Psyllid ID: psy13911


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180---
MALELFLQNSSKLKVLNISKNCLKMLPSLNNENRYLEKLYLTSNALTDIGPLNKCRQLNTLHVAYNAITSLPDNCISAWSEMEELVLSGNGISSLPNTIPQSWPHLRVLRLHSNHLTSCPTLYLSSSLRVLDLSYNHLERLNLNTLIPKQLQYLDVSGNPRLHVDPNHFKSYRSYVRVYIQLV
cccHHHccccccccEEEccccccccccHHHHccccccEEEcccccccccccccccccccEEEccccccccccHHHHcccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccEEEccccccccccccccccccccEEEcccccccccccHHHcccccccEEEEEEc
ccHHHHHHHHHcccEEEcccccHHcccHHHHHHccccEEEcccccccccccHcccccccEEEccccccccccHHHHHHcccccEEEccccccccccHHHHHHHHcccEEEEccccccccccHccccccEEEEccccccccccccHcccccccEEEccccccEEccHHHHHHHHHHcccccccc
MALELFLQNSSKLKVLNISKNCLKmlpslnnenRYLEKLYLtsnaltdigplnkcrqlnTLHVAYNAITSLPDNCISAWSEMEELVLSgngisslpntipqswphlrVLRLhsnhltscptlylssslrVLDLSYNHlerlnlntlipkqlqyldvsgnprlhvdpnhfkSYRSYVRVYIQLV
MALELFLQNSSKLKVLNISKNCLKMLPSLNNENRYLEKLYLTSNALTDIGPLNKCRQLNTLHVAYNAITSLPDNCISAWSEMEELVLSGNGISSLPNTIPQSWPHLRVLRLHSNHLTSCPTLYLSSSLRVLDLSYNHLERLNLNTLIPKQLQYLDVSgnprlhvdpnhfksyrsYVRVYIQLV
MALELFLQNSSKLKVLNISKNCLKMLPSLNNENRYLEKLYLTSNALTDIGPLNKCRQLNTLHVAYNAITSLPDNCISAWSEMEELVLSGNGISSLPNTIPQSWPHLRVLRLHSNHLTSCPTLYLSSSLRVLDLSYNHLERLNLNTLIPKQLQYLDVSGNPRLHVDPNHFKSYRSYVRVYIQLV
*****FL***SKLKVLNISKNCLKMLPSLNNENRYLEKLYLTSNALTDIGPLNKCRQLNTLHVAYNAITSLPDNCISAWSEMEELVLSGNGISSLPNTIPQSWPHLRVLRLHSNHLTSCPTLYLSSSLRVLDLSYNHLERLNLNTLIPKQLQYLDVSGNPRLHVDPNHFKSYRSYVRVYIQ**
MALELFLQNSSKLKVLNISKNCLKMLPSLNNENRYLEKLYLTSNALTDIGPLNKCRQLNTLHVAYNAITSLPDNCISAWSEMEELVLSGNGISSLPNTIPQSWPHLRVLRLHSNHLTSCPTLYLSSSLRVLDLSYNHLERLNLNTLIPKQLQYLDVSGNPRLHVDPNHFKSYRSYVRVYIQLV
MALELFLQNSSKLKVLNISKNCLKMLPSLNNENRYLEKLYLTSNALTDIGPLNKCRQLNTLHVAYNAITSLPDNCISAWSEMEELVLSGNGISSLPNTIPQSWPHLRVLRLHSNHLTSCPTLYLSSSLRVLDLSYNHLERLNLNTLIPKQLQYLDVSGNPRLHVDPNHFKSYRSYVRVYIQLV
MALELFLQNSSKLKVLNISKNCLKMLPSLNNENRYLEKLYLTSNALTDIGPLNKCRQLNTLHVAYNAITSLPDNCISAWSEMEELVLSGNGISSLPNTIPQSWPHLRVLRLHSNHLTSCPTLYLSSSLRVLDLSYNHLERLNLNTLIPKQLQYLDVSGNPRLHVDPNHFKSYRSYVRVYIQLV
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALELFLQNSSKLKVLNISKNCLKMLPSLNNENRYLEKLYLTSNALTDIGPLNKCRQLNTLHVAYNAITSLPDNCISAWSEMEELVLSGNGISSLPNTIPQSWPHLRVLRLHSNHLTSCPTLYLSSSLRVLDLSYNHLERLNLNTLIPKQLQYLDVSGNPRLHVDPNHFKSYRSYVRVYIQLV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query183 2.2.26 [Sep-21-2011]
Q9VJ07 954 Protein phosphatase PHLPP yes N/A 0.972 0.186 0.420 4e-25
O60346 1717 PH domain leucine-rich re yes N/A 0.868 0.092 0.369 1e-17
Q9WTR8 1696 PH domain leucine-rich re yes N/A 0.868 0.093 0.357 3e-17
Q8CHE4 1687 PH domain leucine-rich re yes N/A 0.868 0.094 0.357 5e-17
Q8BXA7 1320 PH domain leucine-rich re no N/A 0.814 0.112 0.354 5e-12
A8JAM0 1159 Coiled-coil domain-contai N/A N/A 0.978 0.154 0.284 7e-09
P14605 1692 Adenylate cyclase OS=Schi yes N/A 0.879 0.095 0.323 2e-08
A6H6A4 596 Leucine-rich repeat and I no N/A 0.836 0.256 0.305 5e-08
Q6ZVD8 1323 PH domain leucine-rich re no N/A 0.568 0.078 0.333 1e-07
Q01513 2145 Adenylate cyclase OS=Podo yes N/A 0.683 0.058 0.309 1e-07
>sp|Q9VJ07|PHLPP_DROME Protein phosphatase PHLPP-like protein OS=Drosophila melanogaster GN=Phlpp PE=3 SV=1 Back     alignment and function desciption
 Score =  114 bits (285), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 77/183 (42%), Positives = 103/183 (56%), Gaps = 5/183 (2%)

Query: 5   LFLQNSSKLKVLNISKNCLKMLPSLNNENRY-LEKLYLTSNALTD--IGPLNKCRQLNTL 61
            F    ++L+ LN+S N L  LP     N   L  L L  N L D    PL+   +L  L
Sbjct: 224 FFAVTHARLETLNVSCNKLSTLPRYEQNNHAALVNLSLAGNHLNDSIFEPLHNAAKLRVL 283

Query: 62  HVAYNAITSLPDNCISAWSEMEELVLSGNGISSLPNTIPQSWPHLRVLRLHSNHLTSCPT 121
           H+AYN I  LP  C+  W E+E LVLSGN +  LP  +  +   LRVLR  +N L   P 
Sbjct: 284 HLAYNRIGVLPAACVRNWPELEILVLSGNMLQQLPEEVA-TLGQLRVLRCCNNLLLCTPQ 342

Query: 122 LYLSSSLRVLDLSYNHLERLNLNTLIP-KQLQYLDVSGNPRLHVDPNHFKSYRSYVRVYI 180
           L   + L+VLDLS+NHL+R+NL  L+P + L+YLD+SGN +L VD   FK  +S  + + 
Sbjct: 343 LAKLAMLKVLDLSHNHLDRVNLLALVPSRNLKYLDLSGNLQLQVDEQQFKVCQSQSQRHW 402

Query: 181 QLV 183
            LV
Sbjct: 403 SLV 405




Protein phosphatase that specifically mediates dephosphorylation of 'Ser-586' of Akt1, a protein that regulates the balance between cell survival and apoptosis through a cascade that primarily alters the function of transcription factors that regulate pro- and antiapoptotic genes. Dephosphorylation of 'Ser-586' of Akt1 triggers apoptosis and suppression of tumor growth.
Drosophila melanogaster (taxid: 7227)
EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 1EC: 6
>sp|O60346|PHLP1_HUMAN PH domain leucine-rich repeat-containing protein phosphatase 1 OS=Homo sapiens GN=PHLPP1 PE=1 SV=3 Back     alignment and function description
>sp|Q9WTR8|PHLP1_RAT PH domain leucine-rich repeat protein phosphatase 1 OS=Rattus norvegicus GN=Phlpp1 PE=1 SV=1 Back     alignment and function description
>sp|Q8CHE4|PHLP1_MOUSE PH domain leucine-rich repeat-containing protein phosphatase 1 OS=Mus musculus GN=Phlpp1 PE=2 SV=2 Back     alignment and function description
>sp|Q8BXA7|PHLP2_MOUSE PH domain leucine-rich repeat-containing protein phosphatase 2 OS=Mus musculus GN=Phlpp2 PE=2 SV=3 Back     alignment and function description
>sp|A8JAM0|CC135_CHLRE Coiled-coil domain-containing protein lobo homolog (Fragment) OS=Chlamydomonas reinhardtii GN=FAP50 PE=2 SV=1 Back     alignment and function description
>sp|P14605|CYAA_SCHPO Adenylate cyclase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cyr1 PE=1 SV=1 Back     alignment and function description
>sp|A6H6A4|LRIQ4_MOUSE Leucine-rich repeat and IQ domain-containing protein 4 OS=Mus musculus GN=Lrriq4 PE=2 SV=1 Back     alignment and function description
>sp|Q6ZVD8|PHLP2_HUMAN PH domain leucine-rich repeat-containing protein phosphatase 2 OS=Homo sapiens GN=PHLPP2 PE=1 SV=3 Back     alignment and function description
>sp|Q01513|CYAA_PODAS Adenylate cyclase OS=Podospora anserina PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query183
332030535 1100 Protein phosphatase PHLPP-like protein [ 0.918 0.152 0.514 7e-42
383864524 1740 PREDICTED: PH domain leucine-rich repeat 0.918 0.096 0.525 9e-42
307181024 1097 Protein phosphatase PHLPP-like protein [ 0.918 0.153 0.514 1e-41
307200228 1111 Protein phosphatase PHLPP-like protein [ 0.918 0.151 0.514 3e-41
340729082 1784 PREDICTED: PH domain leucine-rich repeat 0.918 0.094 0.525 4e-41
350401465 1824 PREDICTED: PH domain leucine-rich repeat 0.918 0.092 0.514 6e-41
380013691 1109 PREDICTED: protein phosphatase PHLPP-lik 0.918 0.151 0.519 2e-40
328788656 1746 PREDICTED: PH domain leucine-rich repeat 0.918 0.096 0.514 4e-40
345483572 1444 PREDICTED: protein phosphatase PHLPP-lik 0.934 0.118 0.494 9e-34
170055945 1002 adenylate cyclase [Culex quinquefasciatu 0.928 0.169 0.479 2e-33
>gi|332030535|gb|EGI70223.1| Protein phosphatase PHLPP-like protein [Acromyrmex echinatior] Back     alignment and taxonomy information
 Score =  175 bits (443), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 91/177 (51%), Positives = 125/177 (70%), Gaps = 9/177 (5%)

Query: 6   FLQNSSKLKVLNISKNCLKMLP------SLNNENRYLEKLYLTSNALTD--IGPLNKCRQ 57
           F  N+ K+KVLN+S N L  LP       ++  +  LEKLY+T+N LTD  +  L K   
Sbjct: 362 FFTNTEKMKVLNLSNNRLSELPYREEAGKIHQGSHTLEKLYITANCLTDTALDALAKFTS 421

Query: 58  LNTLHVAYNAITSLPDNCISAWSEMEELVLSGNGISSLPNTIPQSWPHLRVLRLHSNHLT 117
           L  LH+AYN + +LP++CI+AWS++EELVLSGN +  LP+ +  +  HLRVLR+HSN L 
Sbjct: 422 LRILHIAYNTLDTLPESCIAAWSDLEELVLSGNRLQYLPDNV-ANLRHLRVLRVHSNRLL 480

Query: 118 SCPTLYLSSSLRVLDLSYNHLERLNLNTLIPKQLQYLDVSGNPRLHVDPNHFKSYRS 174
           +CPT   ++SL+VLDL++N L+R+NL TL+P QLQ+LD+S N RLHVDP  F+ YRS
Sbjct: 481 TCPTFSRTASLKVLDLAHNQLDRVNLATLVPPQLQFLDISCNSRLHVDPRQFQDYRS 537




Source: Acromyrmex echinatior

Species: Acromyrmex echinatior

Genus: Acromyrmex

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|383864524|ref|XP_003707728.1| PREDICTED: PH domain leucine-rich repeat-containing protein phosphatase 1-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|307181024|gb|EFN68798.1| Protein phosphatase PHLPP-like protein [Camponotus floridanus] Back     alignment and taxonomy information
>gi|307200228|gb|EFN80522.1| Protein phosphatase PHLPP-like protein [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|340729082|ref|XP_003402837.1| PREDICTED: PH domain leucine-rich repeat-containing protein phosphatase 2-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350401465|ref|XP_003486161.1| PREDICTED: PH domain leucine-rich repeat-containing protein phosphatase 2-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|380013691|ref|XP_003690883.1| PREDICTED: protein phosphatase PHLPP-like protein-like [Apis florea] Back     alignment and taxonomy information
>gi|328788656|ref|XP_394402.4| PREDICTED: PH domain leucine-rich repeat-containing protein phosphatase 1 [Apis mellifera] Back     alignment and taxonomy information
>gi|345483572|ref|XP_001602236.2| PREDICTED: protein phosphatase PHLPP-like protein-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|170055945|ref|XP_001863809.1| adenylate cyclase [Culex quinquefasciatus] gi|167875777|gb|EDS39160.1| adenylate cyclase [Culex quinquefasciatus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query183
FB|FBgn0032749 954 Phlpp "PH domain leucine-rich 0.967 0.185 0.423 1.3e-26
UNIPROTKB|G3N2B1 1176 PHLPP1 "Uncharacterized protei 0.863 0.134 0.371 6e-20
UNIPROTKB|F1P1I2 1175 PHLPP1 "Uncharacterized protei 0.863 0.134 0.371 7.6e-20
UNIPROTKB|F1NJB8 1181 PHLPP1 "Uncharacterized protei 0.863 0.133 0.371 7.7e-20
UNIPROTKB|O60346 1717 PHLPP1 "PH domain leucine-rich 0.863 0.092 0.371 1.6e-19
UNIPROTKB|F1SMW1 1192 PHLPP1 "Uncharacterized protei 0.863 0.132 0.365 2.1e-19
UNIPROTKB|F1PVE1 1388 PHLPP1 "Uncharacterized protei 0.863 0.113 0.365 2.5e-19
UNIPROTKB|D4A5N5 1685 Phlpp1 "PH domain leucine-rich 0.863 0.093 0.359 5.3e-19
RGD|621308 1696 Phlpp1 "PH domain and leucine 0.863 0.093 0.359 5.4e-19
UNIPROTKB|Q9WTR8 1696 Phlpp1 "PH domain leucine-rich 0.863 0.093 0.359 5.4e-19
FB|FBgn0032749 Phlpp "PH domain leucine-rich repeat protein phosphatase" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 311 (114.5 bits), Expect = 1.3e-26, P = 1.3e-26
 Identities = 77/182 (42%), Positives = 103/182 (56%)

Query:     6 FLQNSSKLKVLNISKNCLKMLPSLNNENRY-LEKLYLTSNALTD--IGPLNKCRQLNTLH 62
             F    ++L+ LN+S N L  LP     N   L  L L  N L D    PL+   +L  LH
Sbjct:   225 FAVTHARLETLNVSCNKLSTLPRYEQNNHAALVNLSLAGNHLNDSIFEPLHNAAKLRVLH 284

Query:    63 VAYNAITSLPDNCISAWSEMEELVLSGNGISSLPNTIPQSWPHLRVLRLHSNHLTSCPTL 122
             +AYN I  LP  C+  W E+E LVLSGN +  LP  +  +   LRVLR  +N L   P L
Sbjct:   285 LAYNRIGVLPAACVRNWPELEILVLSGNMLQQLPEEVA-TLGQLRVLRCCNNLLLCTPQL 343

Query:   123 YLSSSLRVLDLSYNHLERLNLNTLIP-KQLQYLDVSGNPRLHVDPNHFKSYRSYVRVYIQ 181
                + L+VLDLS+NHL+R+NL  L+P + L+YLD+SGN +L VD   FK  +S  + +  
Sbjct:   344 AKLAMLKVLDLSHNHLDRVNLLALVPSRNLKYLDLSGNLQLQVDEQQFKVCQSQSQRHWS 403

Query:   182 LV 183
             LV
Sbjct:   404 LV 405




GO:0006470 "protein dephosphorylation" evidence=IMP;NAS
GO:0004722 "protein serine/threonine phosphatase activity" evidence=IMP;NAS
GO:0005575 "cellular_component" evidence=ND
UNIPROTKB|G3N2B1 PHLPP1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1P1I2 PHLPP1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NJB8 PHLPP1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|O60346 PHLPP1 "PH domain leucine-rich repeat-containing protein phosphatase 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SMW1 PHLPP1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1PVE1 PHLPP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|D4A5N5 Phlpp1 "PH domain leucine-rich repeat protein phosphatase 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
RGD|621308 Phlpp1 "PH domain and leucine rich repeat protein phosphatase 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q9WTR8 Phlpp1 "PH domain leucine-rich repeat protein phosphatase 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query183
PRK15370 754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 2e-08
PRK15370 754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 8e-08
PRK15387 788 PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss 7e-07
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 4e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 7e-05
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-04
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 9e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.001
PRK15387 788 PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss 0.002
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.002
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.004
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 0.004
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
 Score = 52.8 bits (126), Expect = 2e-08
 Identities = 52/167 (31%), Positives = 76/167 (45%), Gaps = 29/167 (17%)

Query: 12  KLKVLNISKNCLKMLPSLNNENRYLEKLYLTSNALTDIGPLNKCRQLNTLHVAYNAITSL 71
           ++  L +  N LK LP   N    ++ LY  SN LT I P      +  + ++ N IT L
Sbjct: 200 QITTLILDNNELKSLPE--NLQGNIKTLYANSNQLTSI-PATLPDTIQEMELSINRITEL 256

Query: 72  PDNCISAWSEMEELVLSGNGISSLPNTIPQSWPHLRVLRLHSNHLTSCPTLYLSSSLRVL 131
           P+   SA   ++ L L  N IS LP  +P+    LR L ++ N + + P  +L S +  L
Sbjct: 257 PERLPSA---LQSLDLFHNKISCLPENLPEE---LRYLSVYDNSIRTLPA-HLPSGITHL 309

Query: 132 DLSYNHLERL------NLNTL-------------IPKQLQYLDVSGN 159
           ++  N L  L       L TL             +P +LQ LDVS N
Sbjct: 310 NVQSNSLTALPETLPPGLKTLEAGENALTSLPASLPPELQVLDVSKN 356


Length = 754

>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 183
KOG4194|consensus 873 99.82
KOG4194|consensus 873 99.82
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.79
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.79
KOG0617|consensus264 99.74
KOG0618|consensus 1081 99.68
KOG0444|consensus 1255 99.66
KOG0444|consensus 1255 99.63
KOG0472|consensus 565 99.61
KOG0472|consensus 565 99.58
KOG0617|consensus264 99.58
KOG4237|consensus 498 99.56
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.51
KOG4237|consensus 498 99.49
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.47
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.47
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.44
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.44
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.44
KOG0618|consensus 1081 99.42
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.4
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.4
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.35
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 99.35
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.31
KOG1909|consensus382 99.25
KOG3207|consensus 505 99.21
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.19
KOG0532|consensus 722 99.16
KOG1259|consensus490 99.14
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 99.13
KOG0532|consensus 722 99.12
KOG1259|consensus490 99.06
KOG0531|consensus 414 99.05
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 99.03
KOG3207|consensus 505 98.94
KOG0531|consensus 414 98.87
PLN03150623 hypothetical protein; Provisional 98.86
KOG1909|consensus382 98.8
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 98.74
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.72
KOG1859|consensus 1096 98.71
KOG1644|consensus233 98.71
PLN03150623 hypothetical protein; Provisional 98.69
KOG4579|consensus177 98.68
KOG1859|consensus 1096 98.59
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 98.48
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.48
KOG1644|consensus233 98.45
KOG2120|consensus419 98.4
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.4
KOG2982|consensus 418 98.39
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.26
KOG2982|consensus 418 98.19
KOG2120|consensus419 98.13
KOG4658|consensus 889 98.12
KOG4658|consensus 889 98.09
KOG3665|consensus 699 98.09
KOG4579|consensus177 97.97
PRK15386 426 type III secretion protein GogB; Provisional 97.78
PRK15386 426 type III secretion protein GogB; Provisional 97.76
KOG3665|consensus 699 97.75
KOG2123|consensus 388 97.73
KOG2123|consensus 388 97.65
KOG2739|consensus260 97.56
KOG2739|consensus 260 96.76
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.65
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 95.73
KOG4341|consensus483 95.55
KOG3864|consensus221 95.02
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 94.39
smart0037026 LRR Leucine-rich repeats, outliers. 94.39
KOG4308|consensus 478 93.49
KOG1947|consensus 482 91.0
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 89.21
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 87.76
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 85.82
KOG3864|consensus221 85.63
KOG3763|consensus 585 84.29
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 84.06
KOG1947|consensus482 81.85
>KOG4194|consensus Back     alignment and domain information
Probab=99.82  E-value=4.6e-21  Score=141.84  Aligned_cols=173  Identities=25%  Similarity=0.352  Sum_probs=75.1

Q ss_pred             cCCCCcEEEccCCcCCCcc-ccccccccccEEEccCCCCCCC--CCCCCCCCCCEEeeCCccccccCcccccCCCCCcEE
Q psy13911          9 NSSKLKVLNISKNCLKMLP-SLNNENRYLEKLYLTSNALTDI--GPLNKCRQLNTLHVAYNAITSLPDNCISAWSEMEEL   85 (183)
Q Consensus         9 ~~~~L~~l~l~~~~~~~~~-~~~~~~~~L~~L~l~~~~~~~~--~~~~~l~~L~~l~l~~~~~~~~~~~~~~~~~~L~~l   85 (183)
                      ..+.|+.+|++.|.++.++ +.|..-.++++|++++|+|+.+  +.|..+.+|..|.++.|.++.++...|.+++.|+.|
T Consensus       147 ~l~alrslDLSrN~is~i~~~sfp~~~ni~~L~La~N~It~l~~~~F~~lnsL~tlkLsrNrittLp~r~Fk~L~~L~~L  226 (873)
T KOG4194|consen  147 ALPALRSLDLSRNLISEIPKPSFPAKVNIKKLNLASNRITTLETGHFDSLNSLLTLKLSRNRITTLPQRSFKRLPKLESL  226 (873)
T ss_pred             hHhhhhhhhhhhchhhcccCCCCCCCCCceEEeeccccccccccccccccchheeeecccCcccccCHHHhhhcchhhhh
Confidence            3334444444444444443 3333334444444444444444  344444444444444444444444444444444444


Q ss_pred             EecCCcCccCCCCCCCCCCCccEEEeeCCcCCCCC--CccCCCcccEEeccCcccccccCCCCCC-CCccEEEcCCCCce
Q psy13911         86 VLSGNGISSLPNTIPQSWPHLRVLRLHSNHLTSCP--TLYLSSSLRVLDLSYNHLERLNLNTLIP-KQLQYLDVSGNPRL  162 (183)
Q Consensus        86 ~l~~~~l~~~~~~~~~~~~~L~~L~l~~~~~~~~~--~~~~~~~L~~l~l~~n~l~~~~~~~~~~-~~l~~l~l~~n~~~  162 (183)
                      ++..|+++.+....|+++++|+.+.+.+|.+..+.  .|..+.+++++++..|.++.+...++.. +.|+.|++++|.+.
T Consensus       227 dLnrN~irive~ltFqgL~Sl~nlklqrN~I~kL~DG~Fy~l~kme~l~L~~N~l~~vn~g~lfgLt~L~~L~lS~NaI~  306 (873)
T KOG4194|consen  227 DLNRNRIRIVEGLTFQGLPSLQNLKLQRNDISKLDDGAFYGLEKMEHLNLETNRLQAVNEGWLFGLTSLEQLDLSYNAIQ  306 (873)
T ss_pred             hccccceeeehhhhhcCchhhhhhhhhhcCcccccCcceeeecccceeecccchhhhhhcccccccchhhhhccchhhhh
Confidence            44443333222222222222222222222222221  2444445555555555555444333333 55555555555555


Q ss_pred             eeCCCCcCCCcceeEEEEE
Q psy13911        163 HVDPNHFKSYRSYVRVYIQ  181 (183)
Q Consensus       163 ~~~~~~~~~~~~l~~l~l~  181 (183)
                      .+.+..+..+++|+.|+|+
T Consensus       307 rih~d~WsftqkL~~LdLs  325 (873)
T KOG4194|consen  307 RIHIDSWSFTQKLKELDLS  325 (873)
T ss_pred             eeecchhhhcccceeEecc
Confidence            5555555555555555543



>KOG4194|consensus Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0617|consensus Back     alignment and domain information
>KOG0618|consensus Back     alignment and domain information
>KOG0444|consensus Back     alignment and domain information
>KOG0444|consensus Back     alignment and domain information
>KOG0472|consensus Back     alignment and domain information
>KOG0472|consensus Back     alignment and domain information
>KOG0617|consensus Back     alignment and domain information
>KOG4237|consensus Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237|consensus Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0618|consensus Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG1909|consensus Back     alignment and domain information
>KOG3207|consensus Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532|consensus Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0532|consensus Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>KOG0531|consensus Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG3207|consensus Back     alignment and domain information
>KOG0531|consensus Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1909|consensus Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1859|consensus Back     alignment and domain information
>KOG1644|consensus Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG4579|consensus Back     alignment and domain information
>KOG1859|consensus Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1644|consensus Back     alignment and domain information
>KOG2120|consensus Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG2982|consensus Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2982|consensus Back     alignment and domain information
>KOG2120|consensus Back     alignment and domain information
>KOG4658|consensus Back     alignment and domain information
>KOG4658|consensus Back     alignment and domain information
>KOG3665|consensus Back     alignment and domain information
>KOG4579|consensus Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665|consensus Back     alignment and domain information
>KOG2123|consensus Back     alignment and domain information
>KOG2123|consensus Back     alignment and domain information
>KOG2739|consensus Back     alignment and domain information
>KOG2739|consensus Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG4341|consensus Back     alignment and domain information
>KOG3864|consensus Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG4308|consensus Back     alignment and domain information
>KOG1947|consensus Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>KOG3864|consensus Back     alignment and domain information
>KOG3763|consensus Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>KOG1947|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query183
2o6s_A208 Structural Diversity Of The Hagfish Variable Lympho 1e-07
1g9u_A 454 Crystal Structure Of Yopm-leucine Rich Effector Pro 1e-07
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 3e-07
3zyj_A 440 Netring1 In Complex With Ngl1 Length = 440 5e-07
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 9e-07
3m19_A251 Crystal Structure Of Variable Lymphocyte Receptor V 2e-06
3m18_A251 Crystal Structure Of Variable Lymphocyte Receptor V 2e-06
3zyn_A 321 Crystal Structure Of The N-Terminal Leucine Rich Re 7e-06
3rfj_A279 Design Of A Binding Scaffold Based On Variable Lymp 8e-06
3zyo_A 411 Crystal Structure Of The N-Terminal Leucine Rich Re 1e-05
3p72_A269 Structure Of Platelet Glycoprotein 1b Alpha With A 2e-05
1u0n_D265 The Ternary Von Willebrand Factor A1-Glycoprotein I 2e-05
3kj4_A286 Structure Of Rat Nogo Receptor Bound To 1d9 Antagon 2e-05
1m0z_A290 Crystal Structure Of The Von Willebrand Factor Bind 2e-05
1m10_B290 Crystal Structure Of The Complex Of Glycoprotein Ib 2e-05
1p8v_A279 Crystal Structure Of The Complex Of Platelet Recept 2e-05
1gwb_B281 Structure Of Glycoprotein 1b Length = 281 3e-05
1p9a_G290 Crystal Structure Of N-terminal Domain Of Human Pla 3e-05
1ook_G290 Crystal Structure Of The Complex Of Platelet Recept 3e-05
3pmh_G290 Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib 3e-05
1sq0_B288 Crystal Structure Of The Complex Of The Wild-Type V 3e-05
3zyi_A 452 Netring2 In Complex With Ngl2 Length = 452 6e-05
1p8t_A285 Crystal Structure Of Nogo-66 Receptor Length = 285 8e-05
1ozn_A285 1.5a Crystal Structure Of The Nogo Receptor Ligand 1e-04
3g06_A 622 The Salmonella Virulence Effector Ssph2 Functions A 2e-04
2o6r_A177 Structural Diversity Of The Hagfish Variable Lympho 2e-04
3o6n_A 390 Crystal Structure Of Apl1 Leucine-Rich Repeat Domai 2e-04
3oja_B 597 Crystal Structure Of Lrim1APL1C COMPLEX Length = 59 2e-04
>pdb|2O6S|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B59 Length = 208 Back     alignment and structure

Iteration: 1

Score = 52.8 bits (125), Expect = 1e-07, Method: Compositional matrix adjust. Identities = 37/108 (34%), Positives = 58/108 (53%), Gaps = 3/108 (2%) Query: 16 LNISKNCLKMLP-SLNNENRYLEKLYLTSNALTDI--GPLNKCRQLNTLHVAYNAITSLP 72 L++ N LK LP + +E L +LYL N L + G NK L L+++ N + SLP Sbjct: 33 LDLETNSLKSLPNGVFDELTSLTQLYLGGNKLQSLPNGVFNKLTSLTYLNLSTNQLQSLP 92 Query: 73 DNCISAWSEMEELVLSGNGISSLPNTIPQSWPHLRVLRLHSNHLTSCP 120 + ++++EL L+ N + SLP+ + L+ LRL+ N L S P Sbjct: 93 NGVFDKLTQLKELALNTNQLQSLPDGVFDKLTQLKDLRLYQNQLKSVP 140
>pdb|1G9U|A Chain A, Crystal Structure Of Yopm-leucine Rich Effector Protein From Yersinia Pestis Length = 454 Back     alignment and structure
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure
>pdb|3ZYJ|A Chain A, Netring1 In Complex With Ngl1 Length = 440 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|3M19|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R5.1 Length = 251 Back     alignment and structure
>pdb|3M18|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R2.1 In Complex With Hen Egg Lysozyme Length = 251 Back     alignment and structure
>pdb|3ZYN|A Chain A, Crystal Structure Of The N-Terminal Leucine Rich Repeats Of Netrin-G Ligand-3 Length = 321 Back     alignment and structure
>pdb|3RFJ|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 279 Back     alignment and structure
>pdb|3ZYO|A Chain A, Crystal Structure Of The N-Terminal Leucine Rich Repeats And Immunoglobulin Domain Of Netrin-G Ligand-3 Length = 411 Back     alignment and structure
>pdb|3P72|A Chain A, Structure Of Platelet Glycoprotein 1b Alpha With A Bound Peptide Inhibitor Length = 269 Back     alignment and structure
>pdb|1U0N|D Chain D, The Ternary Von Willebrand Factor A1-Glycoprotein Ibalpha- Botrocetin Complex Length = 265 Back     alignment and structure
>pdb|3KJ4|A Chain A, Structure Of Rat Nogo Receptor Bound To 1d9 Antagonist Antibody Length = 286 Back     alignment and structure
>pdb|1M0Z|A Chain A, Crystal Structure Of The Von Willebrand Factor Binding Domain Of Glycoprotein Ib Alpha Length = 290 Back     alignment and structure
>pdb|1M10|B Chain B, Crystal Structure Of The Complex Of Glycoprotein Ib Alpha And The Von Willebrand Factor A1 Domain Length = 290 Back     alignment and structure
>pdb|1P8V|A Chain A, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Alpha-thrombin At 2.6a Length = 279 Back     alignment and structure
>pdb|1GWB|B Chain B, Structure Of Glycoprotein 1b Length = 281 Back     alignment and structure
>pdb|1P9A|G Chain G, Crystal Structure Of N-terminal Domain Of Human Platelet Receptor Glycoprotein Ib-alpha At 1.7 Angstrom Resolution Length = 290 Back     alignment and structure
>pdb|1OOK|G Chain G, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Human Alpha-thrombin Length = 290 Back     alignment and structure
>pdb|3PMH|G Chain G, Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib Interaction With Two Distinct Alpha-Thrombin Sites Length = 290 Back     alignment and structure
>pdb|1SQ0|B Chain B, Crystal Structure Of The Complex Of The Wild-Type Von Willebrand Factor A1 Domain And Glycoprotein Ib Alpha At 2.6 Angstrom Resolution Length = 288 Back     alignment and structure
>pdb|3ZYI|A Chain A, Netring2 In Complex With Ngl2 Length = 452 Back     alignment and structure
>pdb|1P8T|A Chain A, Crystal Structure Of Nogo-66 Receptor Length = 285 Back     alignment and structure
>pdb|1OZN|A Chain A, 1.5a Crystal Structure Of The Nogo Receptor Ligand Binding Domain Reveals A Convergent Recognition Scaffold Mediating Inhibition Of Myelination Length = 285 Back     alignment and structure
>pdb|3G06|A Chain A, The Salmonella Virulence Effector Ssph2 Functions As A Novel E3 Ligase Length = 622 Back     alignment and structure
>pdb|2O6R|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B61 Length = 177 Back     alignment and structure
>pdb|3O6N|A Chain A, Crystal Structure Of Apl1 Leucine-Rich Repeat Domain Length = 390 Back     alignment and structure
>pdb|3OJA|B Chain B, Crystal Structure Of Lrim1APL1C COMPLEX Length = 597 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query183
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-22
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-18
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 8e-17
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 2e-15
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-09
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 8e-04
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-20
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-19
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-19
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-18
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-17
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 8e-16
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-10
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-08
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-06
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-20
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-17
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-17
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-15
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-14
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-09
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-20
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-19
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-17
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-17
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-14
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-07
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-20
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-17
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-16
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 8e-15
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-20
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-14
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-13
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-07
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 9e-20
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-19
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-16
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-16
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-16
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-15
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-15
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-14
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-13
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-13
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-12
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-06
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-19
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-16
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-16
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-12
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-12
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-19
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-16
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 3e-15
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 4e-13
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-19
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-17
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-14
1o6v_A 466 Internalin A; bacterial infection, extracellular r 8e-19
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-17
1o6v_A 466 Internalin A; bacterial infection, extracellular r 9e-15
1o6v_A 466 Internalin A; bacterial infection, extracellular r 3e-14
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-13
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-13
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-12
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-19
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-17
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-16
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 9e-16
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-13
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-11
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-10
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-09
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-05
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 9e-19
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 4e-17
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 5e-17
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-18
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 5e-17
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 8e-17
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-15
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-18
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-18
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-18
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-18
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-16
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-16
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-15
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 7e-15
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-14
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-12
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-11
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-11
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 6e-07
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-18
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-17
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-17
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-16
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-14
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-13
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-11
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-09
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-06
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-18
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-17
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-17
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-17
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-16
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 2e-15
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 1e-14
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 3e-14
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-13
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 9e-18
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 7e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-07
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-08
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-17
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-17
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-16
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-16
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-16
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-11
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-09
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-07
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-07
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-17
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 6e-17
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-13
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-12
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-17
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-14
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-14
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-14
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-14
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-10
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-08
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-07
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-05
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-04
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-17
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-16
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-16
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-13
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-12
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-12
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-06
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-17
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-16
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-14
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-14
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-13
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-12
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-09
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-09
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-08
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 9e-17
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 2e-12
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 8e-10
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 9e-17
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-16
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-15
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-13
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-10
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-08
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-07
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 8e-05
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-04
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-16
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-15
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-06
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-16
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-15
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-15
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-14
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-14
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-13
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-13
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-12
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-11
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-11
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-16
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-11
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-09
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-09
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-07
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-06
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 6e-16
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-15
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-14
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-12
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 4e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 9e-16
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 9e-10
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-15
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 5e-13
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-12
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-11
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-11
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 9e-10
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 9e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-15
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-12
1xeu_A 263 Internalin C; cellular invasion, leucine-rich repe 9e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-15
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-14
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 2e-14
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 4e-14
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-09
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 2e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-15
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-14
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-13
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-09
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-15
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 2e-10
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 3e-10
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-09
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 9e-06
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-10
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-06
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-05
1wwl_A 312 Monocyte differentiation antigen CD14; LPS, immune 4e-04
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-14
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-09
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-08
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-08
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-06
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-04
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-14
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-14
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 9e-14
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-13
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-12
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-12
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-11
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-14
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-14
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-11
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 7e-06
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-14
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-13
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-12
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-12
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 8e-12
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-11
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-11
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-11
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 8e-10
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-07
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-06
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-13
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 4e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-13
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-13
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-13
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-12
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-08
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-08
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-08
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-13
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-10
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-10
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-06
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-13
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 9e-13
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-11
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-12
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-11
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-06
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 4e-12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-10
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 2e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-11
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-10
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 5e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 7e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-04
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 7e-10
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 3e-07
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 5e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-09
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-07
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-06
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 4e-09
1w8a_A192 SLIT protein; signaling protein, secreted protein, 7e-09
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-08
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 5e-08
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-07
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-07
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 7e-06
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-05
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 4e-08
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-07
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 5e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 5e-07
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-04
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-07
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 7e-07
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 7e-06
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 3e-06
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 8e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-05
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 2e-04
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
 Score = 90.9 bits (226), Expect = 4e-22
 Identities = 41/155 (26%), Positives = 63/155 (40%), Gaps = 6/155 (3%)

Query: 7   LQNSSKLKVLNISKNCLKMLPSLNNENRYLEKLYLTSNALTDIGPLNKCRQLNTLHVAYN 66
           L     ++ L+ S N + ++    N    L  L L  N LTD   L     L  + ++YN
Sbjct: 201 LAIPIAVEELDASHNSINVVRGPVNVE--LTILKLQHNNLTDTAWLLNYPGLVEVDLSYN 258

Query: 67  AITSLPDNCISAWSEMEELVLSGNGISSLPNTIPQSWPHLRVLRLHSNHLTSCP-TLYLS 125
            +  +  +       +E L +S N + +L     Q  P L+VL L  NHL          
Sbjct: 259 ELEKIMYHPFVKMQRLERLYISNNRLVALNLYG-QPIPTLKVLDLSHNHLLHVERNQPQF 317

Query: 126 SSLRVLDLSYNHLERLNLNTLIPKQLQYLDVSGNP 160
             L  L L +N +  L L+T     L+ L +S N 
Sbjct: 318 DRLENLYLDHNSIVTLKLSTH--HTLKNLTLSHND 350


>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Length = 267 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query183
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.94
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.93
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.93
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.93
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.93
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.92
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.92
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.92
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.91
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.91
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.91
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.91
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.91
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.91
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.9
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.9
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.9
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.9
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.9
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.9
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.89
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.89
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.89
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.89
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 99.89
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.89
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.89
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.88
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.88
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.88
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.88
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 99.88
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.88
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 99.88
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.88
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.88
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.88
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 99.87
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.87
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.87
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 99.87
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.87
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 99.87
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.87
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.87
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.87
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.86
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.86
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.86
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.86
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.86
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.86
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.86
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.86
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.86
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.86
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.86
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.86
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.86
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.86
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.86
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.86
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.85
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.85
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.85
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.85
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.85
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.85
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.84
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.84
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.84
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.84
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.84
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.84
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.84
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.84
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.83
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.83
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.83
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.83
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.83
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.82
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.82
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.82
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.82
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.82
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.81
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.81
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 99.81
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.81
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.8
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.8
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.8
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.8
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.79
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.79
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.79
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.79
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.78
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.78
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.78
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.78
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 99.77
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.76
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.75
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.74
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.74
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.73
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.72
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.71
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.71
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.71
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.7
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.7
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.7
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.69
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.68
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.68
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.67
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 99.67
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.67
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.66
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.65
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.65
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.64
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.63
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.62
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.6
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.6
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.59
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.58
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.56
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.55
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.54
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.53
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.52
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.51
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.48
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.42
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.35
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.34
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.29
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.23
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.17
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.16
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.15
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.06
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.01
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.0
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.97
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.96
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.95
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.89
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.74
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.65
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.55
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.44
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.29
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.26
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.24
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.3
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.25
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.24
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.05
2lz0_A100 Uncharacterized protein; hypothetical leucine rich 92.25
2lz0_A100 Uncharacterized protein; hypothetical leucine rich 91.35
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
Probab=99.94  E-value=1.7e-24  Score=151.69  Aligned_cols=171  Identities=29%  Similarity=0.368  Sum_probs=149.7

Q ss_pred             CCCcEEEccCCcCCCcc-ccccccccccEEEccCCCCCCC--CCCCCCCCCCEEeeCCccccccCcccccCCCCCcEEEe
Q psy13911         11 SKLKVLNISKNCLKMLP-SLNNENRYLEKLYLTSNALTDI--GPLNKCRQLNTLHVAYNAITSLPDNCISAWSEMEELVL   87 (183)
Q Consensus        11 ~~L~~l~l~~~~~~~~~-~~~~~~~~L~~L~l~~~~~~~~--~~~~~l~~L~~l~l~~~~~~~~~~~~~~~~~~L~~l~l   87 (183)
                      +.++.|++++|.+..++ ..+..+++|+.|++++|.++.+  ..+..+++|++|++++|.+..+++..+..+++|++|++
T Consensus        37 ~~l~~L~l~~n~l~~~~~~~~~~l~~L~~L~l~~n~l~~i~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~l  116 (270)
T 2o6q_A           37 ADTKKLDLQSNKLSSLPSKAFHRLTKLRLLYLNDNKLQTLPAGIFKELKNLETLWVTDNKLQALPIGVFDQLVNLAELRL  116 (270)
T ss_dssp             TTCSEEECCSSCCSCCCTTSSSSCTTCCEEECCSSCCSCCCTTTTSSCTTCCEEECCSSCCCCCCTTTTTTCSSCCEEEC
T ss_pred             CCCCEEECcCCCCCeeCHHHhcCCCCCCEEECCCCccCeeChhhhcCCCCCCEEECCCCcCCcCCHhHcccccCCCEEEC
Confidence            46899999999998877 5788899999999999998887  44678999999999999999888887888999999999


Q ss_pred             cCCcCccCCCCCCCCCCCccEEEeeCCcCCCCCC--ccCCCcccEEeccCcccccccCCCCCC-CCccEEEcCCCCceee
Q psy13911         88 SGNGISSLPNTIPQSWPHLRVLRLHSNHLTSCPT--LYLSSSLRVLDLSYNHLERLNLNTLIP-KQLQYLDVSGNPRLHV  164 (183)
Q Consensus        88 ~~~~l~~~~~~~~~~~~~L~~L~l~~~~~~~~~~--~~~~~~L~~l~l~~n~l~~~~~~~~~~-~~l~~l~l~~n~~~~~  164 (183)
                      .+|.++.++...+..+++|+.|++++|.+++++.  +..+++|+.|++++|.+++++...+.. ++|++|++++|.++.+
T Consensus       117 ~~n~l~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~N~l~~~  196 (270)
T 2o6q_A          117 DRNQLKSLPPRVFDSLTKLTYLSLGYNELQSLPKGVFDKLTSLKELRLYNNQLKRVPEGAFDKLTELKTLKLDNNQLKRV  196 (270)
T ss_dssp             CSSCCCCCCTTTTTTCTTCCEEECCSSCCCCCCTTTTTTCTTCCEEECCSSCCSCCCTTTTTTCTTCCEEECCSSCCSCC
T ss_pred             CCCccCeeCHHHhCcCcCCCEEECCCCcCCccCHhHccCCcccceeEecCCcCcEeChhHhccCCCcCEEECCCCcCCcC
Confidence            9999998888777788999999999999988764  778899999999999999988776654 8999999999999998


Q ss_pred             CCCCcCCCcceeEEEEE
Q psy13911        165 DPNHFKSYRSYVRVYIQ  181 (183)
Q Consensus       165 ~~~~~~~~~~l~~l~l~  181 (183)
                      ++..+..+++|+.|+++
T Consensus       197 ~~~~~~~l~~L~~L~l~  213 (270)
T 2o6q_A          197 PEGAFDSLEKLKMLQLQ  213 (270)
T ss_dssp             CTTTTTTCTTCCEEECC
T ss_pred             CHHHhccccCCCEEEec
Confidence            88889999999998874



>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>2lz0_A Uncharacterized protein; hypothetical leucine rich repeat protein, structural genomic unknown function; NMR {Bacteroides capillosus} Back     alignment and structure
>2lz0_A Uncharacterized protein; hypothetical leucine rich repeat protein, structural genomic unknown function; NMR {Bacteroides capillosus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 183
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-10
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-05
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 1e-07
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-07
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-07
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-04
d1jl5a_ 353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.001
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 6e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.002
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 6e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 0.003
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.003
d2ca6a1 344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.003
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
 Score = 55.4 bits (132), Expect = 4e-10
 Identities = 34/173 (19%), Positives = 69/173 (39%), Gaps = 26/173 (15%)

Query: 8   QNSSKLKVLNISKNCLKMLPSLNNENRYLEKLYLTSNALTDIGPLNKCRQLNTLHVAYNA 67
              + L  L+++ N LK + +L +    L  L L +N ++++ PL+   +L  L +  N 
Sbjct: 216 GILTNLDELSLNGNQLKDIGTLAS-LTNLTDLDLANNQISNLAPLSGLTKLTELKLGANQ 274

Query: 68  ITSLPD--------------------NCISAWSEMEELVLSGNGISSLPNTIPQSWPHLR 107
           I+++                      + IS    +  L L  N IS +      S   L+
Sbjct: 275 ISNISPLAGLTALTNLELNENQLEDISPISNLKNLTYLTLYFNNISDISPV--SSLTKLQ 332

Query: 108 VLRLHSNHLTSCPTLYLSSSLRVLDLSYNHLERL-NLNTLIPKQLQYLDVSGN 159
            L   +N ++   +L   +++  L   +N +  L  L  L   ++  L ++  
Sbjct: 333 RLFFANNKVSDVSSLANLTNINWLSAGHNQISDLTPLANL--TRITQLGLNDQ 383


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query183
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.9
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.88
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.87
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.87
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.86
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.85
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.83
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.81
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.81
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.8
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.79
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.78
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.78
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.77
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.75
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.74
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.74
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.73
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.72
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.72
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.69
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.68
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.66
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.63
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.53
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.48
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.45
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.41
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 99.4
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.37
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.25
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 99.22
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.17
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.07
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.74
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.45
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.35
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.33
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.82
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.82
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.26
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.96
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: von Willebrand factor binding domain of glycoprotein Ib alpha
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.90  E-value=1.1e-22  Score=140.46  Aligned_cols=169  Identities=24%  Similarity=0.257  Sum_probs=138.1

Q ss_pred             CCCcEEEccCCcCCCcc-ccccccccccEEEccCCCCCCCCCCCCCCCCCEEeeCCccccccCcccccCCCCCcEEEecC
Q psy13911         11 SKLKVLNISKNCLKMLP-SLNNENRYLEKLYLTSNALTDIGPLNKCRQLNTLHVAYNAITSLPDNCISAWSEMEELVLSG   89 (183)
Q Consensus        11 ~~L~~l~l~~~~~~~~~-~~~~~~~~L~~L~l~~~~~~~~~~~~~l~~L~~l~l~~~~~~~~~~~~~~~~~~L~~l~l~~   89 (183)
                      +.++.|++++|.+++++ ..|.++++|+.|++++|+++.++.+..+++|+.|++++|.++..+. .+..+++|+.+++.+
T Consensus        31 ~~l~~L~Ls~N~i~~l~~~~f~~l~~L~~L~L~~N~l~~l~~~~~l~~L~~L~Ls~N~l~~~~~-~~~~l~~L~~L~l~~  109 (266)
T d1p9ag_          31 KDTTILHLSENLLYTFSLATLMPYTRLTQLNLDRAELTKLQVDGTLPVLGTLDLSHNQLQSLPL-LGQTLPALTVLDVSF  109 (266)
T ss_dssp             TTCCEEECTTSCCSEEEGGGGTTCTTCCEEECTTSCCCEEECCSCCTTCCEEECCSSCCSSCCC-CTTTCTTCCEEECCS
T ss_pred             cCCCEEECcCCcCCCcCHHHhhcccccccccccccccccccccccccccccccccccccccccc-ccccccccccccccc
Confidence            46889999999998877 6688889999999999998887777788899999999998887655 377788899999998


Q ss_pred             CcCccCCCCCCCCCCCccEEEeeCCcCCCCC--CccCCCcccEEeccCcccccccCCCCCC-CCccEEEcCCCCceeeCC
Q psy13911         90 NGISSLPNTIPQSWPHLRVLRLHSNHLTSCP--TLYLSSSLRVLDLSYNHLERLNLNTLIP-KQLQYLDVSGNPRLHVDP  166 (183)
Q Consensus        90 ~~l~~~~~~~~~~~~~L~~L~l~~~~~~~~~--~~~~~~~L~~l~l~~n~l~~~~~~~~~~-~~l~~l~l~~n~~~~~~~  166 (183)
                      +.+..++...+..+.+++.+++.+|.++.++  .+..++.++.+++++|.+++++...+.. ++|++|++++|.++.+ |
T Consensus       110 ~~~~~~~~~~~~~l~~l~~L~l~~n~l~~l~~~~~~~l~~l~~l~l~~N~l~~~~~~~~~~l~~L~~L~Ls~N~L~~l-p  188 (266)
T d1p9ag_         110 NRLTSLPLGALRGLGELQELYLKGNELKTLPPGLLTPTPKLEKLSLANNNLTELPAGLLNGLENLDTLLLQENSLYTI-P  188 (266)
T ss_dssp             SCCCCCCSSTTTTCTTCCEEECTTSCCCCCCTTTTTTCTTCCEEECTTSCCSCCCTTTTTTCTTCCEEECCSSCCCCC-C
T ss_pred             cccceeeccccccccccccccccccccceeccccccccccchhcccccccccccCccccccccccceeecccCCCccc-C
Confidence            8888877777667888889999888888775  3566778889999999888888776665 8889999999988866 5


Q ss_pred             CCcCCCcceeEEEEE
Q psy13911        167 NHFKSYRSYVRVYIQ  181 (183)
Q Consensus       167 ~~~~~~~~l~~l~l~  181 (183)
                      ..+..+++|+.|+|+
T Consensus       189 ~~~~~~~~L~~L~L~  203 (266)
T d1p9ag_         189 KGFFGSHLLPFAFLH  203 (266)
T ss_dssp             TTTTTTCCCSEEECC
T ss_pred             hhHCCCCCCCEEEec
Confidence            555578888888764



>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure