oncological ventral antigen 2, 2e-09
d1wvna170 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Huma 8e-18
d1wvna170 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Huma 8e-18
d1wvna170 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Huma 3e-13
d1wvna170 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Huma 3e-13
d1wvna170 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Huma 4e-10
d1wvna170 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Huma 4e-10
d1j4wa271 d.51.1.1 (A:104-174) Far upstream binding element, 4e-17
d1j4wa271 d.51.1.1 (A:104-174) Far upstream binding element, 4e-17
d1j4wa271 d.51.1.1 (A:104-174) Far upstream binding element, 5e-13
d1j4wa271 d.51.1.1 (A:104-174) Far upstream binding element, 5e-13
d1j4wa271 d.51.1.1 (A:104-174) Far upstream binding element, 2e-08
d1j4wa271 d.51.1.1 (A:104-174) Far upstream binding element, 2e-08
d2ctea181 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T 1e-16
d2ctea181 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T 1e-16
d2ctea181 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T 2e-12
d2ctea181 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T 2e-12
d2ctea181 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T 7e-12
d2ctea181 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T 7e-12
d1zzka175 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapie 2e-16
d1zzka175 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapie 2e-16
d1zzka175 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapie 2e-12
d1zzka175 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapie 2e-12
d1zzka175 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapie 4e-10
d1zzka175 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapie 4e-10
d2axya171 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Hum 1e-15
d2axya171 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Hum 1e-15
d2axya171 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Hum 2e-15
d2axya171 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Hum 7e-15
d2axya171 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Hum 7e-15
d2axya171 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Hum 8e-15
d2ctla184 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [T 6e-15
d2ctla184 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [T 6e-15
d2ctla184 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [T 9e-14
d2ctla184 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [T 9e-14
d2ctla184 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [T 5e-09
d2ctla184 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [T 5e-09
d1j4wa174 d.51.1.1 (A:1-74) Far upstream binding element, FB 9e-14
d1j4wa174 d.51.1.1 (A:1-74) Far upstream binding element, FB 9e-14
d1j4wa174 d.51.1.1 (A:1-74) Far upstream binding element, FB 1e-12
d1j4wa174 d.51.1.1 (A:1-74) Far upstream binding element, FB 1e-12
d1j4wa174 d.51.1.1 (A:1-74) Far upstream binding element, FB 5e-09
d1j4wa174 d.51.1.1 (A:1-74) Far upstream binding element, FB 5e-09
d2ctka191 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [T 2e-13
d2ctka191 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [T 2e-13
d2ctka191 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [T 2e-11
d2ctka191 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [T 2e-11
d2ctka191 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [T 4e-11
d2ctka191 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [T 4e-11
d1x4ma181 d.51.1.1 (A:8-88) Far upstream binding element, FB 3e-13
d1x4ma181 d.51.1.1 (A:8-88) Far upstream binding element, FB 3e-13
d1x4ma181 d.51.1.1 (A:8-88) Far upstream binding element, FB 7e-13
d1x4ma181 d.51.1.1 (A:8-88) Far upstream binding element, FB 7e-13
d1x4ma181 d.51.1.1 (A:8-88) Far upstream binding element, FB 2e-07
d1x4ma181 d.51.1.1 (A:8-88) Far upstream binding element, FB 2e-07
d2ctma181 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T 4e-13
d2ctma181 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T 4e-13
d2ctma181 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T 2e-10
d2ctma181 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T 2e-10
d2ctma181 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T 1e-08
d2ctma181 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T 1e-08
d1we8a_104 d.51.1.1 (A:) Tudor and KH domain containing prote 1e-12
d1we8a_104 d.51.1.1 (A:) Tudor and KH domain containing prote 1e-12
d1we8a_104 d.51.1.1 (A:) Tudor and KH domain containing prote 7e-11
d1we8a_104 d.51.1.1 (A:) Tudor and KH domain containing prote 7e-11
d1we8a_104 d.51.1.1 (A:) Tudor and KH domain containing prote 1e-08
d1we8a_104 d.51.1.1 (A:) Tudor and KH domain containing prote 1e-08
d1viga_71 d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId 2e-11
d1viga_71 d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId 2e-11
d1viga_71 d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId 1e-10
d1viga_71 d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId 1e-10
d1viga_71 d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId 6e-09
d1viga_71 d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId 6e-09
d2cpqa178 d.51.1.1 (A:212-289) Fragile X mental retardation 7e-11
d2cpqa178 d.51.1.1 (A:212-289) Fragile X mental retardation 7e-11
d2cpqa178 d.51.1.1 (A:212-289) Fragile X mental retardation 4e-05
d2cpqa178 d.51.1.1 (A:212-289) Fragile X mental retardation 4e-05
d2cpqa178 d.51.1.1 (A:212-289) Fragile X mental retardation 4e-04
d2cpqa178 d.51.1.1 (A:212-289) Fragile X mental retardation 4e-04
d2ctja182 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [T 2e-10
d2ctja182 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [T 2e-10
d2ctja182 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [T 2e-08
d2ctja182 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [T 2e-08
d2ctja182 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [T 2e-07
d2ctja182 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [T 2e-07
d2ba0a384 d.51.1.1 (A:136-219) Exosome complex RNA-binding p 5e-10
d2ba0a384 d.51.1.1 (A:136-219) Exosome complex RNA-binding p 5e-10
d2ba0a384 d.51.1.1 (A:136-219) Exosome complex RNA-binding p 1e-09
d2ba0a384 d.51.1.1 (A:136-219) Exosome complex RNA-binding p 1e-09
d2ba0a384 d.51.1.1 (A:136-219) Exosome complex RNA-binding p 6e-08
d2ba0a384 d.51.1.1 (A:136-219) Exosome complex RNA-binding p 6e-08
d1tuaa184 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Ae 3e-09
d1tuaa184 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Ae 3e-09
d1tuaa184 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Ae 9e-06
d1tuaa184 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Ae 9e-06
d1tuaa184 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Ae 9e-04
d1tuaa184 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Ae 9e-04
d2ctfa190 d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [T 6e-06
d2ctfa190 d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [T 6e-06
d1tuaa2104 d.51.1.1 (A:85-188) Hypothetical protein APE0754 { 1e-05
d1tuaa2104 d.51.1.1 (A:85-188) Hypothetical protein APE0754 { 2e-05
d1tuaa2104 d.51.1.1 (A:85-188) Hypothetical protein APE0754 { 2e-05
d1tuaa2104 d.51.1.1 (A:85-188) Hypothetical protein APE0754 { 2e-05
d1tuaa2104 d.51.1.1 (A:85-188) Hypothetical protein APE0754 { 9e-04
d1tuaa2104 d.51.1.1 (A:85-188) Hypothetical protein APE0754 { 9e-04
d1e3ha454 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/ 2e-05
d1e3ha454 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/ 2e-05
d1e3ha454 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/ 7e-05
d1e3ha454 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/ 7e-05
d1e3ha454 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/ 1e-04
d1e3ha454 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/ 1e-04
d2je6i369 d.51.1.1 (I:153-221) Exosome complex RNA-binding p 1e-04
d2je6i369 d.51.1.1 (I:153-221) Exosome complex RNA-binding p 1e-04
d2je6i369 d.51.1.1 (I:153-221) Exosome complex RNA-binding p 3e-04
d2je6i369 d.51.1.1 (I:153-221) Exosome complex RNA-binding p 3e-04
d2je6i369 d.51.1.1 (I:153-221) Exosome complex RNA-binding p 4e-04
d2je6i369 d.51.1.1 (I:153-221) Exosome complex RNA-binding p 4e-04
d2z0sa287 d.51.1.1 (A:148-234) Exosome complex RNA-binding p 3e-04
d2z0sa287 d.51.1.1 (A:148-234) Exosome complex RNA-binding p 3e-04
d2z0sa287 d.51.1.1 (A:148-234) Exosome complex RNA-binding p 9e-04
d2z0sa287 d.51.1.1 (A:148-234) Exosome complex RNA-binding p 9e-04
d2z0sa287 d.51.1.1 (A:148-234) Exosome complex RNA-binding p 9e-04
d2z0sa287 d.51.1.1 (A:148-234) Exosome complex RNA-binding p 9e-04
>d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Eukaryotic type KH-domain (KH-domain type I)
superfamily: Eukaryotic type KH-domain (KH-domain type I)
family: Eukaryotic type KH-domain (KH-domain type I)
domain: Far upstream binding element, FBP
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 80.6 bits (199), Expect = 3e-19
 Identities = 27/80 (33%), Positives = 51/80 (63%), Gaps = 3/80 (3%)

Query: 257 QQQNQITKEMTVPNELIGAVIGKGGTKIFEIRKISGAMIRISKSSEEEEDSNDRTITMTG 316
           QQ++ +T+E  VP+ ++G +IG+GG +I  I++ SG  I+I+    +     +R+  +TG
Sbjct: 3   QQRSVMTEEYKVPDGMVGFIIGRGGEQISRIQQESGCKIQIAP---DSGGLPERSCMLTG 59

Query: 317 TPDAIALAQYLINMSVELLR 336
           TP+++  A+ L++  VE  R
Sbjct: 60  TPESVQSAKRLLDQIVEKGR 79
>d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 Back     information, alignment and structure
>d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 Back     information, alignment and structure
>d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 Back     information, alignment and structure
>d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 Back     information, alignment and structure
>d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 Back     information, alignment and structure
>d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 70 Back     information, alignment and structure
>d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 70 Back     information, alignment and structure
>d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 70 Back     information, alignment and structure
>d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 70 Back     information, alignment and structure
>d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 70 Back     information, alignment and structure
>d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 70 Back     information, alignment and structure
>d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 Back     information, alignment and structure
>d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 Back     information, alignment and structure
>d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 Back     information, alignment and structure
>d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 Back     information, alignment and structure
>d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 Back     information, alignment and structure
>d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 Back     information, alignment and structure
>d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 Back     information, alignment and structure
>d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 Back     information, alignment and structure
>d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 Back     information, alignment and structure
>d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 Back     information, alignment and structure
>d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 Back     information, alignment and structure
>d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 Back     information, alignment and structure
>d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 Back     information, alignment and structure
>d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 Back     information, alignment and structure
>d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 Back     information, alignment and structure
>d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 Back     information, alignment and structure
>d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 Back     information, alignment and structure
>d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 Back     information, alignment and structure
>d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 78 Back     information, alignment and structure
>d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 78 Back     information, alignment and structure
>d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 78 Back     information, alignment and structure
>d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 78 Back     information, alignment and structure
>d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 78 Back     information, alignment and structure
>d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 78 Back     information, alignment and structure
>d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 84 Back     information, alignment and structure
>d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 84 Back     information, alignment and structure
>d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 84 Back     information, alignment and structure
>d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 84 Back     information, alignment and structure
>d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 84 Back     information, alignment and structure
>d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 84 Back     information, alignment and structure
>d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Length = 84 Back     information, alignment and structure
>d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Length = 84 Back     information, alignment and structure
>d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Length = 84 Back     information, alignment and structure
>d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Length = 84 Back     information, alignment and structure
>d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Length = 84 Back     information, alignment and structure
>d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Length = 84 Back     information, alignment and structure
>d2ctfa1 d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2ctfa1 d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1tuaa2 d.51.1.1 (A:85-188) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Length = 104 Back     information, alignment and structure
>d1tuaa2 d.51.1.1 (A:85-188) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Length = 104 Back     information, alignment and structure
>d1tuaa2 d.51.1.1 (A:85-188) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Length = 104 Back     information, alignment and structure
>d1tuaa2 d.51.1.1 (A:85-188) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Length = 104 Back     information, alignment and structure
>d1tuaa2 d.51.1.1 (A:85-188) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Length = 104 Back     information, alignment and structure
>d1tuaa2 d.51.1.1 (A:85-188) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Length = 104 Back     information, alignment and structure
>d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} Length = 54 Back     information, alignment and structure
>d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} Length = 54 Back     information, alignment and structure
>d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} Length = 54 Back     information, alignment and structure
>d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} Length = 54 Back     information, alignment and structure
>d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} Length = 54 Back     information, alignment and structure
>d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} Length = 54 Back     information, alignment and structure
>d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Length = 69 Back     information, alignment and structure
>d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Length = 69 Back     information, alignment and structure
>d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Length = 69 Back     information, alignment and structure
>d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Length = 69 Back     information, alignment and structure
>d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Length = 69 Back     information, alignment and structure
>d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Length = 69 Back     information, alignment and structure
>d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Length = 87 Back     information, alignment and structure
>d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Length = 87 Back     information, alignment and structure
>d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Length = 87 Back     information, alignment and structure
>d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Length = 87 Back     information, alignment and structure
>d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Length = 87 Back     information, alignment and structure
>d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Length = 87 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query914
d1j4wa271 Far upstream binding element, FBP {Human (Homo sap 99.52
d1zzka175 HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} 99.52
d1dtja_74 Neuro-oncological ventral antigen 2, nova-2, KH3 { 99.5
d1wvna170 Poly(RC)-binding protein 1 {Human (Homo sapiens) [ 99.49
d1j4wa174 Far upstream binding element, FBP {Human (Homo sap 99.46
d1x4na179 Far upstream binding element, FBP {Mouse (Mus musc 99.43
d2axya171 Poly(RC)-binding protein 2 {Human (Homo sapiens) [ 99.4
d1x4ma181 Far upstream binding element, FBP {Mouse (Mus musc 99.39
d2ctma181 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.38
d2axya171 Poly(RC)-binding protein 2 {Human (Homo sapiens) [ 99.38
d1we8a_104 Tudor and KH domain containing protein, Tdrkh {Mou 99.37
d2ctla184 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.36
d2ctea181 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.36
d1wvna170 Poly(RC)-binding protein 1 {Human (Homo sapiens) [ 99.33
d1zzka175 HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} 99.33
d1j4wa271 Far upstream binding element, FBP {Human (Homo sap 99.33
d2ctja182 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.31
d1viga_71 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.31
d1x4ma181 Far upstream binding element, FBP {Mouse (Mus musc 99.3
d1dtja_74 Neuro-oncological ventral antigen 2, nova-2, KH3 { 99.3
d1j4wa174 Far upstream binding element, FBP {Human (Homo sap 99.28
d1x4na179 Far upstream binding element, FBP {Mouse (Mus musc 99.25
d2ctma181 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.24
d2ctla184 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.24
d2ctka191 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.24
d2ctea181 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.22
d1we8a_104 Tudor and KH domain containing protein, Tdrkh {Mou 99.2
d2cpqa178 Fragile X mental retardation syndrome related prot 99.17
d1viga_71 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.17
d2ctja182 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.16
d2ctfa190 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.12
d2ctka191 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.08
d2ba0a384 Exosome complex RNA-binding protein 1, ECR1 {Archa 99.06
d2ctfa190 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.04
d2cpqa178 Fragile X mental retardation syndrome related prot 98.91
d2ba0a384 Exosome complex RNA-binding protein 1, ECR1 {Archa 98.89
d2je6i369 Exosome complex RNA-binding protein 1, ECR1 {Sulfo 98.61
d1tuaa184 Hypothetical protein APE0754 {Aeropyrum pernix [Ta 98.59
d2z0sa287 Exosome complex RNA-binding protein 1, ECR1 {Aerop 98.57
d2je6i369 Exosome complex RNA-binding protein 1, ECR1 {Sulfo 98.4
d2z0sa287 Exosome complex RNA-binding protein 1, ECR1 {Aerop 98.35
d1tuaa184 Hypothetical protein APE0754 {Aeropyrum pernix [Ta 98.25
d1e3ha454 Polynucleotide phosphorylase/guanosine pentaphosph 98.24
d1tuaa2104 Hypothetical protein APE0754 {Aeropyrum pernix [Ta 98.23
d1tuaa2104 Hypothetical protein APE0754 {Aeropyrum pernix [Ta 98.02
d1e3ha454 Polynucleotide phosphorylase/guanosine pentaphosph 98.02
d1k1ga_122 RNA splicing factor 1 {Human (Homo sapiens) [TaxId 97.67
d1k1ga_122 RNA splicing factor 1 {Human (Homo sapiens) [TaxId 97.67
d2bl5a1134 Quaking protein A (Xqua) {African clawed frog (Xen 97.07
d2bl5a1134 Quaking protein A (Xqua) {African clawed frog (Xen 96.91
d2asba367 Transcription factor NusA, C-terminal domains {Myc 93.8
d1hh2p368 Transcription factor NusA, C-terminal domains {The 92.32
d2asba367 Transcription factor NusA, C-terminal domains {Myc 90.25
d1hh2p368 Transcription factor NusA, C-terminal domains {The 88.13
d2ja9a285 Ribosomal RNA-processing protein 40, RRP40 {Saccha 82.99
d2ja9a285 Ribosomal RNA-processing protein 40, RRP40 {Saccha 80.04
>d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Eukaryotic type KH-domain (KH-domain type I)
superfamily: Eukaryotic type KH-domain (KH-domain type I)
family: Eukaryotic type KH-domain (KH-domain type I)
domain: Far upstream binding element, FBP
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.52  E-value=6.7e-15  Score=122.99  Aligned_cols=70  Identities=34%  Similarity=0.542  Sum_probs=64.3

Q ss_pred             EEEEEecCccccccccCCcchHHHHHhhhCCEEEEcCCCCCCCCCCceEEEEEcCHHHHHHHHHHHHHHH
Q psy13906        708 TKEMTVPNELIGAVIGKGGTKIFEIRKISGAMIRISKSSEEEEDSNDRTITMTGTPDAIALAQYLINMSV  777 (914)
Q Consensus       708 ~~~~~vp~~~~g~iIG~~G~~I~~I~~~sga~I~i~~~~~~~~~~~~r~i~I~G~~~~v~~A~~li~~~i  777 (914)
                      ..+|.||.+++|+||||+|++|++|++.|||+|.|++..++.+++.+|.|+|+|++++|++|+.||+++|
T Consensus         2 ~~~~~IP~~~vg~IIGk~G~~Ik~I~~~sga~I~i~~~~~~~~~~~~r~v~I~G~~~~v~~A~~~I~e~i   71 (71)
T d1j4wa2           2 EFNFIVPTGKTGLIIGKGGETIKSISQQSGARIELQRNPPPNADPNMKLFTIRGTPQQIDYARQLIEEKI   71 (71)
T ss_dssp             EEEEEEETTTHHHHHCGGGHHHHHHHHHHCCEEEEECCCTTTSCTTEEEEEEECCHHHHHHHHHHHHHHC
T ss_pred             EEEEEEChHhcceEECCCCcChHHHHhhcCcEEEEeecCCCCCCCCeEEEEEEeCHHHHHHHHHHHHhhC
Confidence            3589999999999999999999999999999999998766666778899999999999999999999874
>d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctfa1 d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2ctfa1 d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} Back     information, alignment and structure
>d1tuaa2 d.51.1.1 (A:85-188) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1tuaa2 d.51.1.1 (A:85-188) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} Back     information, alignment and structure
>d1k1ga_ d.51.1.1 (A:) RNA splicing factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1ga_ d.51.1.1 (A:) RNA splicing factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bl5a1 d.51.1.1 (A:1-134) Quaking protein A (Xqua) {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d2bl5a1 d.51.1.1 (A:1-134) Quaking protein A (Xqua) {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d2asba3 d.52.3.1 (A:263-329) Transcription factor NusA, C-terminal domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1hh2p3 d.52.3.1 (P:277-344) Transcription factor NusA, C-terminal domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2asba3 d.52.3.1 (A:263-329) Transcription factor NusA, C-terminal domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1hh2p3 d.52.3.1 (P:277-344) Transcription factor NusA, C-terminal domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ja9a2 d.51.1.1 (A:152-236) Ribosomal RNA-processing protein 40, RRP40 {Saccharomyces cerevisiae [TaxId: 4932]} Back     information, alignment and structure
>d2ja9a2 d.51.1.1 (A:152-236) Ribosomal RNA-processing protein 40, RRP40 {Saccharomyces cerevisiae [TaxId: 4932]} Back     information, alignment and structure