Psyllid ID: psy13940

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------
MKFKLVSQEDHSDADCLVITVLTHGLGELSQEDHSDADCLVITVLTHGLGERYLWAYDMPYFVEKLWLPFTADKCRTLAGKPKIFFIQ
cccEEEEEEccccccccHHHHHHHHHHHHHHcccccccEEEEEEEcccccccEEEEcccEEEHHHHHcccccccccccccccEEEEEc
ccEEEEEEEcccccccccHHHHHHHHHHHHHHccccccEEEEEEEEccccccEEEEccccEcHHHHHHHHcccccHHHccccEEEEEE
mkfklvsqedhsdadCLVITVLTHglgelsqedhsdadCLVITVLTHGLGERYLWAYDMPYFVeklwlpftadkcrtlagkpkiffiq
mkfklvsqedhsdadCLVITVLTHGLGELSQEDHSDADCLVITVLTHGLGERYLWAYDMPYFVEKLWLPFTADKCRTLAGKPKIFFIQ
MKFKLVSQEDHSDADCLVITVLTHGLGELSQEDHSDADCLVITVLTHGLGERYLWAYDMPYFVEKLWLPFTADKCRTLAGKPKIFFIQ
*************ADCLVITVLTHGLGELSQEDHSDADCLVITVLTHGLGERYLWAYDMPYFVEKLWLPFTADKCRTLAGKPKIFFI*
MKFKLVSQEDHSDADCLVITVLTHGLGELSQEDHSDADCLVITVLTHGLGERYLWAYDMPYFVEKLWLPFTADKCRTLAGKPKIFFIQ
************DADCLVITVLTHGLGELSQEDHSDADCLVITVLTHGLGERYLWAYDMPYFVEKLWLPFTADKCRTLAGKPKIFFIQ
MKFKLVSQEDHSDADCLVITVLTHGLGELSQEDHSDADCLVITVLTHGLGERYLWAYDMPYFVEKLWLPFTADKCRTLAGKPKIFFIQ
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKFKLVSQEDHSDADCLVITVLTHGLGELSQEDHSDADCLVITVLTHGLGERYLWAYDMPYFVEKLWLPFTADKCRTLAGKPKIFFIQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query88 2.2.26 [Sep-21-2011]
P89116 299 Caspase-1 OS=Spodoptera f N/A N/A 0.670 0.197 0.612 4e-14
O02002 323 Caspase-1 OS=Drosophila m no N/A 0.818 0.222 0.459 5e-13
O01382 339 Caspase OS=Drosophila mel no N/A 0.647 0.168 0.466 2e-11
P55212 293 Caspase-6 OS=Homo sapiens yes N/A 0.681 0.204 0.475 5e-09
P55866 282 Caspase-3 OS=Xenopus laev N/A N/A 0.715 0.223 0.428 7e-09
O08738 276 Caspase-6 OS=Mus musculus yes N/A 0.681 0.217 0.459 9e-09
O35397 277 Caspase-6 OS=Rattus norve yes N/A 0.681 0.216 0.459 1e-08
Q3T0P5 293 Caspase-6 OS=Bos taurus G yes N/A 0.681 0.204 0.459 2e-08
P55211 416 Caspase-9 OS=Homo sapiens no N/A 0.727 0.153 0.408 3e-07
P97864 303 Caspase-7 OS=Mus musculus no N/A 0.840 0.244 0.371 4e-07
>sp|P89116|CASP1_SPOFR Caspase-1 OS=Spodoptera frugiperda PE=1 SV=1 Back     alignment and function desciption
 Score = 76.6 bits (187), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 38/62 (61%), Positives = 46/62 (74%), Gaps = 3/62 (4%)

Query: 28  ELSQEDHSDADCLVITVLTHG-LGERYLWAYDMPYFVEKLWLPFTADKCRTLAGKPKIFF 86
           + ++ DHSDADCL++ VLTHG LG   L+A D  Y  + LW  FTADKC TLAGKPK+FF
Sbjct: 117 QTAEMDHSDADCLLVAVLTHGELG--MLYAKDTHYKPDNLWYYFTADKCPTLAGKPKLFF 174

Query: 87  IQ 88
           IQ
Sbjct: 175 IQ 176
Involved in the activation cascade of caspases responsible for apoptosis execution (By similarity). Inhibited by the baculovirus anti-apoptotic protein p35. Cleaves p35 and nuclear immunophilin FKBP46.
Spodoptera frugiperda (taxid: 7108)
EC: 3EC: .EC: 4EC: .EC: 2EC: 2EC: .EC: -
>sp|O02002|CASP1_DROME Caspase-1 OS=Drosophila melanogaster GN=Dcp-1 PE=1 SV=1 Back     alignment and function description
>sp|O01382|ICE_DROME Caspase OS=Drosophila melanogaster GN=Ice PE=1 SV=2 Back     alignment and function description
>sp|P55212|CASP6_HUMAN Caspase-6 OS=Homo sapiens GN=CASP6 PE=1 SV=2 Back     alignment and function description
>sp|P55866|CASP3_XENLA Caspase-3 OS=Xenopus laevis GN=casp3 PE=2 SV=1 Back     alignment and function description
>sp|O08738|CASP6_MOUSE Caspase-6 OS=Mus musculus GN=Casp6 PE=2 SV=1 Back     alignment and function description
>sp|O35397|CASP6_RAT Caspase-6 OS=Rattus norvegicus GN=Casp6 PE=2 SV=2 Back     alignment and function description
>sp|Q3T0P5|CASP6_BOVIN Caspase-6 OS=Bos taurus GN=CASP6 PE=2 SV=1 Back     alignment and function description
>sp|P55211|CASP9_HUMAN Caspase-9 OS=Homo sapiens GN=CASP9 PE=1 SV=3 Back     alignment and function description
>sp|P97864|CASP7_MOUSE Caspase-7 OS=Mus musculus GN=Casp7 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query88
242022291 491 Caspase-1 precursor, putative [Pediculus 0.761 0.136 0.611 6e-19
328708695 448 PREDICTED: caspase-1-like isoform 2 [Acy 0.761 0.149 0.611 9e-18
156550199 276 PREDICTED: caspase-1-like [Nasonia vitri 0.715 0.228 0.619 1e-16
156550197 379 PREDICTED: caspase-1-like [Nasonia vitri 0.715 0.166 0.634 8e-16
307178499 263 Caspase-1 [Camponotus floridanus] 0.784 0.262 0.565 2e-15
322791750 272 hypothetical protein SINV_05057 [Solenop 0.840 0.272 0.540 2e-14
312378725 302 hypothetical protein AND_09644 [Anophele 0.681 0.198 0.6 8e-14
195391388 310 GJ22849 [Drosophila virilis] gi|19415242 0.806 0.229 0.5 1e-13
307209306 383 Caspase [Harpegnathos saltator] 0.670 0.154 0.610 1e-13
194900641 308 GG16826 [Drosophila erecta] gi|190651567 0.829 0.237 0.486 2e-13
>gi|242022291|ref|XP_002431574.1| Caspase-1 precursor, putative [Pediculus humanus corporis] gi|212516877|gb|EEB18836.1| Caspase-1 precursor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score = 98.2 bits (243), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 41/67 (61%), Positives = 52/67 (77%)

Query: 22  LTHGLGELSQEDHSDADCLVITVLTHGLGERYLWAYDMPYFVEKLWLPFTADKCRTLAGK 81
           ++  + E+S+EDHSDADCL+I VLTHG    YL+A D  Y ++ LW PFTAD+C TLAGK
Sbjct: 275 ISEAINEVSKEDHSDADCLMIAVLTHGFDNGYLYARDTIYSIDNLWHPFTADRCLTLAGK 334

Query: 82  PKIFFIQ 88
           PKIFF+Q
Sbjct: 335 PKIFFVQ 341

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|328708695|ref|XP_003243774.1| PREDICTED: caspase-1-like isoform 2 [Acyrthosiphon pisum] gi|328708697|ref|XP_001950891.2| PREDICTED: caspase-1-like isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|156550199|ref|XP_001600972.1| PREDICTED: caspase-1-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|156550197|ref|XP_001600810.1| PREDICTED: caspase-1-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|307178499|gb|EFN67188.1| Caspase-1 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|322791750|gb|EFZ16009.1| hypothetical protein SINV_05057 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|312378725|gb|EFR25221.1| hypothetical protein AND_09644 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|195391388|ref|XP_002054342.1| GJ22849 [Drosophila virilis] gi|194152428|gb|EDW67862.1| GJ22849 [Drosophila virilis] Back     alignment and taxonomy information
>gi|307209306|gb|EFN86391.1| Caspase [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|194900641|ref|XP_001979864.1| GG16826 [Drosophila erecta] gi|190651567|gb|EDV48822.1| GG16826 [Drosophila erecta] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query88
FB|FBgn0028381 308 decay "death executioner caspa 0.829 0.237 0.486 1.8e-14
FB|FBgn0010501 323 Dcp-1 "Death caspase-1" [Droso 0.818 0.222 0.459 2.5e-13
FB|FBgn0019972 339 Ice "Ice" [Drosophila melanoga 0.806 0.209 0.413 1.4e-11
UNIPROTKB|D6RHU3143 CASP6 "Caspase-6 subunit p18" 0.681 0.419 0.475 4.1e-10
UNIPROTKB|F1NEL6 304 CASP6 "Uncharacterized protein 0.681 0.197 0.459 1e-09
UNIPROTKB|P55212 293 CASP6 "Caspase-6" [Homo sapien 0.681 0.204 0.475 1.2e-09
UNIPROTKB|F1NV61 271 CASP7 "Uncharacterized protein 0.840 0.273 0.397 1.2e-09
MGI|MGI:1312921 276 Casp6 "caspase 6" [Mus musculu 0.681 0.217 0.459 1.6e-09
RGD|70967 277 Casp6 "caspase 6" [Rattus norv 0.681 0.216 0.459 2.2e-09
UNIPROTKB|Q6AZ23 277 Casp6 "Caspase 6, isoform CRA_ 0.681 0.216 0.459 2.2e-09
FB|FBgn0028381 decay "death executioner caspase related to Apopain/Yama" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 187 (70.9 bits), Expect = 1.8e-14, P = 1.8e-14
 Identities = 36/74 (48%), Positives = 49/74 (66%)

Query:    15 DCLVITVLTHGLGELSQEDHSDADCLVITVLTHGLGERYLWAYDMPYFVEKLWLPFTADK 74
             D L  + +   L E+++EDHS  DC V+ V++HG  E  ++A DM Y VE+LW PF  D 
Sbjct:    97 DDLTFSEINDTLKEVAREDHSQNDCFVLAVMSHGT-EGKVYAKDMSYPVERLWNPFLGDN 155

Query:    75 CRTLAGKPKIFFIQ 88
             C+TL  KPK+FFIQ
Sbjct:   156 CKTLKNKPKLFFIQ 169
GO:0004197 "cysteine-type endopeptidase activity" evidence=ISS;NAS;IDA;TAS
GO:0006915 "apoptotic process" evidence=IMP
GO:0005737 "cytoplasm" evidence=IDA
GO:0012501 "programmed cell death" evidence=TAS
GO:0006508 "proteolysis" evidence=IEA
GO:0035069 "larval midgut histolysis" evidence=IMP
FB|FBgn0010501 Dcp-1 "Death caspase-1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0019972 Ice "Ice" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|D6RHU3 CASP6 "Caspase-6 subunit p18" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1NEL6 CASP6 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P55212 CASP6 "Caspase-6" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1NV61 CASP7 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:1312921 Casp6 "caspase 6" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|70967 Casp6 "caspase 6" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q6AZ23 Casp6 "Caspase 6, isoform CRA_a" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query88
cd00032 243 cd00032, CASc, Caspase, interleukin-1 beta convert 3e-20
smart00115 241 smart00115, CASc, Caspase, interleukin-1 beta conv 3e-15
pfam00656 228 pfam00656, Peptidase_C14, Caspase domain 1e-10
>gnl|CDD|237997 cd00032, CASc, Caspase, interleukin-1 beta converting enzyme (ICE) homologues; Cysteine-dependent aspartate-directed proteases that mediate programmed cell death (apoptosis) Back     alignment and domain information 
 Score = 80.3 bits (199), Expect = 3e-20
 Identities = 26/64 (40%), Positives = 38/64 (59%), Gaps = 2/64 (3%)

Query: 26  LGELSQEDHSDADCLVITVLTHGLGERYLWAYD-MPYFVEKLWLPFTADKCRTLAGKPKI 84
           L E +  DHSD+D  V  +L+HG  E  ++  D     ++++   F  D C +LAGKPK+
Sbjct: 63  LKEFASPDHSDSDSFVCVILSHG-EEGGIYGTDGDVVPIDEITSLFNGDNCPSLAGKPKL 121

Query: 85  FFIQ 88
           FFIQ
Sbjct: 122 FFIQ 125

Caspases are synthesized as inactive zymogens and activated by proteolysis of the peptide backbone adjacent to an aspartate. The resulting two subunits associate to form an (alpha)2(beta)2-tetramer which is the active enzyme. Activation of caspases can be mediated by other caspase homologs. Length = 243
>gnl|CDD|214521 smart00115, CASc, Caspase, interleukin-1 beta converting enzyme (ICE) homologues Back     alignment and domain information
>gnl|CDD|216047 pfam00656, Peptidase_C14, Caspase domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 88
smart00115 241 CASc Caspase, interleukin-1 beta converting enzyme 99.92
cd00032 243 CASc Caspase, interleukin-1 beta converting enzyme 99.91
KOG3573|consensus 300 99.45
PF00656 248 Peptidase_C14: Caspase domain; InterPro: IPR011600 98.84
>smart00115 CASc Caspase, interleukin-1 beta converting enzyme (ICE) homologues Back     alignment and domain information 
Probab=99.92  E-value=3.3e-25  Score=158.17  Aligned_cols=81  Identities=31%  Similarity=0.625  Sum_probs=76.7

Q ss_pred             CCceEEEEecCCCcccchHHHHHHHHHHhhhc-cCCCCCeEEEEEecCCCCCccEEeeCCc-cchHhhhhccCcCccccC
Q psy13940          1 MKFKLVSQEDHSDADCLVITVLTHGLGELSQE-DHSDADCLVITVLTHGLGERYLWAYDMP-YFVEKLWLPFTADKCRTL   78 (88)
Q Consensus         1 ~~f~v~~~~~~t~~~~Lt~~ei~~~l~~~~~~-~~~~~dc~v~~ilSHG~~~~~i~~~D~~-v~~~~I~~~f~~~~c~~L   78 (88)
                      +||+|.+++|.|      .+||.+.+++++++ +|..+||++|+|||||. ++.|+++|+. |++++|++.|++.+||+|
T Consensus        42 lgF~V~~~~dlt------~~em~~~l~~~~~~~~~~~~d~~v~~~~sHG~-~~~l~~~D~~~v~l~~i~~~f~~~~c~~L  114 (241)
T smart00115       42 LGYEVHVKNNLT------AEEMLEELKEFAERPEHSDSDSFVCVLLSHGE-EGGIYGTDHSPLPLDEIFSLFNGDNCPSL  114 (241)
T ss_pred             CCCEEEEecCCC------HHHHHHHHHHHHhccccCCCCEEEEEEcCCCC-CCeEEEecCCEEEHHHHHHhccccCChhh
Confidence            589999999966      48899999999985 89999999999999999 9999999996 999999999999999999


Q ss_pred             CCCCeEEEeC
Q psy13940         79 AGKPKIFFIQ   88 (88)
Q Consensus        79 ~gKPKlffiQ   88 (88)
                      +|||||||||
T Consensus       115 ~~kPKlffiq  124 (241)
T smart00115      115 AGKPKLFFIQ  124 (241)
T ss_pred             cCCCcEEEEe
Confidence            9999999998

Cysteine aspartases that mediate programmed cell death (apoptosis). Caspases are synthesised as zymogens and activated by proteolysis of the peptide backbone adjacent to an aspartate. The resulting two subunits associate to form an (alpha)2(beta)2-tetramer which is the active enzyme. Activation of caspases can be mediated by other caspase homologues.
>cd00032 CASc Caspase, interleukin-1 beta converting enzyme (ICE) homologues; Cysteine-dependent aspartate-directed proteases that mediate programmed cell death (apoptosis) Back     alignment and domain information
>KOG3573|consensus Back     alignment and domain information
>PF00656 Peptidase_C14: Caspase domain; InterPro: IPR011600 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query88
1m72_A 272 Crystal Structure Of Caspase-1 From Spodoptera Frug 5e-15
2nn3_C 310 Structure Of Pro-Sf-Caspase-1 Length = 310 4e-14
3sip_A157 Crystal Structure Of Drice And Diap1-Bir1 Complex L 3e-12
3sir_A 259 Crystal Structure Of Drice Length = 259 5e-12
3p45_A179 Crystal Structure Of Apo-Caspase-6 At Physiological 4e-10
4fxo_A 299 Zinc-Mediated Allosteric Inhibiton Of Caspase-6 Len 4e-10
2wdp_A 293 Crystal Structure Of Ligand Free Human Caspase-6 Le 4e-10
3nr2_A 294 Crystal Structure Of Caspase-6 Zymogen Length = 294 4e-10
4ejf_A 279 Allosteric Peptides That Bind To A Caspase Zymogen 4e-10
3nkf_A 277 Crystal Structure Of Human Ligand-Free Mature Caspa 4e-10
3k7e_A 278 Crystal Structure Of Human Ligand-Free Mature Caspa 4e-10
3qnw_A156 Caspase-6 In Complex With Z-Vad-Fmk Inhibitor Lengt 4e-10
3v6m_A 279 Inhibition Of Caspase-6 Activity By Single Mutation 4e-10
3v6l_A 282 Crystal Structure Of Caspase-6 Inactivation Mutatio 4e-10
3s8e_A 277 Phosphorylation Regulates Assembly Of The Caspase-6 5e-10
3p4u_A157 Crystal Structure Of Active Caspase-6 In Complex Wi 5e-10
1i3o_A175 Crystal Structure Of The Complex Of Xiap-Bir2 And C 6e-08
2ql5_A173 Crystal Structure Of Caspase-7 With Inhibitor Ac-Dm 7e-08
2xzd_A149 Caspase-3 In Complex With An Inhibitory Darpin-3.4 7e-08
1nme_A146 Structure Of Casp-3 With Tethered Salicylate Length 8e-08
4dcj_A147 Crystal Structure Of Caspase 3, L168d Mutant Length 8e-08
4dcp_A147 Crystal Structure Of Caspase 3, L168f Mutant Length 8e-08
1pau_A147 Crystal Structure Of The Complex Of Apopain With Th 8e-08
4dco_A147 Crystal Structure Of Caspase 3, L168y Mutant Length 8e-08
2ar9_A 278 Crystal Structure Of A Dimeric Caspase-9 Length = 2 9e-08
1jxq_A 284 Structure Of Cleaved, Card Domain Deleted Caspase-9 9e-08
1nw9_B 277 Structure Of Caspase-9 In An Inhibitory Complex Wit 9e-08
1i4o_A 280 Crystal Structure Of The XiapCASPASE-7 Complex Leng 1e-07
1shl_A 245 Caspase-7 In Complex With Fica Allosteric Inhibitor 1e-07
1kmc_A 303 Crystal Structure Of The Caspase-7 XIAP-Bir2 Comple 1e-07
4fea_A 247 Crystal Structure Of Caspase-7 In Complex With Allo 1e-07
3r5k_A 312 A Designed Redox-Controlled Caspase-7 Length = 312 1e-07
4fdl_A 305 Crystal Structure Of Caspase-7 Length = 305 1e-07
1gqf_B 265 Crystal Structure Of Human Procaspase-7 Length = 26 1e-07
3pd0_A 250 Caspase-3 E246a Length = 250 2e-07
1nmq_A 249 Extendend Tethering: In Situ Assembly Of Inhibitors 2e-07
2j30_A 250 The Role Of Loop Bundle Hydrogen Bonds In The Matur 2e-07
2j33_A 250 The Role Of Loop Bundle Hydrogen Bonds In The Matur 2e-07
3deh_A 249 Crystal Structures Of Caspase-3 With Bound Isoquino 2e-07
2j32_A 250 The Role Of Loop Bundle Hydrogen Bonds In The Matur 2e-07
2j31_A 250 The Role Of Loop Bundle Hydrogen Bonds In The Matur 2e-07
1qx3_A 257 Conformational Restrictions In The Active Site Of U 2e-07
3pd1_A 250 Caspase-3 K242a Length = 250 2e-07
3pcx_A 250 Caspase-3 E246a, K242a Double Mutant Length = 250 2e-07
3h0e_A 255 3,4-Dihydropyrimido(1,2-A)indol-10(2h)-Ones As Pote 2e-07
3itn_A 250 Crystal Structure Of Pseudo-Activated Procaspase-3 2e-07
4ehd_A 277 Allosteric Modulation Of Caspase-3 Through Mutagene 5e-07
1cp3_A 277 Crystal Structure Of The Complex Of Apopain With Th 5e-07
4ehf_A 277 Allosteric Modulation Of Caspase-3 Through Mutagene 5e-07
4eha_A 277 Allosteric Modulation Of Caspase-3 Through Mutagene 5e-07
1i51_A148 Crystal Structure Of Caspase-7 Complexed With Xiap 6e-07
1k86_A 253 Crystal Structure Of Caspase-7 Length = 253 9e-07
1shj_A 262 Caspase-7 In Complex With Dica Allosteric Inhibitor 1e-06
1k88_A 253 Crystal Structure Of Procaspase-7 Length = 253 1e-06
3h1p_A 260 Mature Caspase-7 I213a With Devd-Cho Inhibitor Boun 2e-06
1f1j_A 305 Crystal Structure Of Caspase-7 In Complex With Acet 2e-06
4ehh_A 277 Allosteric Modulation Of Caspase-3 Through Mutagene 2e-06
4ehk_A 277 Allosteric Modulation Of Caspase-3 Through Mutagene 2e-06
4ehl_A 277 Allosteric Modulation Of Caspase-3 Through Mutagene 2e-06
4ehn_A 277 Allosteric Modulation Of Caspase-3 Through Mutagene 2e-06
2c2z_A159 Crystal Structure Of Caspase-8 In Complex With Aza- 3e-06
1qtn_A164 Crystal Structure Of The Complex Of Caspase-8 With 3e-06
3h11_B 271 Zymogen Caspase-8:c-Flipl Protease Domain Complex L 3e-06
2k7z_A 266 Solution Structure Of The Catalytic Domain Of Proca 3e-06
1qdu_A153 Crystal Structure Of The Complex Of Caspase-8 With 4e-06
1i4e_B 258 Crystal Structure Of The Caspase-8P35 COMPLEX Lengt 5e-06
>pdb|1M72|A Chain A, Crystal Structure Of Caspase-1 From Spodoptera Frugiperda Length = 272 Back     alignment and structure 
Iteration: 1

 Score = 76.3 bits (186), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 38/62 (61%), Positives = 46/62 (74%), Gaps = 3/62 (4%)
Query: 28  ELSQEDHSDADCLVITVLTHG-LGERYLWAYDMPYFVEKLWLPFTADKCRTLAGKPKIFF 86
           + ++ DHSDADCL++ VLTHG LG   L+A D  Y  + LW  FTADKC TLAGKPK+FF
Sbjct: 89  QTAEMDHSDADCLLVAVLTHGELG--MLYAKDTHYKPDNLWYYFTADKCPTLAGKPKLFF 146
Query: 87  IQ 88
           IQ
Sbjct: 147 IQ 148
>pdb|2NN3|C Chain C, Structure Of Pro-Sf-Caspase-1 Length = 310 Back     alignment and structure
>pdb|3SIP|A Chain A, Crystal Structure Of Drice And Diap1-Bir1 Complex Length = 157 Back     alignment and structure
>pdb|3SIR|A Chain A, Crystal Structure Of Drice Length = 259 Back     alignment and structure
>pdb|3P45|A Chain A, Crystal Structure Of Apo-Caspase-6 At Physiological Ph Length = 179 Back     alignment and structure
>pdb|4FXO|A Chain A, Zinc-Mediated Allosteric Inhibiton Of Caspase-6 Length = 299 Back     alignment and structure
>pdb|2WDP|A Chain A, Crystal Structure Of Ligand Free Human Caspase-6 Length = 293 Back     alignment and structure
>pdb|3NR2|A Chain A, Crystal Structure Of Caspase-6 Zymogen Length = 294 Back     alignment and structure
>pdb|4EJF|A Chain A, Allosteric Peptides That Bind To A Caspase Zymogen And Mediate Caspase Tetramerization Length = 279 Back     alignment and structure
>pdb|3NKF|A Chain A, Crystal Structure Of Human Ligand-Free Mature Caspase-6 With Intersubunit Linker Attached Length = 277 Back     alignment and structure
>pdb|3K7E|A Chain A, Crystal Structure Of Human Ligand-Free Mature Caspase-6 Length = 278 Back     alignment and structure
>pdb|3QNW|A Chain A, Caspase-6 In Complex With Z-Vad-Fmk Inhibitor Length = 156 Back     alignment and structure
>pdb|3V6M|A Chain A, Inhibition Of Caspase-6 Activity By Single Mutation Outside The Active Site Length = 279 Back     alignment and structure
>pdb|3V6L|A Chain A, Crystal Structure Of Caspase-6 Inactivation Mutation Length = 282 Back     alignment and structure
>pdb|3S8E|A Chain A, Phosphorylation Regulates Assembly Of The Caspase-6 Substrate-Binding Groove Length = 277 Back     alignment and structure
>pdb|3P4U|A Chain A, Crystal Structure Of Active Caspase-6 In Complex With Ac-Veid-Cho Inhibitor Length = 157 Back     alignment and structure
>pdb|1I3O|A Chain A, Crystal Structure Of The Complex Of Xiap-Bir2 And Caspase 3 Length = 175 Back     alignment and structure
>pdb|2QL5|A Chain A, Crystal Structure Of Caspase-7 With Inhibitor Ac-Dmqd-Cho Length = 173 Back     alignment and structure
>pdb|2XZD|A Chain A, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 149 Back     alignment and structure
>pdb|1NME|A Chain A, Structure Of Casp-3 With Tethered Salicylate Length = 146 Back     alignment and structure
>pdb|4DCJ|A Chain A, Crystal Structure Of Caspase 3, L168d Mutant Length = 147 Back     alignment and structure
>pdb|4DCP|A Chain A, Crystal Structure Of Caspase 3, L168f Mutant Length = 147 Back     alignment and structure
>pdb|1PAU|A Chain A, Crystal Structure Of The Complex Of Apopain With The Tetrapeptide Aldehyde Inhibitor Ac-Devd-Cho Length = 147 Back     alignment and structure
>pdb|4DCO|A Chain A, Crystal Structure Of Caspase 3, L168y Mutant Length = 147 Back     alignment and structure
>pdb|2AR9|A Chain A, Crystal Structure Of A Dimeric Caspase-9 Length = 278 Back     alignment and structure
>pdb|1JXQ|A Chain A, Structure Of Cleaved, Card Domain Deleted Caspase-9 Length = 284 Back     alignment and structure
>pdb|1NW9|B Chain B, Structure Of Caspase-9 In An Inhibitory Complex With Xiap- Bir3 Length = 277 Back     alignment and structure
>pdb|1I4O|A Chain A, Crystal Structure Of The XiapCASPASE-7 Complex Length = 280 Back     alignment and structure
>pdb|1SHL|A Chain A, Caspase-7 In Complex With Fica Allosteric Inhibitor Length = 245 Back     alignment and structure
>pdb|1KMC|A Chain A, Crystal Structure Of The Caspase-7 XIAP-Bir2 Complex Length = 303 Back     alignment and structure
>pdb|4FEA|A Chain A, Crystal Structure Of Caspase-7 In Complex With Allosteric Inhibitor Length = 247 Back     alignment and structure
>pdb|3R5K|A Chain A, A Designed Redox-Controlled Caspase-7 Length = 312 Back     alignment and structure
>pdb|4FDL|A Chain A, Crystal Structure Of Caspase-7 Length = 305 Back     alignment and structure
>pdb|3PD0|A Chain A, Caspase-3 E246a Length = 250 Back     alignment and structure
>pdb|1NMQ|A Chain A, Extendend Tethering: In Situ Assembly Of Inhibitors Length = 249 Back     alignment and structure
>pdb|2J30|A Chain A, The Role Of Loop Bundle Hydrogen Bonds In The Maturation And Activity Of (Pro)caspase-3 Length = 250 Back     alignment and structure
>pdb|2J33|A Chain A, The Role Of Loop Bundle Hydrogen Bonds In The Maturation And Activity Of (Pro)caspase-3 Length = 250 Back     alignment and structure
>pdb|3DEH|A Chain A, Crystal Structures Of Caspase-3 With Bound Isoquinoline-1,3, 4-Trione Derivative Inhibitors Length = 249 Back     alignment and structure
>pdb|2J32|A Chain A, The Role Of Loop Bundle Hydrogen Bonds In The Maturation And Activity Of(Pro)caspase-3 Length = 250 Back     alignment and structure
>pdb|2J31|A Chain A, The Role Of Loop Bundle Hydrogen Bonds In The Maturation And Activity Of(pro)caspase-3 Length = 250 Back     alignment and structure
>pdb|1QX3|A Chain A, Conformational Restrictions In The Active Site Of Unliganded Human Caspase-3 Length = 257 Back     alignment and structure
>pdb|3PD1|A Chain A, Caspase-3 K242a Length = 250 Back     alignment and structure
>pdb|3PCX|A Chain A, Caspase-3 E246a, K242a Double Mutant Length = 250 Back     alignment and structure
>pdb|3H0E|A Chain A, 3,4-Dihydropyrimido(1,2-A)indol-10(2h)-Ones As Potent Non- Peptidic Inhibitors Of Caspase-3 Length = 255 Back     alignment and structure
>pdb|3ITN|A Chain A, Crystal Structure Of Pseudo-Activated Procaspase-3 Length = 250 Back     alignment and structure
>pdb|4EHD|A Chain A, Allosteric Modulation Of Caspase-3 Through Mutagenesis Length = 277 Back     alignment and structure
>pdb|1CP3|A Chain A, Crystal Structure Of The Complex Of Apopain With The Tetrapeptide Inhibitor Ace-Dvad-Fmc Length = 277 Back     alignment and structure
>pdb|4EHF|A Chain A, Allosteric Modulation Of Caspase-3 Through Mutagenesis Length = 277 Back     alignment and structure
>pdb|4EHA|A Chain A, Allosteric Modulation Of Caspase-3 Through Mutagenesis Length = 277 Back     alignment and structure
>pdb|1I51|A Chain A, Crystal Structure Of Caspase-7 Complexed With Xiap Length = 148 Back     alignment and structure
>pdb|1K86|A Chain A, Crystal Structure Of Caspase-7 Length = 253 Back     alignment and structure
>pdb|1SHJ|A Chain A, Caspase-7 In Complex With Dica Allosteric Inhibitor Length = 262 Back     alignment and structure
>pdb|1K88|A Chain A, Crystal Structure Of Procaspase-7 Length = 253 Back     alignment and structure
>pdb|3H1P|A Chain A, Mature Caspase-7 I213a With Devd-Cho Inhibitor Bound To Active Site Length = 260 Back     alignment and structure
>pdb|1F1J|A Chain A, Crystal Structure Of Caspase-7 In Complex With Acetyl-asp-glu-val-asp- Cho Length = 305 Back     alignment and structure
>pdb|4EHH|A Chain A, Allosteric Modulation Of Caspase-3 Through Mutagenesis Length = 277 Back     alignment and structure
>pdb|4EHK|A Chain A, Allosteric Modulation Of Caspase-3 Through Mutagenesis Length = 277 Back     alignment and structure
>pdb|4EHL|A Chain A, Allosteric Modulation Of Caspase-3 Through Mutagenesis Length = 277 Back     alignment and structure
>pdb|4EHN|A Chain A, Allosteric Modulation Of Caspase-3 Through Mutagenesis Length = 277 Back     alignment and structure
>pdb|2C2Z|A Chain A, Crystal Structure Of Caspase-8 In Complex With Aza-Peptide Michael Acceptor Inhibitor Length = 159 Back     alignment and structure
>pdb|1QTN|A Chain A, Crystal Structure Of The Complex Of Caspase-8 With The Tetrapeptide Inhibitor Ace-Ietd-Aldehyde Length = 164 Back     alignment and structure
>pdb|3H11|B Chain B, Zymogen Caspase-8:c-Flipl Protease Domain Complex Length = 271 Back     alignment and structure
>pdb|2K7Z|A Chain A, Solution Structure Of The Catalytic Domain Of Procaspase-8 Length = 266 Back     alignment and structure
>pdb|1QDU|A Chain A, Crystal Structure Of The Complex Of Caspase-8 With The Tripeptide Ketone Inhibitor Zevd-Dcbmk Length = 153 Back     alignment and structure
>pdb|1I4E|B Chain B, Crystal Structure Of The Caspase-8P35 COMPLEX Length = 258 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query88
1qtn_A164 Caspase-8; apoptosis, dithiane-DIOL, caspase, cyst 1e-19
2dko_A146 Caspase-3; low barrier hydrogen bond, caspase, dru 3e-19
2ql9_A173 Caspase-7; cysteine protease, apoptosis, thiol pro 1e-18
3p45_A179 Caspase-6; protease, huntington'S disease, physio 4e-18
1pyo_A167 Caspase-2; apoptosis, caspase, alpha-beta, thiol p 6e-17
2nn3_C 310 Caspase-1; cysteine protease, hydrolase; 3.00A {Sp 3e-16
3h11_A 272 CAsp8 and FADD-like apoptosis regulator; cell deat 5e-16
3sir_A 259 Caspase; hydrolase; 2.68A {Drosophila melanogaster 7e-16
4ehd_A 277 Caspase-3; caspase, apoptosis, allosteric inhibiti 8e-16
3od5_A 278 Caspase-6; caspase domain, apoptotic protease, hyd 2e-15
1m72_A 272 Caspase-1; caspase, cysteine protease, hydrolase-h 3e-15
2j32_A 250 Caspase-3; Pro-caspase3, thiol protease, hydrolase 6e-15
1f1j_A 305 Caspase-7 protease; caspase-7, cysteine protease, 3e-14
1nw9_B 277 Caspase 9, apoptosis-related cysteine protease; XI 4e-14
3h11_B 271 Caspase-8; cell death, apoptosis, caspase, alterna 6e-14
2h54_A178 Caspase-1; allosteric site, dimer interface, hydro 2e-13
2fp3_A 316 Caspase NC; apoptosis, initiator caspase activatio 1e-12
3e4c_A 302 Caspase-1; zymogen, inflammasome, ICE, IL-1B, inna 5e-12
>1qtn_A Caspase-8; apoptosis, dithiane-DIOL, caspase, cysteine-protease, hydrol hydrolase inhibitor complex; 1.20A {Homo sapiens} SCOP: c.17.1.1 PDB: 3kjn_A* 3kjq_A* 2y1l_A 2c2z_A 1qdu_A* 1f9e_A* Length = 164 Back     alignment and structure
 Score = 76.6 bits (188), Expect = 1e-19
 Identities = 24/63 (38%), Positives = 32/63 (50%)

Query: 26  LGELSQEDHSDADCLVITVLTHGLGERYLWAYDMPYFVEKLWLPFTADKCRTLAGKPKIF 85
           L      DHS+ DC +  +L+HG              + +L   FT  KC +LAGKPK+F
Sbjct: 86  LKIYQLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVF 145

Query: 86  FIQ 88
           FIQ
Sbjct: 146 FIQ 148
>2dko_A Caspase-3; low barrier hydrogen bond, caspase, drug design, radiation D tetrahedral intermediate, protease; 1.06A {Homo sapiens} PDB: 1nme_A 2h5i_A 2h5j_A 2h65_A 2xyg_A* 2xyh_A 2xyp_A* 2xzd_A 2xzt_A 2y0b_A 3edq_A 1gfw_A 1re1_A* 1pau_A* 1rhk_A* 1rhm_A* 1rhq_A* 1rhr_A* 1rhu_A* 1rhj_A* ... Length = 146 Back     alignment and structure
>2ql9_A Caspase-7; cysteine protease, apoptosis, thiol protease, zymogen, hydro hydrolase inhibitor complex; HET: CIT; 2.14A {Homo sapiens} PDB: 2ql7_A* 2ql5_A* 2qlb_A* 2qlf_A 2qlj_A* 3edr_A 3ibc_A 3ibf_A 1i51_A Length = 173 Back     alignment and structure
>3p45_A Caspase-6; protease, huntington'S disease, physio PH, competitive inhibition, hydrolase; 2.53A {Homo sapiens} Length = 179 Back     alignment and structure
>1pyo_A Caspase-2; apoptosis, caspase, alpha-beta, thiol protease, hydrolase-HY inhibitor complex; 1.65A {Homo sapiens} SCOP: c.17.1.1 PDB: 3rjm_A* 2p2c_A 3r5j_A 3r6g_A 3r6l_A 3r7b_A 3r7n_A 3r7s_A Length = 167 Back     alignment and structure
>2nn3_C Caspase-1; cysteine protease, hydrolase; 3.00A {Spodoptera frugiperda} Length = 310 Back     alignment and structure
>3h11_A CAsp8 and FADD-like apoptosis regulator; cell death, apoptosis, caspase, alternative splicing, HOST- virus interaction, polymorphism, cytoplasm, disease mutation; 1.90A {Homo sapiens} PDB: 3h13_A Length = 272 Back     alignment and structure
>3sir_A Caspase; hydrolase; 2.68A {Drosophila melanogaster} PDB: 3sip_A Length = 259 Back     alignment and structure
>4ehd_A Caspase-3; caspase, apoptosis, allosteric inhibition; 1.58A {Homo sapiens} PDB: 4ehk_A 4ehf_A 4ehn_A 1cp3_A 4ehh_A 4eha_A 4ehl_A 1i3o_A Length = 277 Back     alignment and structure
>3od5_A Caspase-6; caspase domain, apoptotic protease, hydrolase-hydrolase INHI complex; 1.60A {Homo sapiens} PDB: 3k7e_A 3s70_A 3v6m_A 3v6l_A 3nr2_A 2wdp_A 3nkf_A 3s8e_A 3qnw_A* 3p4u_A* 3p45_B 3qnw_B* 3p4u_B* Length = 278 Back     alignment and structure
>1m72_A Caspase-1; caspase, cysteine protease, hydrolase-hydrolase inhibitor CO; 2.30A {Spodoptera frugiperda} SCOP: c.17.1.1 PDB: 3sip_B Length = 272 Back     alignment and structure
>2j32_A Caspase-3; Pro-caspase3, thiol protease, hydrolase, hydrolase-hydrolase inhibitor complex; 1.30A {Homo sapiens} PDB: 2j30_A 3h0e_A* 2j33_A 3pd1_A 2j31_A 3pcx_A 1nms_A* 1nmq_A* 3deh_A* 3dei_A* 3dej_A* 3dek_A* 3pd0_A 3itn_A 1qx3_A Length = 250 Back     alignment and structure
>1f1j_A Caspase-7 protease; caspase-7, cysteine protease, hydrolase, apoptosis, hydrolas hydrolase inhibitor complex; 2.35A {Homo sapiens} SCOP: c.17.1.1 PDB: 1kmc_A 3r5k_A 1i4o_A 1gqf_A 3h1p_A 1shj_A* 1k86_A 1k88_A 1shl_A* Length = 305 Back     alignment and structure
>1nw9_B Caspase 9, apoptosis-related cysteine protease; XIAP, caspase inhibition, caspase activation, dimerization; 2.40A {Homo sapiens} SCOP: c.17.1.1 PDB: 1jxq_A* 2ar9_A Length = 277 Back     alignment and structure
>3h11_B Caspase-8; cell death, apoptosis, caspase, alternative splicing, HOST- virus interaction, polymorphism, cytoplasm, disease mutation; 1.90A {Homo sapiens} PDB: 2k7z_A 1i4e_B 2fun_B 2c2z_B* Length = 271 Back     alignment and structure
>2h54_A Caspase-1; allosteric site, dimer interface, hydrolase; HET: PHQ; 1.80A {Homo sapiens} PDB: 1rwm_A* 1rwk_A* 1rwo_A* 1rwp_A* 1rwv_A* 1rww_A* 1rwn_A* 2h48_A* 2h4w_A* 1rwx_A* 2hbq_A* 2hby_A* 1ibc_A 3d6m_A* 2h4y_A* 2h51_A* 3d6f_A* 3d6h_A* 2hbz_A* 2hbr_A* ... Length = 178 Back     alignment and structure
>2fp3_A Caspase NC; apoptosis, initiator caspase activation, dimerization, active site conformation, hydrolysis/apoptosis complex; 2.50A {Drosophila melanogaster} Length = 316 Back     alignment and structure
>3e4c_A Caspase-1; zymogen, inflammasome, ICE, IL-1B, innate immunity, apoptosis, hydrolase, protease protease; 2.05A {Homo sapiens} Length = 302 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query88
2dko_A146 Caspase-3; low barrier hydrogen bond, caspase, dru 99.97
1qtn_A164 Caspase-8; apoptosis, dithiane-DIOL, caspase, cyst 99.97
3p45_A179 Caspase-6; protease, huntington'S disease, physio 99.97
2ql9_A173 Caspase-7; cysteine protease, apoptosis, thiol pro 99.97
1pyo_A167 Caspase-2; apoptosis, caspase, alpha-beta, thiol p 99.97
3h11_B 271 Caspase-8; cell death, apoptosis, caspase, alterna 99.95
3od5_A 278 Caspase-6; caspase domain, apoptotic protease, hyd 99.95
3h11_A 272 CAsp8 and FADD-like apoptosis regulator; cell deat 99.95
1nw9_B 277 Caspase 9, apoptosis-related cysteine protease; XI 99.94
3sir_A 259 Caspase; hydrolase; 2.68A {Drosophila melanogaster 99.94
4ehd_A 277 Caspase-3; caspase, apoptosis, allosteric inhibiti 99.94
2j32_A 250 Caspase-3; Pro-caspase3, thiol protease, hydrolase 99.94
1m72_A 272 Caspase-1; caspase, cysteine protease, hydrolase-h 99.94
2h54_A178 Caspase-1; allosteric site, dimer interface, hydro 99.94
2fp3_A 316 Caspase NC; apoptosis, initiator caspase activatio 99.93
2nn3_C 310 Caspase-1; cysteine protease, hydrolase; 3.00A {Sp 99.93
3e4c_A 302 Caspase-1; zymogen, inflammasome, ICE, IL-1B, inna 99.92
1f1j_A 305 Caspase-7 protease; caspase-7, cysteine protease, 99.92
3uoa_B 390 Mucosa-associated lymphoid tissue lymphoma transl 99.08
3bij_A 285 Uncharacterized protein GSU0716; alpha-beta protei 94.97
>2dko_A Caspase-3; low barrier hydrogen bond, caspase, drug design, radiation D tetrahedral intermediate, protease; 1.06A {Homo sapiens} PDB: 1nme_A 2h5i_A 2h5j_A 2h65_A 2xyg_A* 2xyh_A 2xyp_A* 2xzd_A 2xzt_A 2y0b_A 3edq_A 1gfw_A 1re1_A* 1pau_A* 1rhk_A* 1rhm_A* 1rhq_A* 1rhr_A* 1rhu_A* 1rhj_A* ... Back     alignment and structure
Probab=99.97  E-value=3.6e-32  Score=181.67  Aligned_cols=81  Identities=32%  Similarity=0.593  Sum_probs=78.0

Q ss_pred             CCceEEEEecCCCcccchHHHHHHHHHHhhhccCCCCCeEEEEEecCCCCCccEEeeCCccchHhhhhccCcCccccCCC
Q psy13940          1 MKFKLVSQEDHSDADCLVITVLTHGLGELSQEDHSDADCLVITVLTHGLGERYLWAYDMPYFVEKLWLPFTADKCRTLAG   80 (88)
Q Consensus         1 ~~f~v~~~~~~t~~~~Lt~~ei~~~l~~~~~~~~~~~dc~v~~ilSHG~~~~~i~~~D~~v~~~~I~~~f~~~~c~~L~g   80 (88)
                      +||+|.+|+|.|      ++||.+.|+++++++|+.+|||+|+|||||. +|.|||+|+++++++|+++|++++||+|+|
T Consensus        53 LgF~V~~~~dlt------~~em~~~l~~~~~~dh~~~dc~vv~ilSHG~-~g~i~g~D~~~~l~~i~~~F~~~~CpsL~g  125 (146)
T 2dko_A           53 LKYEVRNKNDLT------REEIVELMRDVSKEDHSKRSSFVCVLLSHGE-EGIIFGTNGPVDLKKITNFFRGDRCRSLTG  125 (146)
T ss_dssp             TTCEEEEEESCC------HHHHHHHHHHHHHSCCTTEEEEEEEEESCEE-TTEEEETTEEEEHHHHHHTTSTTTCGGGTT
T ss_pred             CCCEEEEeeCCC------HHHHHHHHHHHHHhhcCCCCeEEEEeccCCC-CCEEEEeCCcEeHHHHHHHhccccChhhcC
Confidence            699999999966      5899999999999999999999999999999 999999999999999999999999999999


Q ss_pred             CCeEEEeC
Q psy13940         81 KPKIFFIQ   88 (88)
Q Consensus        81 KPKlffiQ   88 (88)
                      ||||||||
T Consensus       126 KPKlffiQ  133 (146)
T 2dko_A          126 KPKLFIIQ  133 (146)
T ss_dssp             SCEEEEEE
T ss_pred             CCeEEEEE
Confidence            99999998
>1qtn_A Caspase-8; apoptosis, dithiane-DIOL, caspase, cysteine-protease, hydrol hydrolase inhibitor complex; 1.20A {Homo sapiens} SCOP: c.17.1.1 PDB: 3kjn_A* 3kjq_A* 2y1l_A 2c2z_A 1qdu_A* 1f9e_A* Back     alignment and structure
>3p45_A Caspase-6; protease, huntington'S disease, physio PH, competitive inhibition, hydrolase; 2.53A {Homo sapiens} Back     alignment and structure
>2ql9_A Caspase-7; cysteine protease, apoptosis, thiol protease, zymogen, hydro hydrolase inhibitor complex; HET: CIT; 2.14A {Homo sapiens} PDB: 2ql7_A* 2ql5_A* 2qlb_A* 2qlf_A 2qlj_A* 3edr_A 3ibc_A 3ibf_A 1i51_A Back     alignment and structure
>1pyo_A Caspase-2; apoptosis, caspase, alpha-beta, thiol protease, hydrolase-HY inhibitor complex; 1.65A {Homo sapiens} SCOP: c.17.1.1 PDB: 3rjm_A* 2p2c_A 3r5j_A 3r6g_A 3r6l_A 3r7b_A 3r7n_A 3r7s_A Back     alignment and structure
>3h11_B Caspase-8; cell death, apoptosis, caspase, alternative splicing, HOST- virus interaction, polymorphism, cytoplasm, disease mutation; 1.90A {Homo sapiens} SCOP: c.17.1.1 PDB: 2k7z_A 1i4e_B 2fun_B 2c2z_B* Back     alignment and structure
>3od5_A Caspase-6; caspase domain, apoptotic protease, hydrolase-hydrolase INHI complex; 1.60A {Homo sapiens} SCOP: c.17.1.0 PDB: 3k7e_A 3s70_A 3v6m_A 3v6l_A 3nr2_A 4fxo_A 2wdp_A 3nkf_A 3s8e_A 4ejf_A 3qnw_A* 3p4u_A* 3p45_B 3qnw_B* 3p4u_B* Back     alignment and structure
>3h11_A CAsp8 and FADD-like apoptosis regulator; cell death, apoptosis, caspase, alternative splicing, HOST- virus interaction, polymorphism, cytoplasm, disease mutation; 1.90A {Homo sapiens} PDB: 3h13_A Back     alignment and structure
>1nw9_B Caspase 9, apoptosis-related cysteine protease; XIAP, caspase inhibition, caspase activation, dimerization; 2.40A {Homo sapiens} SCOP: c.17.1.1 PDB: 1jxq_A* 2ar9_A Back     alignment and structure
>3sir_A Caspase; hydrolase; 2.68A {Drosophila melanogaster} PDB: 3sip_A Back     alignment and structure
>4ehd_A Caspase-3; caspase, apoptosis, allosteric inhibition; 1.58A {Homo sapiens} PDB: 4ehk_A 4ehf_A 4ehn_A 1cp3_A 4ehh_A 4eha_A 4ehl_A 1i3o_A Back     alignment and structure
>2j32_A Caspase-3; Pro-caspase3, thiol protease, hydrolase, hydrolase-hydrolase inhibitor complex; 1.30A {Homo sapiens} PDB: 2j30_A 3h0e_A* 2j33_A 3pd1_A 2j31_A 3pcx_A 1nms_A* 1nmq_A* 3deh_A* 3dei_A* 3dej_A* 3dek_A* 3pd0_A 3itn_A 1qx3_A Back     alignment and structure
>1m72_A Caspase-1; caspase, cysteine protease, hydrolase-hydrolase inhibitor CO; 2.30A {Spodoptera frugiperda} SCOP: c.17.1.1 PDB: 3sip_B Back     alignment and structure
>2h54_A Caspase-1; allosteric site, dimer interface, hydrolase; HET: PHQ; 1.80A {Homo sapiens} PDB: 1rwm_A* 1rwk_A* 1rwo_A* 1rwp_A* 1rwv_A* 1rww_A* 1rwn_A* 2h48_A* 2h4w_A* 1rwx_A* 2hbq_A* 2hby_A* 1ibc_A 3d6m_A* 2h4y_A* 2h51_A* 3d6f_A* 3d6h_A* 2hbz_A* 2hbr_A* ... Back     alignment and structure
>2fp3_A Caspase NC; apoptosis, initiator caspase activation, dimerization, active site conformation, hydrolysis/apoptosis complex; 2.50A {Drosophila melanogaster} Back     alignment and structure
>2nn3_C Caspase-1; cysteine protease, hydrolase; 3.00A {Spodoptera frugiperda} Back     alignment and structure
>3e4c_A Caspase-1; zymogen, inflammasome, ICE, IL-1B, innate immunity, apoptosis, hydrolase, protease protease; 2.05A {Homo sapiens} Back     alignment and structure
>1f1j_A Caspase-7 protease; caspase-7, cysteine protease, hydrolase, apoptosis, hydrolas hydrolase inhibitor complex; 2.35A {Homo sapiens} SCOP: c.17.1.1 PDB: 1kmc_A 3r5k_A 1i4o_A 1gqf_A 3h1p_A 1shj_A* 1k86_A 1k88_A 1shl_A* Back     alignment and structure
>3uoa_B Mucosa-associated lymphoid tissue lymphoma transl protein 1; paracaspase, lymphoma, NF-KB signalling, caspase fold, immun fold, hydrolase-hydrolase inhibitor complex; 1.75A {Homo sapiens} PDB: 3uo8_B 3v55_A 3v4l_A* 3v4o_A* Back     alignment and structure
>3bij_A Uncharacterized protein GSU0716; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.50A {Geobacter sulfurreducens pca} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 88
d1m72a_ 256 c.17.1.1 (A:) Caspase-1 {Fall armyworm (Spodoptera 3e-13
g1nme.1 238 c.17.1.1 (A:,B:) Apopain (caspase-3, cpp32) {Human 4e-11
g1sc3.1 261 c.17.1.1 (A:,B:) Interleukin-1beta converting enzy 2e-10
d1f1ja_ 245 c.17.1.1 (A:) Caspase-7 {Human (Homo sapiens) [Tax 1e-09
g1qtn.1 242 c.17.1.1 (A:,B:) Caspase-8 {Human (Homo sapiens) [ 2e-09
g1pyo.1 257 c.17.1.1 (A:,B:) Caspase-2 {Human (Homo sapiens) [ 5e-09
d1nw9b_ 277 c.17.1.1 (B:) Caspase-9 {Human (Homo sapiens) [Tax 6e-08
>d1m72a_ c.17.1.1 (A:) Caspase-1 {Fall armyworm (Spodoptera frugiperda) [TaxId: 7108]} Length = 256 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Caspase-like
superfamily: Caspase-like
family: Caspase catalytic domain
domain: Caspase-1
species: Fall armyworm (Spodoptera frugiperda) [TaxId: 7108]

 Score = 60.5 bits (146), Expect = 3e-13
 Identities = 36/63 (57%), Positives = 45/63 (71%), Gaps = 1/63 (1%)

Query: 26  LGELSQEDHSDADCLVITVLTHGLGERYLWAYDMPYFVEKLWLPFTADKCRTLAGKPKIF 85
           + + ++ DHSDADCL++ VLTHG     L+A D  Y  + LW  FTADKC TLAGKPK+F
Sbjct: 76  IQQTAEMDHSDADCLLVAVLTHG-ELGMLYAKDTHYKPDNLWYYFTADKCPTLAGKPKLF 134

Query: 86  FIQ 88
           FIQ
Sbjct: 135 FIQ 137
>d1f1ja_ c.17.1.1 (A:) Caspase-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 245 Back     information, alignment and structure
>d1nw9b_ c.17.1.1 (B:) Caspase-9 {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query88
d1f1ja_ 245 Caspase-7 {Human (Homo sapiens) [TaxId: 9606]} 99.86
g1qtn.1 242 Caspase-8 {Human (Homo sapiens) [TaxId: 9606]} 99.86
d1m72a_ 256 Caspase-1 {Fall armyworm (Spodoptera frugiperda) [ 99.86
g1nme.1 238 Apopain (caspase-3, cpp32) {Human (Homo sapiens) [ 99.84
g1pyo.1 257 Caspase-2 {Human (Homo sapiens) [TaxId: 9606]} 99.83
g1sc3.1 261 Interleukin-1beta converting enzyme (a cysteine pr 99.77
d1nw9b_ 277 Caspase-9 {Human (Homo sapiens) [TaxId: 9606]} 99.74
>d1f1ja_ c.17.1.1 (A:) Caspase-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Caspase-like
superfamily: Caspase-like
family: Caspase catalytic domain
domain: Caspase-7
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.86  E-value=7.6e-23  Score=142.14  Aligned_cols=81  Identities=33%  Similarity=0.555  Sum_probs=76.7

Q ss_pred             CCceEEEEecCCCcccchHHHHHHHHHHhhhccCCCCCeEEEEEecCCCCCccEEeeCCccchHhhhhccCcCccccCCC
Q psy13940          1 MKFKLVSQEDHSDADCLVITVLTHGLGELSQEDHSDADCLVITVLTHGLGERYLWAYDMPYFVEKLWLPFTADKCRTLAG   80 (88)
Q Consensus         1 ~~f~v~~~~~~t~~~~Lt~~ei~~~l~~~~~~~~~~~dc~v~~ilSHG~~~~~i~~~D~~v~~~~I~~~f~~~~c~~L~g   80 (88)
                      +||+|.+++|.|      .+||.+.++++++..+..+||+++++||||. ++.|+|+|+.++++++...|.+.+||+|++
T Consensus        47 lGF~V~~~~nl~------~~em~~~l~~~~~~~~~~~~~~vv~~~~HG~-~~~i~g~d~~~~v~~~~~~~~~~~~~~L~~  119 (245)
T d1f1ja_          47 LGFDVIVYNDCS------CAKMQDLLKKASEEDHTNAACFACILLSHGE-ENVIYGKDGVTPIKDLTAHFRGDRSKTLLE  119 (245)
T ss_dssp             HTEEEEEEESCC------HHHHHHHHHHHHHSCGGGEEEEEEEEESCEE-TTEEECSSSEEEHHHHHHTTSTTTCGGGTT
T ss_pred             CCCEEEEecCCC------HHHHHHHHHHHHHHhccCCceEEEEEeeccc-cceEecCCCcEEcchhhhhccchhhHHHhh
Confidence            599999999966      5899999999998888899999999999999 999999999999999999999999999999


Q ss_pred             CCeEEEeC
Q psy13940         81 KPKIFFIQ   88 (88)
Q Consensus        81 KPKlffiQ   88 (88)
                      ||||||+|
T Consensus       120 kpKif~iq  127 (245)
T d1f1ja_         120 KPKLFFIQ  127 (245)
T ss_dssp             SCEEEEEE
T ss_pred             cchhhehh
Confidence            99999998
>d1m72a_ c.17.1.1 (A:) Caspase-1 {Fall armyworm (Spodoptera frugiperda) [TaxId: 7108]} Back     information, alignment and structure
>d1nw9b_ c.17.1.1 (B:) Caspase-9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure