Psyllid ID: psy13961

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------46

MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETSKFYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEARFEEIKKEVSGYIKKIGYNPATVAFVPISGWHGDNMLEVSDKMPWFKGWAIERKEGKADGKCLIEALDAILPPSRPTEKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMLVTFAPANLTTEVKSVEMHHEALQEAVPGDNVGFNVKNVSVKELRRGFVAGDSKASPPKATQDFTAQVIVLNHPGQISNGYTPVLDCHTAHIACKFAEIKEKCDRRTGKTTEENPKALKSGDAAIIVLVPSKPMCVESFSEFPPLGRFAVRDMRQTVAVGVIKVNNNHGNKYLPTYLDDNYSS

ccccccEEEEEEEEEccccccccccEEEEccccccHHHHHHHHHHHHHccccccEEEEEEEHHccccccccEEEEEEcccccccEEEEEEEcccccccccccccccccccEEEEEEEccccEEEccccccccHHHHHHHHHcccccEEEEEEEccccccccccHHHHHHHHHHHHHHHHHHccccccccEEEccccccccccccccccccccccEEEEcccccccccHHHHHccccccccccccccccccccEEEEccEEEEEcEEEEEcccccccEEEEcccccEEEEEEEEEcHHHHccccccccEEEEEcccccccccccccccccccccccccccEEEEEEEcccccccccccccccccccccccHHHHHHHHHHHccccccccccccccccccEEEEEEEccccEEEEcccccccccccEEEccccEEEEEEEEEEEccccccccccccccccc

cccccEEEEEEEEEcccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccccccccEEEEcccEEEEEEEccccccHHHHHHHccccccEEEEEEEccHHHHHHHcccccHHHHHHHHHHHccccEEEEEEEcHHHHcccccHHHHHHHHHHHHHHHHHHcccHHHccEEEccccccEcccEccccccccccEEEEccccEEEEccHHHHHHcccccccccccccEEEEEEEEEEcccEEEEEEEccEccEccccEEEEEcccEEEEEEEEEEccEEcccEccccEEEEEEccccccccccccEEEEccccccccccEEEEEEEEccccccEccccccEEEEccEEEEEEEEEEEEEEccccccEEEEccccEccccEEEEEEEEccccccccccccHHHcEEEEEEccEEEEEEEEEEEEcccccccEccccccccc

MGKEKTHINIVVIGhvdsgkstttghliykcggidkRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETSKFYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGtgefeagiskngqTREHALLAFTLGVKQLIVGVnkmdsteppyseaRFEEIKKEVSGYIKkigynpatvafvpisgwhgdnmlevsdkmpwfkgWAIERKEGKADGKCLIEALdailppsrptekplrlplqdvykiggigtvpvgrvetgvikpgmlvtfapanlttEVKSVEMHHEALqeavpgdnvgfnvkNVSVKELRrgfvagdskasppkatqdFTAQVIVLnhpgqisngytpvldcHTAHIACKFAEIKEkcdrrtgktteenpkalksgdaAIIVlvpskpmcvesfsefpplgrfavrDMRQTVAVGVIKVnnnhgnkylptylddnyss

mgkekthiNIVVighvdsgkstttghLIYKCGGIDKRTIEKFEKEAqemgkgsfkyAWVLDKLKAERERGITIdialwkfetsKFYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMdsteppysearfEEIKKEVSGYIKKIGYNPATVAFVPISGWHGDNMLEVSDKMPWFKGWAIERKEGKADGKCLIEALdailppsrptekplrlplqdvykiggigtvPVGRVETGVIKPGMLVTFAPANLTTEVKSVEMHHEALqeavpgdnvgfNVKNVSVKELRRGFvagdskasppkaTQDFTAQVIVLNHPGQISNGYTPVLDCHTAHIACKFAEikekcdrrtgktteenpkalksgdaAIIVLVPSKPMCVESFSEFPPLGRFAVRDMRQTVAVGVikvnnnhgnkylptylddnyss

******HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETSKFYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKM***********FEEIKKEVSGYIKKIGYNPATVAFVPISGWHGDNMLEVSDKMPWFKGWAIERKEGKADGKCLIEALDAILP********LRLPLQDVYKIGGIGTVPVGRVETGVIKPGMLVTFAPANLTTEVKSVEMHHEALQEAVPGDNVGFNVKNVSVKELRRGFV*************DFTAQVIVLNHPGQISNGYTPVLDCHTAHIACKFAEIKEKC******************DAAIIVLVPSKPMCVESFSEFPPLGRFAVRDMRQTVAVGVIKVNNNHGNKYLPTYL******

***EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEK*****GKGSFKYAWVLDKLKAERERGITIDIALWKFETSKFYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEARFEEIKKEVSGYIKKIGYNPATVAFVPISGWHGDNMLEVSDKMPWFKGWAIERKEGKADGKCLIEALDAILPPSRPTEKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMLVTFAPANLTTEVKSVEMHHEALQEAVPGDNVGFNVKNVSVKELRRGFVAGDSKASPPKATQDFTAQVIVLNHPGQISNGYTPVLDCHTAHIACKFAEIKEKCDRRTGKTTEENPKALKSGDAAIIVLVPSKPMCVESFSEFPPLGRFAVRDMRQTVAVGVIKVNNNHGNKYLPTYL******

MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETSKFYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEARFEEIKKEVSGYIKKIGYNPATVAFVPISGWHGDNMLEVSDKMPWFKGWAIERKEGKADGKCLIEALDAILPPSRPTEKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMLVTFAPANLTTEVKSVEMHHEALQEAVPGDNVGFNVKNVSVKELRRGFVAG*********TQDFTAQVIVLNHPGQISNGYTPVLDCHTAHIACKFAEIKEKCDRRTGKTTEENPKALKSGDAAIIVLVPSKPMCVESFSEFPPLGRFAVRDMRQTVAVGVIKVNNNHGNKYLPTYLDDNYSS

***EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETSKFYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEARFEEIKKEVSGYIKKIGYNPATVAFVPISGWHGDNMLEVSDKMPWFKGWAIERKEGKADGKCLIEALDAILPPSRPTEKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMLVTFAPANLTTEVKSVEMHHEALQEAVPGDNVGFNVKNVSVKELRRGFVAGDSKASPPKATQDFTAQVIVLNHPGQISNGYTPVLDCHTAHIACKFAEIKEKCDRRTGKTTEENPKALKSGDAAIIVLVPSKPMCVESFSEFPPLGRFAVRDMRQTVAVGVIKVNNNHGNKYLPTY*******

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		459	2.2.26 [Sep-21-2011]
P29520		463	Elongation factor 1-alpha	N/A	N/A	0.962	0.954	0.925	0.0
P05303		462	Elongation factor 1-alpha	yes	N/A	0.962	0.956	0.916	0.0
P08736		463	Elongation factor 1-alpha	no	N/A	0.962	0.954	0.909	0.0
P02993		462	Elongation factor 1-alpha	N/A	N/A	0.962	0.956	0.902	0.0
P19039		461	Elongation factor 1-alpha	no	N/A	0.956	0.952	0.906	0.0
Q92005		462	Elongation factor 1-alpha	yes	N/A	0.956	0.950	0.881	0.0
Q9YIC0		461	Elongation factor 1-alpha	N/A	N/A	0.956	0.952	0.874	0.0
Q26487		413	Elongation factor 1-alpha	N/A	N/A	0.899	1.0	0.920	0.0
P62632		463	Elongation factor 1-alpha	yes	N/A	0.956	0.948	0.856	0.0
P62631		463	Elongation factor 1-alpha	yes	N/A	0.956	0.948	0.856	0.0

>sp\|P29520\|EF1A_BOMMO Elongation factor 1-alpha OS=Bombyx mori PE=2 SV=1	Back alignment and function desciption

 Score =  850 bits (2196), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/442 (92%), Positives = 423/442 (95%)

Query: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60

Query: 61  DKLKAERERGITIDIALWKFETSKFYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 120
           DKLKAERERGITIDIALWKFETSK+YVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT
Sbjct: 61  DKLKAERERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 120

Query: 121 GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEARFEEIKKEVSGYIKK 180
           GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSE RFEEIKKEVS YIKK
Sbjct: 121 GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKK 180

Query: 181 IGYNPATVAFVPISGWHGDNMLEVSDKMPWFKGWAIERKEGKADGKCLIEALDAILPPSR 240
           IGYNPA VAFVPISGWHGDNMLE S KMPWFKGW +ERKEGKADGK LIEALDAILPP+R
Sbjct: 181 IGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKSLIEALDAILPPAR 240

Query: 241 PTEKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMLVTFAPANLTTEVKSVEMHHEALQ 300
           PT+KPLRLPLQDVYKIGGIGTVPVGRVETGV+KPG +V FAPAN+TTEVKSVEMHHEALQ
Sbjct: 241 PTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGTIVVFAPANITTEVKSVEMHHEALQ 300

Query: 301 EAVPGDNVGFNVKNVSVKELRRGFVAGDSKASPPKATQDFTAQVIVLNHPGQISNGYTPV 360
           EAVPGDNVGFNVKNVSVKELRRG+VAGDSK +PPK   DFTAQVIVLNHPGQISNGYTPV
Sbjct: 301 EAVPGDNVGFNVKNVSVKELRRGYVAGDSKNNPPKGAADFTAQVIVLNHPGQISNGYTPV 360

Query: 361 LDCHTAHIACKFAEIKEKCDRRTGKTTEENPKALKSGDAAIIVLVPSKPMCVESFSEFPP 420
           LDCHTAHIACKFAEIKEK DRRTGK+TE NPK++KSGDAAI+ LVPSKP+CVESF EFPP
Sbjct: 361 LDCHTAHIACKFAEIKEKVDRRTGKSTEVNPKSIKSGDAAIVNLVPSKPLCVESFQEFPP 420

Query: 421 LGRFAVRDMRQTVAVGVIKVNN 442
           LGRFAVRDMRQTVAVGVIK  N
Sbjct: 421 LGRFAVRDMRQTVAVGVIKAVN 442

This protein promotes the GTP-dependent binding of aminoacyl-tRNA to the A-site of ribosomes during protein biosynthesis.
Bombyx mori (taxid: 7091)

>sp\|P05303\|EF1A2_DROME Elongation factor 1-alpha 2 OS=Drosophila melanogaster GN=Ef1alpha100E PE=2 SV=2	Back alignment and function description

>sp\|P08736\|EF1A1_DROME Elongation factor 1-alpha 1 OS=Drosophila melanogaster GN=Ef1alpha48D PE=1 SV=2	Back alignment and function description

>sp\|P02993\|EF1A_ARTSA Elongation factor 1-alpha OS=Artemia salina PE=1 SV=2	Back alignment and function description

>sp\|P19039\|EF1A_APIME Elongation factor 1-alpha OS=Apis mellifera PE=3 SV=1	Back alignment and function description

>sp\|Q92005\|EF1A_DANRE Elongation factor 1-alpha OS=Danio rerio GN=eef1a PE=2 SV=1	Back alignment and function description

>sp\|Q9YIC0\|EF1A_ORYLA Elongation factor 1-alpha OS=Oryzias latipes GN=eef1a PE=2 SV=1	Back alignment and function description

>sp\|Q26487\|EF1A_SPOFR Elongation factor 1-alpha (Fragment) OS=Spodoptera frugiperda PE=1 SV=1	Back alignment and function description

>sp\|P62632\|EF1A2_RAT Elongation factor 1-alpha 2 OS=Rattus norvegicus GN=Eef1a2 PE=2 SV=1	Back alignment and function description

>sp\|P62631\|EF1A2_MOUSE Elongation factor 1-alpha 2 OS=Mus musculus GN=Eef1a2 PE=1 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		459
40786900		462	putative elongation factor 1-alpha [Homa	0.965	0.958	0.948	0.0
307095102		462	putative elongation factor 1-alpha [Tria	0.965	0.958	0.941	0.0
388523593		462	elongation factor 1-alpha [Cryptocercus	0.956	0.950	0.949	0.0
389607689		462	elongation factor 1 alpha [Riptortus ped	0.965	0.958	0.934	0.0
305377016		462	elongation factor 1 alpha [Locusta migra	0.956	0.950	0.943	0.0
332027063		461	Elongation factor 1-alpha [Acromyrmex ec	0.956	0.952	0.940	0.0
307187377		461	Elongation factor 1-alpha [Camponotus fl	0.956	0.952	0.940	0.0
289629288		461	elongation factor 1-alpha [Nasonia vitri	0.962	0.958	0.938	0.0
307196337		461	Elongation factor 1-alpha [Harpegnathos	0.956	0.952	0.936	0.0
167234441		462	elongation factor 1-alpha [Tribolium cas	0.962	0.956	0.936	0.0

>gi\|40786900\|gb\|AAR89978.1\| putative elongation factor 1-alpha [Homalodisca vitripennis] gi\|45387425\|gb\|AAS60203.1\| putative elongation factor 1-alpha [Oncometopia nigricans]	Back alignment and taxonomy information

 Score =  872 bits (2252), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/443 (94%), Positives = 432/443 (97%)

Query: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60
           MGKEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL
Sbjct: 1   MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60

Query: 61  DKLKAERERGITIDIALWKFETSKFYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 120
           DKLKAERERGITIDIALWKFET+K+YVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT
Sbjct: 61  DKLKAERERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 120

Query: 121 GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEARFEEIKKEVSGYIKK 180
           GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEP YSE+RFEEIKKEVS YIKK
Sbjct: 121 GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPAYSESRFEEIKKEVSNYIKK 180

Query: 181 IGYNPATVAFVPISGWHGDNMLEVSDKMPWFKGWAIERKEGKADGKCLIEALDAILPPSR 240
           IGYNPA VAFVPISGWHGDNMLE SDKMPWFKGWAIERKEGKA+GKCLIEALDAILPPSR
Sbjct: 181 IGYNPAAVAFVPISGWHGDNMLEPSDKMPWFKGWAIERKEGKAEGKCLIEALDAILPPSR 240

Query: 241 PTEKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMLVTFAPANLTTEVKSVEMHHEALQ 300
           PTEKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGM+VTFAPANLTTEVKSVEMHHEALQ
Sbjct: 241 PTEKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPANLTTEVKSVEMHHEALQ 300

Query: 301 EAVPGDNVGFNVKNVSVKELRRGFVAGDSKASPPKATQDFTAQVIVLNHPGQISNGYTPV 360
           EAVPGDNVGFNVKNVSVKELRRGFVAGDSK++PPKA  DFTAQVIVLNHPGQISNGYTPV
Sbjct: 301 EAVPGDNVGFNVKNVSVKELRRGFVAGDSKSNPPKAAADFTAQVIVLNHPGQISNGYTPV 360

Query: 361 LDCHTAHIACKFAEIKEKCDRRTGKTTEENPKALKSGDAAIIVLVPSKPMCVESFSEFPP 420
           LDCHTAHIACKFAEIKEKCDRRTGKTTE+NPK++KSGDAAII LVPSKPMCVESF EFPP
Sbjct: 361 LDCHTAHIACKFAEIKEKCDRRTGKTTEDNPKSIKSGDAAIITLVPSKPMCVESFQEFPP 420

Query: 421 LGRFAVRDMRQTVAVGVIKVNNN 443
           LGRFAVRDMRQTVAVGVIK  N+
Sbjct: 421 LGRFAVRDMRQTVAVGVIKSVNH 443

Source: Homalodisca vitripennis

Species: Homalodisca vitripennis

Genus: Homalodisca

Family: Cicadellidae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi\|307095102\|gb\|ADN29857.1\| putative elongation factor 1-alpha [Triatoma matogrossensis]	Back alignment and taxonomy information

>gi\|388523593\|gb\|AFK49795.1\| elongation factor 1-alpha [Cryptocercus punctulatus]	Back alignment and taxonomy information

>gi\|389607689\|dbj\|BAK08877.2\| elongation factor 1 alpha [Riptortus pedestris]	Back alignment and taxonomy information

>gi\|305377016\|dbj\|BAJ15871.1\| elongation factor 1 alpha [Locusta migratoria]	Back alignment and taxonomy information

>gi\|332027063\|gb\|EGI67159.1\| Elongation factor 1-alpha [Acromyrmex echinatior]	Back alignment and taxonomy information

>gi\|307187377\|gb\|EFN72500.1\| Elongation factor 1-alpha [Camponotus floridanus]	Back alignment and taxonomy information

>gi\|289629288\|ref\|NP_001166227.1\| elongation factor 1-alpha [Nasonia vitripennis]	Back alignment and taxonomy information

>gi\|307196337\|gb\|EFN77947.1\| Elongation factor 1-alpha [Harpegnathos saltator]	Back alignment and taxonomy information

>gi\|167234441\|ref\|NP_001107835.1\| elongation factor 1-alpha [Tribolium castaneum] gi\|270016369\|gb\|EFA12815.1\| hypothetical protein TcasGA2_TC001880 [Tribolium castaneum]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		459
FB\|FBgn0000557		462	Ef1alpha100E "Elongation facto	0.960	0.954	0.918	6.7e-223
FB\|FBgn0000556		463	Ef1alpha48D "Elongation factor	0.962	0.954	0.909	6.2e-220
ZFIN\|ZDB-GENE-990415-52		462	eef1a1l1 "eukaryotic translati	0.956	0.950	0.881	1.1e-211
ZFIN\|ZDB-GENE-050706-188		462	eef1a1l2 "eukaryotic translati	0.956	0.950	0.872	3.5e-210
MGI\|MGI:1096317		463	Eef1a2 "eukaryotic translation	0.956	0.948	0.856	4e-209
RGD\|3781		463	Eef1a2 "eukaryotic translation	0.956	0.948	0.856	4e-209
UNIPROTKB\|Q32PH8		463	EEF1A2 "Elongation factor 1-al	0.956	0.948	0.854	8.3e-209
UNIPROTKB\|Q05639		463	EEF1A2 "Elongation factor 1-al	0.956	0.948	0.854	8.3e-209
UNIPROTKB\|F1N9H4		466	EEF1A2 "Elongation factor 1-al	0.956	0.942	0.849	1.4e-208
UNIPROTKB\|Q90835		462	EEF1A "Elongation factor 1-alp	0.956	0.950	0.861	1.5e-207

FB\|FBgn0000557 Ef1alpha100E "Elongation factor 1alpha100E" [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

 Score = 2152 (762.6 bits), Expect = 6.7e-223, P = 6.7e-223
 Identities = 406/442 (91%), Positives = 426/442 (96%)

Query:     1 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL
Sbjct:     1 MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60

Query:    61 DKLKAERERGITIDIALWKFETSKFYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 120
             DKLKAERERGITIDIALWKFETSK+YVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT
Sbjct:    61 DKLKAERERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 120

Query:   121 GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEARFEEIKKEVSGYIKK 180
             GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEAR+EEIKKEVS YIKK
Sbjct:   121 GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEARYEEIKKEVSSYIKK 180

Query:   181 IGYNPATVAFVPISGWHGDNMLEVSDKMPWFKGWAIERKEGKADGKCLIEALDAILPPSR 240
             IGYNPA+VAFVPISGWHGDNMLE S+KMPWFKGW++ERKEGKA+GKCLI+ALDAILPP R
Sbjct:   181 IGYNPASVAFVPISGWHGDNMLEPSEKMPWFKGWSVERKEGKAEGKCLIDALDAILPPQR 240

Query:   241 PTEKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMLVTFAPANLTTEVKSVEMHHEALQ 300
             PT+KPLRLPLQDVYKIGGIGTVPVGRVETG++KPGM+V FAP NL TEVKSVEMHHEAL 
Sbjct:   241 PTDKPLRLPLQDVYKIGGIGTVPVGRVETGLLKPGMVVNFAPVNLVTEVKSVEMHHEALT 300

Query:   301 EAVPGDNVGFNVKNVSVKELRRGFVAGDSKASPPKATQDFTAQVIVLNHPGQISNGYTPV 360
             EA+PGDNVGFNVKNVSVKELRRG+VAGDSK +PP+   DFTAQVIVLNHPGQI+NGYTPV
Sbjct:   301 EAMPGDNVGFNVKNVSVKELRRGYVAGDSKNNPPRGAADFTAQVIVLNHPGQIANGYTPV 360

Query:   361 LDCHTAHIACKFAEIKEKCDRRTGKTTEENPKALKSGDAAIIVLVPSKPMCVESFSEFPP 420
             LDCHTAHIACKF+EIKEKCDRRTGKTTE  PKA+KSGDAAIIVLVPSKP+CVESF EFPP
Sbjct:   361 LDCHTAHIACKFSEIKEKCDRRTGKTTETEPKAIKSGDAAIIVLVPSKPLCVESFQEFPP 420

Query:   421 LGRFAVRDMRQTVAVGVIK-VN 441
             LGRFAVRDMRQTVAVGVIK VN
Sbjct:   421 LGRFAVRDMRQTVAVGVIKSVN 442

GO:0006414 "translational elongation" evidence=IEA;ISS;NAS

GO:0003746 "translation elongation factor activity" evidence=ISS;NAS

GO:0005737 "cytoplasm" evidence=NAS

GO:0005853 "eukaryotic translation elongation factor 1 complex" evidence=ISS

GO:0006412 "translation" evidence=NAS

GO:0003924 "GTPase activity" evidence=IEA;NAS

GO:0005525 "GTP binding" evidence=IEA

GO:0005811 "lipid particle" evidence=IDA

GO:0022008 "neurogenesis" evidence=IMP

FB\|FBgn0000556 Ef1alpha48D "Elongation factor 1alpha48D" [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-990415-52 eef1a1l1 "eukaryotic translation elongation factor 1 alpha 1, like 1" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-050706-188 eef1a1l2 "eukaryotic translation elongation factor 1 alpha 1, like 2" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

MGI\|MGI:1096317 Eef1a2 "eukaryotic translation elongation factor 1 alpha 2" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

RGD\|3781 Eef1a2 "eukaryotic translation elongation factor 1 alpha 2" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|Q32PH8 EEF1A2 "Elongation factor 1-alpha 2" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|Q05639 EEF1A2 "Elongation factor 1-alpha 2" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|F1N9H4 EEF1A2 "Elongation factor 1-alpha" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|Q90835 EEF1A "Elongation factor 1-alpha 1" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
P84318	EF1A_HELGL	No assigned EC number	0.9176	0.8997	1.0	N/A	N/A
P84319	EF1A_HELAL	No assigned EC number	0.9176	0.8997	1.0	N/A	N/A
Q01372	EF1A_NEUCR	No assigned EC number	0.8068	0.9520	0.95	N/A	N/A
P84316	EF1A_HELZE	No assigned EC number	0.9176	0.8997	1.0	N/A	N/A
P84317	EF1A_HELAM	No assigned EC number	0.9176	0.8997	1.0	N/A	N/A
Q71V39	EF1A2_RABIT	No assigned EC number	0.8542	0.9564	0.9481	yes	N/A
Q5R4R8	EF1A1_PONAB	No assigned EC number	0.8633	0.9564	0.9502	yes	N/A
Q5R1X2	EF1A1_PANTR	No assigned EC number	0.8633	0.9564	0.9502	yes	N/A
Q26487	EF1A_SPOFR	No assigned EC number	0.9200	0.8997	1.0	N/A	N/A
Q90835	EF1A_CHICK	No assigned EC number	0.8610	0.9564	0.9502	no	N/A
Q05639	EF1A2_HUMAN	No assigned EC number	0.8542	0.9564	0.9481	yes	N/A
P62631	EF1A2_MOUSE	No assigned EC number	0.8564	0.9564	0.9481	yes	N/A
P62630	EF1A1_RAT	No assigned EC number	0.8633	0.9564	0.9502	no	N/A
P62632	EF1A2_RAT	No assigned EC number	0.8564	0.9564	0.9481	yes	N/A
P02993	EF1A_ARTSA	No assigned EC number	0.9027	0.9629	0.9567	N/A	N/A
P10126	EF1A1_MOUSE	No assigned EC number	0.8633	0.9564	0.9502	no	N/A
Q01765	EF1A_PODCU	No assigned EC number	0.8113	0.9520	0.9479	N/A	N/A
P13549	EF1A0_XENLA	No assigned EC number	0.8678	0.9564	0.9502	N/A	N/A
P84322	EF1A_ANIIF	No assigned EC number	0.9176	0.8997	1.0	N/A	N/A
P84321	EF1A_ADIBE	No assigned EC number	0.9176	0.8997	1.0	N/A	N/A
P84320	EF1A_HELDI	No assigned EC number	0.9176	0.8997	1.0	N/A	N/A
Q92005	EF1A_DANRE	No assigned EC number	0.8815	0.9564	0.9502	yes	N/A
Q2HJN4	EF1A1_OSCTI	No assigned EC number	0.8314	0.9564	0.9564	N/A	N/A
P53013	EF1A_CAEEL	No assigned EC number	0.8405	0.9564	0.9481	yes	N/A
P19039	EF1A_APIME	No assigned EC number	0.9066	0.9564	0.9522	no	N/A
P29520	EF1A_BOMMO	No assigned EC number	0.9253	0.9629	0.9546	N/A	N/A
A5DPE3	EF1A_PICGU	No assigned EC number	0.8018	0.9520	0.9541	N/A	N/A
P0CY35	EF1A1_CANAL	No assigned EC number	0.8041	0.9520	0.9541	N/A	N/A
P17507	EF1A2_XENLA	No assigned EC number	0.8587	0.9564	0.9522	N/A	N/A
Q5VTE0	EF1A3_HUMAN	No assigned EC number	0.8587	0.9564	0.9502	no	N/A
Q2HJN9	EF1A4_OSCTI	No assigned EC number	0.8314	0.9564	0.9564	N/A	N/A
Q2HJN8	EF1A2_OSCTI	No assigned EC number	0.8337	0.9564	0.9564	N/A	N/A
Q01520	EF1A_PODAS	No assigned EC number	0.8113	0.9520	0.95	yes	N/A
P84315	EF1A_HELVI	No assigned EC number	0.9176	0.8997	1.0	N/A	N/A
Q66RN5	EF1A1_FELCA	No assigned EC number	0.8633	0.9564	0.9502	N/A	N/A
Q2HJN6	EF1A3_OSCTI	No assigned EC number	0.8318	0.9564	0.9543	N/A	N/A
A2Q0Z0	EF1A1_HORSE	No assigned EC number	0.8610	0.9564	0.9502	yes	N/A
P17508	EF1A3_XENLA	No assigned EC number	0.8519	0.9564	0.9522	N/A	N/A
P28295	EF1A_ABSGL	No assigned EC number	0.7995	0.9520	0.9541	N/A	N/A
P68103	EF1A1_BOVIN	No assigned EC number	0.8633	0.9564	0.9502	no	N/A
P68105	EF1A1_RABIT	No assigned EC number	0.8633	0.9564	0.9502	yes	N/A
P68104	EF1A1_HUMAN	No assigned EC number	0.8633	0.9564	0.9502	no	N/A
Q59QD6	EF1A2_CANAL	No assigned EC number	0.8041	0.9520	0.9541	N/A	N/A
P62629	EF1A1_CRIGR	No assigned EC number	0.8633	0.9564	0.9502	no	N/A
Q32PH8	EF1A2_BOVIN	No assigned EC number	0.8542	0.9564	0.9481	yes	N/A
Q9YIC0	EF1A_ORYLA	No assigned EC number	0.8747	0.9564	0.9522	N/A	N/A
P05303	EF1A2_DROME	No assigned EC number	0.9162	0.9629	0.9567	yes	N/A
P08736	EF1A1_DROME	No assigned EC number	0.9095	0.9629	0.9546	no	N/A
Q09069	EF1A_SORMA	No assigned EC number	0.8045	0.9520	0.95	N/A	N/A
P27592	EF1A_ONCVO	No assigned EC number	0.8337	0.9564	0.9461	N/A	N/A

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database

ID	Alignment Graph	Length	Definition	E-value
Query		459
PTZ00141		446	PTZ00141, PTZ00141, elongation factor 1- alpha; Pr	0.0
TIGR00483		426	TIGR00483, EF-1_alpha, translation elongation fact	0.0
PLN00043		447	PLN00043, PLN00043, elongation factor 1-alpha; Pro	0.0
COG5256		428	COG5256, TEF1, Translation elongation factor EF-1a	0.0
PRK12317		425	PRK12317, PRK12317, elongation factor 1-alpha; Rev	0.0
cd01883		219	cd01883, EF1_alpha, Elongation Factor 1-alpha (EF1	1e-161
COG2895		431	COG2895, CysN, GTPases - Sulfate adenylate transfe	1e-80
pfam00009		184	pfam00009, GTP_EFTU, Elongation factor Tu GTP bind	4e-76
cd03705		104	cd03705, EF1_alpha_III, Domain III of EF-1	4e-65
COG0050		394	COG0050, TufB, GTPases - translation elongation fa	7e-63
TIGR02034		406	TIGR02034, CysN, sulfate adenylyltransferase, larg	8e-62
cd04166		209	cd04166, CysN_ATPS, CysN, together with protein Cy	2e-61
PRK05506		632	PRK05506, PRK05506, bifunctional sulfate adenylylt	1e-58
cd03693		91	cd03693, EF1_alpha_II, EF1_alpha_II: this family r	1e-56
cd00881		183	cd00881, GTP_translation_factor, GTP translation f	4e-56
PRK05124		474	PRK05124, cysN, sulfate adenylyltransferase subuni	1e-53
PRK12735		396	PRK12735, PRK12735, elongation factor Tu; Reviewed	6e-53
PRK00049		396	PRK00049, PRK00049, elongation factor Tu; Reviewed	7e-53
CHL00071		409	CHL00071, tufA, elongation factor Tu	3e-52
TIGR00485		394	TIGR00485, EF-Tu, translation elongation factor TU	1e-51
PLN03127		447	PLN03127, PLN03127, Elongation factor Tu; Provisio	2e-51
PRK12736		394	PRK12736, PRK12736, elongation factor Tu; Reviewed	3e-50
PLN03126		478	PLN03126, PLN03126, Elongation factor Tu; Provisio	8e-50
COG3276		447	COG3276, SelB, Selenocysteine-specific translation	1e-40
COG5258		527	COG5258, GTPBP1, GTPase [General function predicti	5e-39
pfam03143		91	pfam03143, GTP_EFTU_D3, Elongation factor Tu C-ter	3e-37
cd01884		195	cd01884, EF_Tu, Elongation Factor Tu (EF-Tu) GTP-b	1e-33
TIGR00475		581	TIGR00475, selB, selenocysteine-specific elongatio	6e-32
cd01513		102	cd01513, Translation_factor_III, Domain III of Elo	2e-31
cd04171		170	cd04171, SelB, SelB, the dedicated elongation fact	1e-24
cd03704		108	cd03704, eRF3c_III, This family represents eEF1alp	4e-22
COG0481		603	COG0481, LepA, Membrane GTPase LepA [Cell envelope	2e-19
TIGR03680		406	TIGR03680, eif2g_arch, translation initiation fact	2e-19
pfam03144		70	pfam03144, GTP_EFTU_D2, Elongation factor Tu domai	4e-18
cd03696		83	cd03696, selB_II, selB_II: this subfamily represen	7e-18
TIGR01393		595	TIGR01393, lepA, GTP-binding protein LepA	1e-17
cd01890		179	cd01890, LepA, LepA also known as Elongation Facto	2e-17
cd04093		107	cd04093, HBS1_C, HBS1_C: this family represents th	2e-17
PRK04000		411	PRK04000, PRK04000, translation initiation factor	4e-17
COG0480		697	COG0480, FusA, Translation elongation factors (GTP	9e-17
COG5257		415	COG5257, GCD11, Translation initiation factor 2, g	1e-16
cd03697		87	cd03697, EFTU_II, EFTU_II: Elongation factor Tu do	3e-16
PRK05433		600	PRK05433, PRK05433, GTP-binding protein LepA; Prov	6e-16
cd01342		83	cd01342, Translation_Factor_II_like, Translation_F	7e-16
PRK10512		614	PRK10512, PRK10512, selenocysteinyl-tRNA-specific	2e-15
cd03698		83	cd03698, eRF3_II_like, eRF3_II_like: domain simila	2e-15
cd04168		237	cd04168, TetM_like, Tet(M)-like family includes Te	4e-15
TIGR01394		594	TIGR01394, TypA_BipA, GTP-binding protein TypA/Bip	6e-15
cd01889		192	cd01889, SelB_euk, SelB, the dedicated elongation	2e-13
cd01888		197	cd01888, eIF2_gamma, Gamma subunit of initiation f	2e-13
cd01891		194	cd01891, TypA_BipA, Tyrosine phosphorylated protei	7e-13
cd01885		218	cd01885, EF2, Elongation Factor 2 (EF2) in archaea	3e-12
PRK10218		607	PRK10218, PRK10218, GTP-binding protein; Provision	3e-12
COG1217		603	COG1217, TypA, Predicted membrane GTPase involved	3e-12
cd04089		82	cd04089, eRF3_II, eRF3_II: domain II of the eukary	3e-12
PRK13351		687	PRK13351, PRK13351, elongation factor G; Reviewed	1e-11
PRK12740		668	PRK12740, PRK12740, elongation factor G; Reviewed	1e-11
cd01886		270	cd01886, EF-G, Elongation factor G (EF-G) family i	3e-11
cd04170		268	cd04170, EF-G_bact, Elongation factor G (EF-G) fam	6e-11
TIGR00484		689	TIGR00484, EF-G, translation elongation factor EF-	4e-10
cd01887		169	cd01887, IF2_eIF5B, Initiation Factor 2 (IF2)/ euk	1e-09
cd04167		213	cd04167, Snu114p, Snu114p, a spliceosome protein,	1e-09
cd04165		224	cd04165, GTPBP1_like, GTP binding protein 1 (GTPBP	2e-09
cd03695		81	cd03695, CysN_NodQ_II, CysN_NodQ_II: This subfamil	4e-09
cd04169		268	cd04169, RF3, Release Factor 3 (RF3) protein invol	6e-09
TIGR00503		527	TIGR00503, prfC, peptide chain release factor 3	1e-08
cd03694		87	cd03694, GTPBP_II, Domain II of the GP-1 family of	3e-08
COG4108		528	COG4108, PrfC, Peptide chain release factor RF-3 [	4e-08
PTZ00327		460	PTZ00327, PTZ00327, eukaryotic translation initiat	1e-07
TIGR00490		720	TIGR00490, aEF-2, translation elongation factor aE	1e-07
PTZ00416		836	PTZ00416, PTZ00416, elongation factor 2; Provision	2e-07
PRK07560		731	PRK07560, PRK07560, elongation factor EF-2; Review	3e-07
PRK12739		691	PRK12739, PRK12739, elongation factor G; Reviewed	5e-07
TIGR00487		587	TIGR00487, IF-2, translation initiation factor IF-	2e-06
PLN00116		843	PLN00116, PLN00116, translation elongation factor	2e-06
COG0532		509	COG0532, InfB, Translation initiation factor 2 (IF	6e-06
PRK00007		693	PRK00007, PRK00007, elongation factor G; Reviewed	3e-05
cd00882		161	cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like s	5e-05
TIGR00231		162	TIGR00231, small_GTP, small GTP-binding protein do	3e-04
CHL00189		742	CHL00189, infB, translation initiation factor 2; P	4e-04
cd03708		87	cd03708, GTPBP_III, Domain III of the GP-1 family	0.002

>gnl\|CDD\|185474 PTZ00141, PTZ00141, elongation factor 1- alpha; Provisional	Back alignment and domain information

 Score =  860 bits (2225), Expect = 0.0
 Identities = 347/440 (78%), Positives = 384/440 (87%), Gaps = 12/440 (2%)

Query: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60
           MGKEKTHIN+VVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINLVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 61  DKLKAERERGITIDIALWKFETSKFYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 120
           DKLKAERERGITIDIALWKFET K+Y TIIDAPGHRDFIKNMITGTSQAD A+L+VA+  
Sbjct: 61  DKLKAERERGITIDIALWKFETPKYYFTIIDAPGHRDFIKNMITGTSQADVAILVVASTA 120

Query: 121 GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEARFEEIKKEVSGYIKK 180
           GEFEAGISK+GQTREHALLAFTLGVKQ+IV +NKMD     YS+ R++EIKKEVS Y+KK
Sbjct: 121 GEFEAGISKDGQTREHALLAFTLGVKQMIVCINKMDDKTVNYSQERYDEIKKEVSAYLKK 180

Query: 181 IGYNPATVAFVPISGWHGDNMLEVSDKMPWFKGWAIERKEGKADGKCLIEALDAILPPSR 240
           +GYNP  V F+PISGW GDNM+E SD MPW+K            G  L+EALD + PP R
Sbjct: 181 VGYNPEKVPFIPISGWQGDNMIEKSDNMPWYK------------GPTLLEALDTLEPPKR 228

Query: 241 PTEKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMLVTFAPANLTTEVKSVEMHHEALQ 300
           P +KPLRLPLQDVYKIGGIGTVPVGRVETG++KPGM+VTFAP+ +TTEVKSVEMHHE L 
Sbjct: 229 PVDKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPSGVTTEVKSVEMHHEQLA 288

Query: 301 EAVPGDNVGFNVKNVSVKELRRGFVAGDSKASPPKATQDFTAQVIVLNHPGQISNGYTPV 360
           EAVPGDNVGFNVKNVSVK+++RG+VA DSK  P K   DFTAQVIVLNHPGQI NGYTPV
Sbjct: 289 EAVPGDNVGFNVKNVSVKDIKRGYVASDSKNDPAKECADFTAQVIVLNHPGQIKNGYTPV 348

Query: 361 LDCHTAHIACKFAEIKEKCDRRTGKTTEENPKALKSGDAAIIVLVPSKPMCVESFSEFPP 420
           LDCHTAHIACKFAEI+ K DRR+GK  EENPKA+KSGDAAI+ +VP+KPMCVE F+E+PP
Sbjct: 349 LDCHTAHIACKFAEIESKIDRRSGKVLEENPKAIKSGDAAIVKMVPTKPMCVEVFNEYPP 408

Query: 421 LGRFAVRDMRQTVAVGVIKV 440
           LGRFAVRDM+QTVAVGVIK 
Sbjct: 409 LGRFAVRDMKQTVAVGVIKS 428

Length = 446

>gnl\|CDD\|129574 TIGR00483, EF-1_alpha, translation elongation factor EF-1 alpha	Back alignment and domain information

>gnl\|CDD\|165621 PLN00043, PLN00043, elongation factor 1-alpha; Provisional	Back alignment and domain information

>gnl\|CDD\|227581 COG5256, TEF1, Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>gnl\|CDD\|237055 PRK12317, PRK12317, elongation factor 1-alpha; Reviewed	Back alignment and domain information

>gnl\|CDD\|206670 cd01883, EF1_alpha, Elongation Factor 1-alpha (EF1-alpha) protein family	Back alignment and domain information

>gnl\|CDD\|225448 COG2895, CysN, GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|215653 pfam00009, GTP_EFTU, Elongation factor Tu GTP binding domain	Back alignment and domain information

>gnl\|CDD\|239676 cd03705, EF1_alpha_III, Domain III of EF-1	Back alignment and domain information

>gnl\|CDD\|223128 COG0050, TufB, GTPases - translation elongation factors [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>gnl\|CDD\|213679 TIGR02034, CysN, sulfate adenylyltransferase, large subunit	Back alignment and domain information

>gnl\|CDD\|206729 cd04166, CysN_ATPS, CysN, together with protein CysD, forms the ATP sulfurylase (ATPS) complex	Back alignment and domain information

>gnl\|CDD\|180120 PRK05506, PRK05506, bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional	Back alignment and domain information

>gnl\|CDD\|239664 cd03693, EF1_alpha_II, EF1_alpha_II: this family represents the domain II of elongation factor 1-alpha (EF-1a) that is found in archaea and all eukaryotic lineages	Back alignment and domain information

>gnl\|CDD\|206647 cd00881, GTP_translation_factor, GTP translation factor family primarily contains translation initiation, elongation and release factors	Back alignment and domain information

>gnl\|CDD\|235349 PRK05124, cysN, sulfate adenylyltransferase subunit 1; Provisional	Back alignment and domain information

>gnl\|CDD\|183708 PRK12735, PRK12735, elongation factor Tu; Reviewed	Back alignment and domain information

>gnl\|CDD\|234596 PRK00049, PRK00049, elongation factor Tu; Reviewed	Back alignment and domain information

>gnl\|CDD\|177010 CHL00071, tufA, elongation factor Tu	Back alignment and domain information

>gnl\|CDD\|129576 TIGR00485, EF-Tu, translation elongation factor TU	Back alignment and domain information

>gnl\|CDD\|178673 PLN03127, PLN03127, Elongation factor Tu; Provisional	Back alignment and domain information

>gnl\|CDD\|237184 PRK12736, PRK12736, elongation factor Tu; Reviewed	Back alignment and domain information

>gnl\|CDD\|215592 PLN03126, PLN03126, Elongation factor Tu; Provisional	Back alignment and domain information

>gnl\|CDD\|225815 COG3276, SelB, Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>gnl\|CDD\|227583 COG5258, GTPBP1, GTPase [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|217387 pfam03143, GTP_EFTU_D3, Elongation factor Tu C-terminal domain	Back alignment and domain information

>gnl\|CDD\|206671 cd01884, EF_Tu, Elongation Factor Tu (EF-Tu) GTP-binding proteins	Back alignment and domain information

>gnl\|CDD\|129567 TIGR00475, selB, selenocysteine-specific elongation factor SelB	Back alignment and domain information

>gnl\|CDD\|238771 cd01513, Translation_factor_III, Domain III of Elongation factor (EF) Tu (EF-TU) and EF-G	Back alignment and domain information

>gnl\|CDD\|206734 cd04171, SelB, SelB, the dedicated elongation factor for delivery of selenocysteinyl-tRNA to the ribosome	Back alignment and domain information

>gnl\|CDD\|239675 cd03704, eRF3c_III, This family represents eEF1alpha-like C-terminal region of eRF3 homologous to the domain III of EF-Tu	Back alignment and domain information

>gnl\|CDD\|223557 COG0481, LepA, Membrane GTPase LepA [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>gnl\|CDD\|211860 TIGR03680, eif2g_arch, translation initiation factor 2 subunit gamma	Back alignment and domain information

>gnl\|CDD\|217388 pfam03144, GTP_EFTU_D2, Elongation factor Tu domain 2	Back alignment and domain information

>gnl\|CDD\|239667 cd03696, selB_II, selB_II: this subfamily represents the domain of elongation factor SelB, homologous to domain II of EF-Tu	Back alignment and domain information

>gnl\|CDD\|130460 TIGR01393, lepA, GTP-binding protein LepA	Back alignment and domain information

>gnl\|CDD\|206677 cd01890, LepA, LepA also known as Elongation Factor 4 (EF4)	Back alignment and domain information

>gnl\|CDD\|239760 cd04093, HBS1_C, HBS1_C: this family represents the C-terminal domain of Hsp70 subfamily B suppressor 1 (HBS1) which is homologous to the domain III of EF-1alpha	Back alignment and domain information

>gnl\|CDD\|235194 PRK04000, PRK04000, translation initiation factor IF-2 subunit gamma; Validated	Back alignment and domain information

>gnl\|CDD\|223556 COG0480, FusA, Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>gnl\|CDD\|227582 COG5257, GCD11, Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>gnl\|CDD\|239668 cd03697, EFTU_II, EFTU_II: Elongation factor Tu domain II	Back alignment and domain information

>gnl\|CDD\|235462 PRK05433, PRK05433, GTP-binding protein LepA; Provisional	Back alignment and domain information

>gnl\|CDD\|238652 cd01342, Translation_Factor_II_like, Translation_Factor_II_like: Elongation factor Tu (EF-Tu) domain II-like proteins	Back alignment and domain information

>gnl\|CDD\|182508 PRK10512, PRK10512, selenocysteinyl-tRNA-specific translation factor; Provisional	Back alignment and domain information

>gnl\|CDD\|239669 cd03698, eRF3_II_like, eRF3_II_like: domain similar to domain II of the eukaryotic class II release factor (eRF3)	Back alignment and domain information

>gnl\|CDD\|206731 cd04168, TetM_like, Tet(M)-like family includes Tet(M), Tet(O), Tet(W), and OtrA, containing tetracycline resistant proteins	Back alignment and domain information

>gnl\|CDD\|233394 TIGR01394, TypA_BipA, GTP-binding protein TypA/BipA	Back alignment and domain information

>gnl\|CDD\|206676 cd01889, SelB_euk, SelB, the dedicated elongation factor for delivery of selenocysteinyl-tRNA to the ribosome	Back alignment and domain information

>gnl\|CDD\|206675 cd01888, eIF2_gamma, Gamma subunit of initiation factor 2 (eIF2 gamma)	Back alignment and domain information

>gnl\|CDD\|206678 cd01891, TypA_BipA, Tyrosine phosphorylated protein A (TypA)/BipA family belongs to ribosome-binding GTPases	Back alignment and domain information

>gnl\|CDD\|206672 cd01885, EF2, Elongation Factor 2 (EF2) in archaea and eukarya	Back alignment and domain information

>gnl\|CDD\|104396 PRK10218, PRK10218, GTP-binding protein; Provisional	Back alignment and domain information

>gnl\|CDD\|224138 COG1217, TypA, Predicted membrane GTPase involved in stress response [Signal transduction mechanisms]	Back alignment and domain information

>gnl\|CDD\|239756 cd04089, eRF3_II, eRF3_II: domain II of the eukaryotic class II release factor (eRF3)	Back alignment and domain information

>gnl\|CDD\|237358 PRK13351, PRK13351, elongation factor G; Reviewed	Back alignment and domain information

>gnl\|CDD\|237186 PRK12740, PRK12740, elongation factor G; Reviewed	Back alignment and domain information

>gnl\|CDD\|206673 cd01886, EF-G, Elongation factor G (EF-G) family involved in both the elongation and ribosome recycling phases of protein synthesis	Back alignment and domain information

>gnl\|CDD\|206733 cd04170, EF-G_bact, Elongation factor G (EF-G) family	Back alignment and domain information

>gnl\|CDD\|129575 TIGR00484, EF-G, translation elongation factor EF-G	Back alignment and domain information

>gnl\|CDD\|206674 cd01887, IF2_eIF5B, Initiation Factor 2 (IF2)/ eukaryotic Initiation Factor 5B (eIF5B) family	Back alignment and domain information

>gnl\|CDD\|206730 cd04167, Snu114p, Snu114p, a spliceosome protein, is a GTPase	Back alignment and domain information

>gnl\|CDD\|206728 cd04165, GTPBP1_like, GTP binding protein 1 (GTPBP1)-like family includes GTPBP2	Back alignment and domain information

>gnl\|CDD\|239666 cd03695, CysN_NodQ_II, CysN_NodQ_II: This subfamily represents the domain II of the large subunit of ATP sulfurylase (ATPS): CysN or the N-terminal portion of NodQ, found mainly in proteobacteria and homologous to the domain II of EF-Tu	Back alignment and domain information

>gnl\|CDD\|206732 cd04169, RF3, Release Factor 3 (RF3) protein involved in the terminal step of translocation in bacteria	Back alignment and domain information

>gnl\|CDD\|129594 TIGR00503, prfC, peptide chain release factor 3	Back alignment and domain information

>gnl\|CDD\|239665 cd03694, GTPBP_II, Domain II of the GP-1 family of GTPase	Back alignment and domain information

>gnl\|CDD\|226593 COG4108, PrfC, Peptide chain release factor RF-3 [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>gnl\|CDD\|240362 PTZ00327, PTZ00327, eukaryotic translation initiation factor 2 gamma subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|129581 TIGR00490, aEF-2, translation elongation factor aEF-2	Back alignment and domain information

>gnl\|CDD\|240409 PTZ00416, PTZ00416, elongation factor 2; Provisional	Back alignment and domain information

>gnl\|CDD\|236047 PRK07560, PRK07560, elongation factor EF-2; Reviewed	Back alignment and domain information

>gnl\|CDD\|237185 PRK12739, PRK12739, elongation factor G; Reviewed	Back alignment and domain information

>gnl\|CDD\|232995 TIGR00487, IF-2, translation initiation factor IF-2	Back alignment and domain information

>gnl\|CDD\|177730 PLN00116, PLN00116, translation elongation factor EF-2 subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|223606 COG0532, InfB, Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>gnl\|CDD\|234569 PRK00007, PRK00007, elongation factor G; Reviewed	Back alignment and domain information

>gnl\|CDD\|206648 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like superfamily of small guanosine triphosphatases (GTPases)	Back alignment and domain information

>gnl\|CDD\|232886 TIGR00231, small_GTP, small GTP-binding protein domain	Back alignment and domain information

>gnl\|CDD\|177089 CHL00189, infB, translation initiation factor 2; Provisional	Back alignment and domain information

>gnl\|CDD\|239679 cd03708, GTPBP_III, Domain III of the GP-1 family of GTPase	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		459
COG5256		428	TEF1 Translation elongation factor EF-1alpha (GTPa	100.0
PLN00043		447	elongation factor 1-alpha; Provisional	100.0
PTZ00141		446	elongation factor 1- alpha; Provisional	100.0
TIGR00483		426	EF-1_alpha translation elongation factor EF-1 alph	100.0
PRK12317		425	elongation factor 1-alpha; Reviewed	100.0
KOG0458\|consensus		603		100.0
KOG0459\|consensus		501		100.0
COG2895		431	CysN GTPases - Sulfate adenylate transferase subun	100.0
PRK05124		474	cysN sulfate adenylyltransferase subunit 1; Provis	100.0
TIGR02034		406	CysN sulfate adenylyltransferase, large subunit. H	100.0
PRK05506		632	bifunctional sulfate adenylyltransferase subunit 1	100.0
PLN03126		478	Elongation factor Tu; Provisional	100.0
CHL00071		409	tufA elongation factor Tu	100.0
PRK12735		396	elongation factor Tu; Reviewed	100.0
PRK00049		396	elongation factor Tu; Reviewed	100.0
PRK12736		394	elongation factor Tu; Reviewed	100.0
TIGR00485		394	EF-Tu translation elongation factor TU. This align	100.0
PLN03127		447	Elongation factor Tu; Provisional	100.0
KOG0460\|consensus		449		100.0
COG0050		394	TufB GTPases - translation elongation factors [Tra	100.0
PTZ00327		460	eukaryotic translation initiation factor 2 gamma s	100.0
COG5258		527	GTPBP1 GTPase [General function prediction only]	100.0
PRK10512		614	selenocysteinyl-tRNA-specific translation factor;	100.0
PRK04000		411	translation initiation factor IF-2 subunit gamma;	100.0
TIGR03680		406	eif2g_arch translation initiation factor 2 subunit	100.0
TIGR00475		581	selB selenocysteine-specific elongation factor Sel	100.0
KOG0463\|consensus		641		100.0
COG3276		447	SelB Selenocysteine-specific translation elongatio	100.0
KOG0052\|consensus		391		100.0
KOG1143\|consensus		591		100.0
COG5257		415	GCD11 Translation initiation factor 2, gamma subun	100.0
TIGR01394		594	TypA_BipA GTP-binding protein TypA/BipA. This bact	100.0
PRK10218		607	GTP-binding protein; Provisional	100.0
COG1217		603	TypA Predicted membrane GTPase involved in stress	100.0
PRK05433		600	GTP-binding protein LepA; Provisional	100.0
TIGR01393		595	lepA GTP-binding protein LepA. LepA (GUF1 in Sacca	100.0
cd01883		219	EF1_alpha Eukaryotic elongation factor 1 (EF1) alp	100.0
KOG0462\|consensus		650		100.0
KOG0461\|consensus		522		100.0
COG0481		603	LepA Membrane GTPase LepA [Cell envelope biogenesi	100.0
cd04166		208	CysN_ATPS CysN_ATPS subfamily. CysN, together with	100.0
PRK07560		731	elongation factor EF-2; Reviewed	100.0
cd01884		195	EF_Tu EF-Tu subfamily. This subfamily includes ort	100.0
PRK00741		526	prfC peptide chain release factor 3; Provisional	100.0
PRK00007		693	elongation factor G; Reviewed	100.0
COG0480		697	FusA Translation elongation factors (GTPases) [Tra	100.0
TIGR00503		527	prfC peptide chain release factor 3. This translat	100.0
PRK12739		691	elongation factor G; Reviewed	100.0
PRK05306		787	infB translation initiation factor IF-2; Validated	100.0
TIGR00484		689	EF-G translation elongation factor EF-G. After pep	100.0
TIGR00487		587	IF-2 translation initiation factor IF-2. This mode	100.0
PRK13351		687	elongation factor G; Reviewed	100.0
TIGR00490		720	aEF-2 translation elongation factor aEF-2. This mo	100.0
PF00009		188	GTP_EFTU: Elongation factor Tu GTP binding domain;	100.0
COG4108		528	PrfC Peptide chain release factor RF-3 [Translatio	100.0
PRK12740		668	elongation factor G; Reviewed	100.0
CHL00189		742	infB translation initiation factor 2; Provisional	100.0
PLN00116		843	translation elongation factor EF-2 subunit; Provis	99.98
PRK04004		586	translation initiation factor IF-2; Validated	99.97
TIGR00491		590	aIF-2 translation initiation factor aIF-2/yIF-2. T	99.97
PTZ00416		836	elongation factor 2; Provisional	99.97
KOG0466\|consensus		466		99.97
KOG1145\|consensus		683		99.97
KOG0465\|consensus		721		99.97
COG0532		509	InfB Translation initiation factor 2 (IF-2; GTPase	99.97
cd01885		222	EF2 EF2 (for archaea and eukarya). Translocation r	99.96
PRK14845		1049	translation initiation factor IF-2; Provisional	99.94
cd01889		192	SelB_euk SelB subfamily. SelB is an elongation fac	99.94
cd01888		203	eIF2_gamma eIF2-gamma (gamma subunit of initiation	99.94
cd04167		213	Snu114p Snu114p subfamily. Snu114p is one of sever	99.93
cd01886		270	EF-G Elongation factor G (EF-G) subfamily. Translo	99.93
cd04165		224	GTPBP1_like GTPBP1-like. Mammalian GTP binding pro	99.93
cd01891		194	TypA_BipA TypA (tyrosine phosphorylated protein A)	99.93
cd04168		237	TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T	99.93
cd03704		108	eRF3c_III This family represents eEF1alpha-like C-	99.93
cd04169		267	RF3 RF3 subfamily. Peptide chain release factor 3	99.92
cd01890		179	LepA LepA subfamily. LepA belongs to the GTPase fa	99.92
KOG0464\|consensus		753		99.92
cd04093		107	HBS1_C HBS1_C: this family represents the C-termin	99.92
KOG0469\|consensus		842		99.92
cd03705		104	EF1_alpha_III Domain III of EF-1. Eukaryotic elong	99.91
cd04171		164	SelB SelB subfamily. SelB is an elongation factor	99.91
cd00881		189	GTP_translation_factor GTP translation factor fami	99.9
KOG1144\|consensus		1064		99.89
KOG0467\|consensus		887		99.89
cd04170		268	EF-G_bact Elongation factor G (EF-G) subfamily. Tr	99.88
cd04095		103	CysN_NoDQ_III TCysN_NoDQ_II: This subfamily repres	99.87
PF03143		99	GTP_EFTU_D3: Elongation factor Tu C-terminal domai	99.87
cd01887		168	IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo	99.85
COG1159		298	Era GTPase [General function prediction only]	99.85
cd01513		102	Translation_factor_III Domain III of Elongation fa	99.85
cd04160		167	Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote	99.82
PF02421		156	FeoB_N: Ferrous iron transport protein B; InterPro	99.82
COG1160		444	Predicted GTPases [General function prediction onl	99.81
PRK00093		435	GTP-binding protein Der; Reviewed	99.81
cd03693		91	EF1_alpha_II EF1_alpha_II: this family represents	99.8
TIGR00436		270	era GTP-binding protein Era. Era is an essential G	99.8
KOG0468\|consensus		971		99.8
PRK15494		339	era GTPase Era; Provisional	99.79
TIGR03594		429	GTPase_EngA ribosome-associated GTPase EngA. EngA	99.79
COG1160		444	Predicted GTPases [General function prediction onl	99.79
cd04154		173	Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are	99.78
cd01895		174	EngA2 EngA2 subfamily. This CD represents the seco	99.78
cd04157		162	Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub	99.78
cd01864		165	Rab19 Rab19 subfamily. Rab19 proteins are associat	99.77
cd03698		83	eRF3_II_like eRF3_II_like: domain similar to domai	99.77
cd01894		157	EngA1 EngA1 subfamily. This CD represents the firs	99.76
cd04151		158	Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t	99.76
TIGR03598		179	GTPase_YsxC ribosome biogenesis GTP-binding protei	99.76
cd04149		168	Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor	99.75
cd04150		159	Arf1_5_like Arf1-Arf5-like subfamily. This subfami	99.75
cd04124		161	RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily	99.75
cd01898		170	Obg Obg subfamily. The Obg nucleotide binding prot	99.74
PRK03003		472	GTP-binding protein Der; Reviewed	99.74
cd01879		158	FeoB Ferrous iron transport protein B (FeoB) subfa	99.74
cd04153		174	Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a	99.74
cd04114		169	Rab30 Rab30 subfamily. Rab30 appears to be associa	99.74
cd04089		82	eRF3_II eRF3_II: domain II of the eukaryotic class	99.74
PLN00223		181	ADP-ribosylation factor; Provisional	99.74
smart00177		175	ARF ARF-like small GTPases; ARF, ADP-ribosylation	99.74
PRK00089		292	era GTPase Era; Reviewed	99.73
cd03694		87	GTPBP_II Domain II of the GP-1 family of GTPase. T	99.73
cd01861		161	Rab6 Rab6 subfamily. Rab6 is involved in microtubu	99.73
cd04158		169	ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor	99.73
COG2229		187	Predicted GTPase [General function prediction only	99.73
cd01897		168	NOG NOG1 is a nucleolar GTP-binding protein presen	99.73
cd01860		163	Rab5_related Rab5-related subfamily. This subfamil	99.73
cd04113		161	Rab4 Rab4 subfamily. Rab4 has been implicated in n	99.73
cd00879		190	Sar1 Sar1 subfamily. Sar1 is an essential componen	99.73
cd01862		172	Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th	99.72
cd00878		158	Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik	99.72
cd04145		164	M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf	99.72
cd04106		162	Rab23_lke Rab23-like subfamily. Rab23 is a member	99.72
smart00175		164	RAB Rab subfamily of small GTPases. Rab GTPases ar	99.72
TIGR03594		429	GTPase_EngA ribosome-associated GTPase EngA. EngA	99.72
PRK03003		472	GTP-binding protein Der; Reviewed	99.72
TIGR00231		161	small_GTP small GTP-binding protein domain. This m	99.72
cd03697		87	EFTU_II EFTU_II: Elongation factor Tu domain II. E	99.71
PTZ00133		182	ADP-ribosylation factor; Provisional	99.71
smart00178		184	SAR Sar1p-like members of the Ras-family of small	99.71
cd01865		165	Rab3 Rab3 subfamily. The Rab3 subfamily contains R	99.71
cd04107		201	Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38	99.71
cd01867		167	Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp	99.71
cd04152		183	Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i	99.71
cd01869		166	Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev	99.71
cd04120		202	Rab12 Rab12 subfamily. Rab12 was first identified	99.71
cd04138		162	H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras,	99.71
cd04164		157	trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein	99.71
cd04116		170	Rab9 Rab9 subfamily. Rab9 is found in late endosom	99.71
cd03696		83	selB_II selB_II: this subfamily represents the dom	99.7
PRK04213		201	GTP-binding protein; Provisional	99.7
cd01866		168	Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg	99.7
cd01863		161	Rab18 Rab18 subfamily. Mammalian Rab18 is implicat	99.7
KOG0092\|consensus		200		99.7
PRK09554		772	feoB ferrous iron transport protein B; Reviewed	99.7
cd04140		165	ARHI_like ARHI subfamily. ARHI (A Ras homolog memb	99.7
cd00154		159	Rab Rab family. Rab GTPases form the largest famil	99.7
cd04112		191	Rab26 Rab26 subfamily. First identified in rat pan	99.7
cd04127		180	Rab27A Rab27a subfamily. The Rab27a subfamily cons	99.7
PRK15467		158	ethanolamine utilization protein EutP; Provisional	99.7
cd03708		87	GTPBP_III Domain III of the GP-1 family of GTPase.	99.7
TIGR02528		142	EutP ethanolamine utilization protein, EutP. This	99.69
cd04155		173	Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f	99.69
cd04119		168	RJL RJL (RabJ-Like) subfamily. RJLs are found in m	99.69
cd01868		165	Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a	99.69
cd04159		159	Arl10_like Arl10-like subfamily. Arl9/Arl10 was id	99.69
cd04122		166	Rab14 Rab14 subfamily. Rab14 GTPases are localized	99.69
cd04156		160	ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su	99.69
smart00173		164	RAS Ras subfamily of RAS small GTPases. Similar in	99.69
cd04121		189	Rab40 Rab40 subfamily. This subfamily contains Rab	99.69
PF10662		143	PduV-EutP: Ethanolamine utilisation - propanediol	99.69
PRK09518		712	bifunctional cytidylate kinase/GTPase Der; Reviewe	99.69
cd04108		170	Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr	99.69
cd00877		166	Ran Ran (Ras-related nuclear proteins) /TC4 subfam	99.69
cd04136		163	Rap_like Rap-like subfamily. The Rap subfamily con	99.68
PRK00093		435	GTP-binding protein Der; Reviewed	99.68
cd04110		199	Rab35 Rab35 subfamily. Rab35 is one of several Rab	99.68
cd04161		167	Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 (	99.68
cd04142		198	RRP22 RRP22 subfamily. RRP22 (Ras-related protein	99.68
PRK00454		196	engB GTP-binding protein YsxC; Reviewed	99.68
cd01878		204	HflX HflX subfamily. A distinct conserved domain w	99.68
cd04163		168	Era Era subfamily. Era (E. coli Ras-like protein)	99.68
cd04109		215	Rab28 Rab28 subfamily. First identified in maize,	99.68
PRK09518		712	bifunctional cytidylate kinase/GTPase Der; Reviewe	99.67
cd01893		166	Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr	99.67
cd03695		81	CysN_NodQ_II CysN_NodQ_II: This subfamily represen	99.67
cd04162		164	Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9	99.67
PLN03118		211	Rab family protein; Provisional	99.67
cd04147		198	Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v	99.67
PTZ00369		189	Ras-like protein; Provisional	99.67
cd04128		182	Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi	99.67
cd04175		164	Rap1 Rap1 subgroup. The Rap1 subgroup is part of t	99.67
PRK12299		335	obgE GTPase CgtA; Reviewed	99.67
cd04118		193	Rab24 Rab24 subfamily. Rab24 is distinct from othe	99.66
cd04126		220	Rab20 Rab20 subfamily. Rab20 is one of several Rab	99.66
PRK12298		390	obgE GTPase CgtA; Reviewed	99.66
cd04115		170	Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u	99.66
PF00025		175	Arf: ADP-ribosylation factor family The prints ent	99.66
cd04123		162	Rab21 Rab21 subfamily. The localization and functi	99.66
cd03706		93	mtEFTU_III Domain III of mitochondrial EF-TU (mtEF	99.66
cd04176		163	Rap2 Rap2 subgroup. The Rap2 subgroup is part of t	99.66
cd04144		190	Ras2 Ras2 subfamily. The Ras2 subfamily, found exc	99.66
cd00157		171	Rho Rho (Ras homology) family. Members of the Rho	99.66
cd01871		174	Rac1_like Rac1-like subfamily. The Rac1-like subfa	99.66
TIGR03156		351	GTP_HflX GTP-binding protein HflX. This protein fa	99.65
cd01874		175	Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas	99.65
PRK05291		449	trmE tRNA modification GTPase TrmE; Reviewed	99.65
cd04141		172	Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p	99.65
cd04143		247	Rhes_like Rhes_like subfamily. This subfamily incl	99.65
TIGR02729		329	Obg_CgtA Obg family GTPase CgtA. This model descri	99.65
PLN03071		219	GTP-binding nuclear protein Ran; Provisional	99.64
cd04135		174	Tc10 TC10 subfamily. TC10 is a Rho family protein	99.64
PRK12296		500	obgE GTPase CgtA; Reviewed	99.64
cd04139		164	RalA_RalB RalA/RalB subfamily. The Ral (Ras-like)	99.64
cd01875		191	RhoG RhoG subfamily. RhoG is a GTPase with high se	99.64
cd04101		164	RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove	99.64
KOG0094\|consensus		221		99.64
cd04132		187	Rho4_like Rho4-like subfamily. Rho4 is a GTPase th	99.63
cd00880		163	Era_like Era (E. coli Ras-like protein)-like. This	99.63
KOG0084\|consensus		205		99.63
cd01892		169	Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr	99.63
cd04117		161	Rab15 Rab15 subfamily. Rab15 colocalizes with the	99.63
PLN03110		216	Rab GTPase; Provisional	99.63
COG0486		454	ThdF Predicted GTPase [General function prediction	99.63
smart00174		174	RHO Rho (Ras homology) subfamily of Ras-like small	99.63
cd00876		160	Ras Ras family. The Ras family of the Ras superfam	99.63
cd01881		176	Obg_like The Obg-like subfamily consists of five w	99.63
COG0218		200	Predicted GTPase [General function prediction only	99.63
cd04177		168	RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the	99.63
cd04111		211	Rab39 Rab39 subfamily. Found in eukaryotes, Rab39	99.62
cd04125		188	RabA_like RabA-like subfamily. RabA was first iden	99.62
PLN03108		210	Rab family protein; Provisional	99.62
cd04134		189	Rho3 Rho3 subfamily. Rho3 is a member of the Rho f	99.62
PRK12297		424	obgE GTPase CgtA; Reviewed	99.62
cd03707		90	EFTU_III Domain III of elongation factor (EF) Tu.	99.61
cd04133		176	Rop_like Rop subfamily. The Rop (Rho-related prote	99.61
PRK11058		426	GTPase HflX; Provisional	99.61
cd04137		180	RheB Rheb (Ras Homolog Enriched in Brain) subfamil	99.6
cd04146		165	RERG_RasL11_like RERG/RasL11-like subfamily. RERG	99.6
cd04130		173	Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive	99.6
cd04172		182	Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE	99.6
TIGR00450		442	mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE	99.6
cd01882		225	BMS1 Bms1. Bms1 is an essential, evolutionarily co	99.6
smart00176		200	RAN Ran (Ras-related nuclear proteins) /TC4 subfam	99.59
cd01870		175	RhoA_like RhoA-like subfamily. The RhoA subfamily	99.59
COG0370		653	FeoB Fe2+ transport system protein B [Inorganic io	99.59
cd01876		170	YihA_EngB The YihA (EngB) subfamily. This subfamil	99.58
TIGR00437		591	feoB ferrous iron transporter FeoB. FeoB (773 amin	99.58
cd04131		178	Rnd Rnd subfamily. The Rnd subfamily contains Rnd1	99.57
cd04148		221	RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki	99.56
cd04174		232	Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a memb	99.56
cd04173		222	Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a memb	99.55
KOG0078\|consensus		207		99.54
KOG0098\|consensus		216		99.53
cd00882		157	Ras_like_GTPase Ras-like GTPase superfamily. The R	99.53
KOG0394\|consensus		210		99.52
cd04105		203	SR_beta Signal recognition particle receptor, beta	99.52
PF01926		116	MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I	99.52
PTZ00132		215	GTP-binding nuclear protein Ran; Provisional	99.52
KOG1423\|consensus		379		99.5
KOG0075\|consensus		186		99.5
PRK09866		741	hypothetical protein; Provisional	99.49
PF00071		162	Ras: Ras family; InterPro: IPR001806 Small GTPases	99.49
cd04129		187	Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that	99.49
cd04103		158	Centaurin_gamma Centaurin gamma. The centaurins (a	99.49
cd01852		196	AIG1 AIG1 (avrRpt2-induced gene 1). This represent	99.48
cd01896		233	DRG The developmentally regulated GTP-binding prot	99.48
cd04104		197	p47_IIGP_like p47 (47-kDa) family. The p47 GTPase	99.47
COG2262		411	HflX GTPases [General function prediction only]	99.46
cd01873		195	RhoBTB RhoBTB subfamily. Members of the RhoBTB sub	99.45
KOG0087\|consensus		222		99.45
KOG0073\|consensus		185		99.45
KOG0080\|consensus		209		99.45
cd04102		202	RabL3 RabL3 (Rab-like3) subfamily. RabL3s are nove	99.43
KOG0095\|consensus		213		99.42
KOG1489\|consensus		366		99.42
KOG0070\|consensus		181		99.41
cd04094		97	selB_III This family represents the domain of elon	99.41
KOG0086\|consensus		214		99.4
KOG0076\|consensus		197		99.4
PLN00023		334	GTP-binding protein; Provisional	99.4
KOG1532\|consensus		366		99.39
COG3596		296	Predicted GTPase [General function prediction only	99.38
PF08477		119	Miro: Miro-like protein; InterPro: IPR013684 Mitoc	99.38
KOG1191\|consensus		531		99.37
cd03688		113	eIF2_gamma_II eIF2_gamma_II: this subfamily repres	99.36
COG1084		346	Predicted GTPase [General function prediction only	99.35
KOG0093\|consensus		193		99.34
KOG0079\|consensus		198		99.33
PF09439		181	SRPRB: Signal recognition particle receptor beta s	99.33
cd01850		276	CDC_Septin CDC/Septin. Septins are a conserved fam	99.32
COG1100		219	GTPase SAR1 and related small G proteins [General	99.3
PRK13768		253	GTPase; Provisional	99.29
PF04670		232	Gtr1_RagA: Gtr1/RagA G protein conserved region; I	99.29
cd03692		84	mtIF2_IVc mtIF2_IVc: this family represents the C2	99.29
PF03029		238	ATP_bind_1: Conserved hypothetical ATP binding pro	99.28
COG4917		148	EutP Ethanolamine utilization protein [Amino acid	99.24
KOG0090\|consensus		238		99.22
KOG0091\|consensus		213		99.19
cd01899		318	Ygr210 Ygr210 subfamily. Ygr210 is a member of Obg	99.19
PTZ00099		176	rab6; Provisional	99.18
KOG0088\|consensus		218		99.18
cd01853		249	Toc34_like Toc34-like (Translocon at the Outer-env	99.17
COG0536		369	Obg Predicted GTPase [General function prediction	99.17
KOG0395\|consensus		196		99.16
PRK09435		332	membrane ATPase/protein kinase; Provisional	99.16
KOG0097\|consensus		215		99.15
KOG0071\|consensus		180		99.15
COG1163		365	DRG Predicted GTPase [General function prediction	99.08
KOG0074\|consensus		185		99.07
cd01342		83	Translation_Factor_II_like Translation_Factor_II_l	99.06
KOG0072\|consensus		182		99.05
COG5192		1077	BMS1 GTP-binding protein required for 40S ribosome	99.04
KOG0081\|consensus		219		99.02
PRK09602		396	translation-associated GTPase; Reviewed	99.02
TIGR00073		207	hypB hydrogenase accessory protein HypB. HypB is i	99.01
PF03144		74	GTP_EFTU_D2: Elongation factor Tu domain 2; InterP	99.0
PF05049		376	IIGP: Interferon-inducible GTPase (IIGP); InterPro	99.0
cd03690		85	Tet_II Tet_II: This subfamily represents domain II	98.95
TIGR00750		300	lao LAO/AO transport system ATPase. Mutations have	98.94
PF04548		212	AIG1: AIG1 family; InterPro: IPR006703 This entry	98.92
cd04092		83	mtEFG2_II_like mtEFG2_C: C-terminus of mitochondri	98.9
TIGR02836		492	spore_IV_A stage IV sporulation protein A. A compa	98.9
cd03699		86	lepA_II lepA_II: This subfamily represents the dom	98.87
KOG0410\|consensus		410		98.87
cd03689		85	RF3_II RF3_II: this subfamily represents the domai	98.86
TIGR00991		313	3a0901s02IAP34 GTP-binding protein (Chloroplast En	98.85
cd04088		83	EFG_mtEFG_II EFG_mtEFG_II: this subfamily represen	98.85
PF00350		168	Dynamin_N: Dynamin family; InterPro: IPR001401 Mem	98.84
smart00053		240	DYNc Dynamin, GTPase. Large GTPases that mediate v	98.84
KOG0077\|consensus		193		98.84
COG0378		202	HypB Ni2+-binding GTPase involved in regulation of	98.83
PF14578		81	GTP_EFTU_D4: Elongation factor Tu domain 4; PDB: 1	98.82
KOG4252\|consensus		246		98.8
cd03691		86	BipA_TypA_II BipA_TypA_II: domain II of BipA (also	98.79
KOG3886\|consensus		295		98.79
cd04091		81	mtEFG1_II_like mtEFG1_C: C-terminus of mitochondri	98.77
TIGR00101		199	ureG urease accessory protein UreG. This model rep	98.76
KOG0083\|consensus		192		98.76
PRK10463		290	hydrogenase nickel incorporation protein HypB; Pro	98.71
PF03308		266	ArgK: ArgK protein; InterPro: IPR005129 Bacterial	98.68
KOG2486\|consensus		320		98.62
KOG3883\|consensus		198		98.61
PTZ00258		390	GTP-binding protein; Provisional	98.6
COG1703		323	ArgK Putative periplasmic protein kinase ArgK and	98.58
TIGR00993		763	3a0901s04IAP86 chloroplast protein import componen	98.57
KOG0393\|consensus		198		98.57
KOG1707\|consensus		625		98.57
cd01900		274	YchF YchF subfamily. YchF is a member of the Obg f	98.57
PRK09601		364	GTP-binding protein YchF; Reviewed	98.55
PF00735		281	Septin: Septin; InterPro: IPR000038 Septins consti	98.54
cd03700		93	eEF2_snRNP_like_II EF2_snRNP_like_II: this subfami	98.48
cd01859		156	MJ1464 MJ1464. This family represents archaeal GTP	98.46
KOG1673\|consensus		205		98.44
KOG0448\|consensus		749		98.42
cd01857		141	HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t	98.32
KOG0096\|consensus		216		98.29
cd01856		171	YlqF YlqF. Proteins of the YlqF family contain all	98.29
cd04090		94	eEF2_II_snRNP Loc2 eEF2_C_snRNP, cd01514/C termina	98.29
TIGR01425		429	SRP54_euk signal recognition particle protein SRP5	98.28
KOG1490\|consensus		620		98.25
KOG1534\|consensus		273		98.25
cd01858		157	NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei	98.25
cd01858		157	NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei	98.24
KOG1547\|consensus		336		98.17
cd04178		172	Nucleostemin_like Nucleostemin-like. Nucleostemin	98.17
cd01855		190	YqeH YqeH. YqeH is an essential GTP-binding protei	98.17
cd01851		224	GBP Guanylate-binding protein (GBP), N-terminal do	98.16
TIGR03596		276	GTPase_YlqF ribosome biogenesis GTP-binding protei	98.16
PF05783		472	DLIC: Dynein light intermediate chain (DLIC); Inte	98.15
COG5019		373	CDC3 Septin family protein [Cell division and chro	98.14
COG0012		372	Predicted GTPase, probable translation factor [Tra	98.13
PF03193		161	DUF258: Protein of unknown function, DUF258; Inter	98.09
TIGR00157		245	ribosome small subunit-dependent GTPase A. The Aqu	98.09
PF00448		196	SRP54: SRP54-type protein, GTPase domain; InterPro	98.09
KOG3905\|consensus		473		98.08
KOG1486\|consensus		364		98.07
cd01849		155	YlqF_related_GTPase YlqF-related GTPases. These pr	98.03
cd01849		155	YlqF_related_GTPase YlqF-related GTPases. These pr	98.03
PRK10416		318	signal recognition particle-docking protein FtsY;	98.02
TIGR00064		272	ftsY signal recognition particle-docking protein F	98.02
PRK11889		436	flhF flagellar biosynthesis regulator FlhF; Provis	98.02
PRK12289		352	GTPase RsgA; Reviewed	98.02
cd03115		173	SRP The signal recognition particle (SRP) mediates	98.01
PRK09563		287	rbgA GTPase YlqF; Reviewed	98.0
PRK14722		374	flhF flagellar biosynthesis regulator FlhF; Provis	97.97
KOG1954\|consensus		532		97.97
cd01855		190	YqeH YqeH. YqeH is an essential GTP-binding protei	97.95
cd01857		141	HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t	97.91
PRK14974		336	cell division protein FtsY; Provisional	97.91
cd03112		158	CobW_like The function of this protein family is u	97.9
cd03114		148	ArgK-like The function of this protein family is u	97.88
PRK00098		298	GTPase RsgA; Reviewed	97.88
COG3640		255	CooC CO dehydrogenase maturation factor [Cell divi	97.87
KOG2655\|consensus		366		97.87
PRK00771		437	signal recognition particle protein Srp54; Provisi	97.86
TIGR00487		587	IF-2 translation initiation factor IF-2. This mode	97.84
PRK12288		347	GTPase RsgA; Reviewed	97.84
COG1161		322	Predicted GTPases [General function prediction onl	97.81
cd01856		171	YlqF YlqF. Proteins of the YlqF family contain all	97.8
TIGR00157		245	ribosome small subunit-dependent GTPase A. The Aqu	97.79
PRK09563		287	rbgA GTPase YlqF; Reviewed	97.79
PRK05306		787	infB translation initiation factor IF-2; Validated	97.78
KOG4423\|consensus		229		97.77
TIGR03596		276	GTPase_YlqF ribosome biogenesis GTP-binding protei	97.76
PRK12724		432	flagellar biosynthesis regulator FlhF; Provisional	97.76
CHL00189		742	infB translation initiation factor 2; Provisional	97.76
COG0541		451	Ffh Signal recognition particle GTPase [Intracellu	97.76
KOG1487\|consensus		358		97.75
cd01854		287	YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil	97.74
cd03110		179	Fer4_NifH_child This protein family's function is	97.72
PRK06731		270	flhF flagellar biosynthesis regulator FlhF; Valida	97.71
PRK12289		352	GTPase RsgA; Reviewed	97.7
TIGR00959		428	ffh signal recognition particle protein. This mode	97.67
PRK10867		433	signal recognition particle protein; Provisional	97.67
TIGR03597		360	GTPase_YqeH ribosome biogenesis GTPase YqeH. This	97.67
COG1162		301	Predicted GTPases [General function prediction onl	97.66
TIGR00092		368	GTP-binding protein YchF. This predicted GTP-bindi	97.66
KOG0082\|consensus		354		97.65
PRK14721		420	flhF flagellar biosynthesis regulator FlhF; Provis	97.64
KOG3887\|consensus		347		97.61
KOG1533\|consensus		290		97.6
PRK12288		347	GTPase RsgA; Reviewed	97.59
PRK12723		388	flagellar biosynthesis regulator FlhF; Provisional	97.59
cd02036		179	MinD Bacterial cell division requires the formatio	97.58
PRK12726		407	flagellar biosynthesis regulator FlhF; Provisional	97.58
cd01854		287	YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil	97.58
TIGR03597		360	GTPase_YqeH ribosome biogenesis GTPase YqeH. This	97.58
COG1419		407	FlhF Flagellar GTP-binding protein [Cell motility	97.57
PRK13796		365	GTPase YqeH; Provisional	97.57
KOG0780\|consensus		483		97.56
KOG1491\|consensus		391		97.52
PRK12727		559	flagellar biosynthesis regulator FlhF; Provisional	97.51
cd01859		156	MJ1464 MJ1464. This family represents archaeal GTP	97.5
cd03111		106	CpaE_like This protein family consists of proteins	97.5
cd02038		139	FleN-like FleN is a member of the Fer4_NifH superf	97.42
PRK01889		356	GTPase RsgA; Reviewed	97.38
PRK05703		424	flhF flagellar biosynthesis regulator FlhF; Valida	97.35
cd00066		317	G-alpha G protein alpha subunit. The alpha subunit	97.32
COG0532		509	InfB Translation initiation factor 2 (IF-2; GTPase	97.32
smart00275		342	G_alpha G protein alpha subunit. Subunit of G prot	97.32
PRK13796		365	GTPase YqeH; Provisional	97.32
PF02492		178	cobW: CobW/HypB/UreG, nucleotide-binding domain; I	97.31
PRK00098		298	GTPase RsgA; Reviewed	97.28
KOG2485\|consensus		335		97.22
PRK06995		484	flhF flagellar biosynthesis regulator FlhF; Valida	97.21
PRK14723		767	flhF flagellar biosynthesis regulator FlhF; Provis	97.21
KOG0447\|consensus		980		97.19
PRK11537		318	putative GTP-binding protein YjiA; Provisional	97.17
COG0523		323	Putative GTPases (G3E family) [General function pr	97.16
COG1162		301	Predicted GTPases [General function prediction onl	97.15
cd03702		95	IF2_mtIF2_II This family represents the domain II	97.14
cd02037		169	MRP-like MRP (Multiple Resistance and pH adaptatio	97.09
cd02042		104	ParA ParA and ParB of Caulobacter crescentus belon	97.06
TIGR02475		341	CobW cobalamin biosynthesis protein CobW. A broade	96.96
cd03703		110	aeIF5B_II aeIF5B_II: This family represents the do	96.93
KOG4181\|consensus		491		96.89
PRK08099		399	bifunctional DNA-binding transcriptional repressor	96.89
PF09547		492	Spore_IV_A: Stage IV sporulation protein A (spore_	96.86
cd01983		99	Fer4_NifH The Fer4_NifH superfamily contains a var	96.85
COG0552		340	FtsY Signal recognition particle GTPase [Intracell	96.83
TIGR03348		1169	VI_IcmF type VI secretion protein IcmF. Members of	96.75
TIGR00491		590	aIF-2 translation initiation factor aIF-2/yIF-2. T	96.66
KOG2743\|consensus		391		96.63
KOG2484\|consensus		435		96.55
COG3172		187	NadR Predicted ATPase/kinase involved in NAD metab	96.49
cd04178		172	Nucleostemin_like Nucleostemin-like. Nucleostemin	96.49
PRK13695		174	putative NTPase; Provisional	96.49
cd03701		95	IF2_IF5B_II IF2_IF5B_II: This family represents th	96.49
KOG2423\|consensus		572		96.45
KOG1424\|consensus		562		96.38
PF09173		88	eIF2_C: Initiation factor eIF2 gamma, C terminal;	96.37
PF06858		58	NOG1: Nucleolar GTP-binding protein 1 (NOG1); Inte	96.34
PRK04004		586	translation initiation factor IF-2; Validated	96.27
PRK14845		1049	translation initiation factor IF-2; Provisional	96.09
PRK10751		173	molybdopterin-guanine dinucleotide biosynthesis pr	96.05
PF13207		121	AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6	95.87
smart00010		124	small_GTPase Small GTPase of the Ras superfamily;	95.83
COG1341		398	Predicted GTPase or GTP-binding protein [General f	95.82
KOG3859\|consensus		406		95.82
PF13555		62	AAA_29: P-loop containing region of AAA domain	95.75
COG3523		1188	IcmF Type VI protein secretion system component Va	95.73
PRK01889		356	GTPase RsgA; Reviewed	95.72
COG1763		161	MobB Molybdopterin-guanine dinucleotide biosynthes	95.69
PF00503		389	G-alpha: G-protein alpha subunit; InterPro: IPR001	95.59
KOG2484\|consensus		435		95.56
PF00437		270	T2SE: Type II/IV secretion system protein; InterPr	95.45
COG0563		178	Adk Adenylate kinase and related kinases [Nucleoti	95.4
TIGR00235		207	udk uridine kinase. Model contains a number of lon	95.36
PRK08118		167	topology modulation protein; Reviewed	95.34
PRK07261		171	topology modulation protein; Provisional	95.3
KOG1144\|consensus		1064		95.27
cd02019		69	NK Nucleoside/nucleotide kinase (NK) is a protein	95.21
KOG0781\|consensus		587		95.2
PF13671		143	AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1	95.19
COG1126		240	GlnQ ABC-type polar amino acid transport system, A	95.17
cd03116		159	MobB Molybdenum is an essential trace element in t	95.1
COG1136		226	SalX ABC-type antimicrobial peptide transport syst	95.06
COG1116		248	TauB ABC-type nitrate/sulfonate/bicarbonate transp	95.0
KOG1707\|consensus		625		95.0

>COG5256 TEF1 Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

Probab=100.00  E-value=1.5e-101  Score=734.16  Aligned_cols=427  Identities=63%  Similarity=1.031  Sum_probs=416.7

Q ss_pred             CCCCCceeEEEEEecCCCChHHHHhHHHHhcCCCChHHHHHHHHHHHHhCCCcceeeeeccCchhHHhcCceEEeeeeEE
Q psy13961          1 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKF   80 (459)
Q Consensus         1 ~~~~k~~~~v~v~G~~~~GKSTLi~~Ll~~~~~i~~~~~~~~~~~~~~~g~~~~~~~~~~d~~~~e~~~g~Ti~~~~~~~   80 (459)
                      |...|+++|++++||+|||||||+++|+|++|.++.+.++++++++.+.|+++|.|+|+||++++||+||+|++.++..|
T Consensus         1 ~~~~Kph~nl~~iGHVD~GKSTl~GrLly~~G~id~~tmeK~~~ea~~~gK~sf~fawvlD~tkeERerGvTi~~~~~~f   80 (428)
T COG5256           1 MASEKPHLNLVFIGHVDAGKSTLVGRLLYDLGEIDKRTMEKLEKEAKELGKESFKFAWVLDKTKEERERGVTIDVAHSKF   80 (428)
T ss_pred             CCCCCCceEEEEEcCCCCCchhhhhhhHHHhCCCCHHHHHHHHHHHHhcCCCceEEEEEecCChhHHhcceEEEEEEEEe
Confidence            66789999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eeCCEEEEEEeCCCccchHhHHHHhhcccCEEEEEEECCCCceeccccCCCchHHHHHHHHHcCCceEEEEEEccCCCCC
Q psy13961         81 ETSKFYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEP  160 (459)
Q Consensus        81 ~~~~~~~~liDtpG~~~~~~~~~~~~~~aD~~ilVvda~~g~~~~~~~~~~qt~e~~~~~~~~~ip~iivviNK~D~~~~  160 (459)
                      +++.+.++|+|||||.+|.++|+.|+++||++||||||+.+.||+||...+||+||+.+++.+|+.++||++||||.++ 
T Consensus        81 et~k~~~tIiDaPGHrdFvknmItGasqAD~aVLVV~a~~~efE~g~~~~gQtrEH~~La~tlGi~~lIVavNKMD~v~-  159 (428)
T COG5256          81 ETDKYNFTIIDAPGHRDFVKNMITGASQADVAVLVVDARDGEFEAGFGVGGQTREHAFLARTLGIKQLIVAVNKMDLVS-  159 (428)
T ss_pred             ecCCceEEEeeCCchHHHHHHhhcchhhccEEEEEEECCCCccccccccCCchhHHHHHHHhcCCceEEEEEEcccccc-
Confidence            9999999999999999999999999999999999999999999999999999999999999999999999999999998 


Q ss_pred             CCcHHHHHHHHHHHHhhhhhcCcCCceeeEeecCCCCCCccccccCCCCCccccccccccCCCChhhHHHhccccCCCCC
Q psy13961        161 PYSEARFEEIKKEVSGYIKKIGYNPATVAFVPISGWHGDNMLEVSDKMPWFKGWAIERKEGKADGKCLIEALDAILPPSR  240 (459)
Q Consensus       161 ~~~~~~~~~i~~~l~~~l~~~g~~~~~~~~i~iSa~~g~~i~~~~~~~~w~~~~~~~~~~~~~~g~~Ll~~l~~~~~~~~  240 (459)
                       |++++|+++++++..+++.+||++++++|+|+||+.|+|+.+.++.+|||+|            ++|+++|+.+.+|.+
T Consensus       160 -wde~rf~ei~~~v~~l~k~~G~~~~~v~FIPiSg~~G~Nl~~~s~~~pWY~G------------pTLleaLd~~~~p~~  226 (428)
T COG5256         160 -WDEERFEEIVSEVSKLLKMVGYNPKDVPFIPISGFKGDNLTKKSENMPWYKG------------PTLLEALDQLEPPER  226 (428)
T ss_pred             -cCHHHHHHHHHHHHHHHHHcCCCccCCeEEecccccCCcccccCcCCcCccC------------ChHHHHHhccCCCCC
Confidence             9999999999999999999999988999999999999999999999999986            999999999888988


Q ss_pred             CCCCCeeEEeEEEEEeCCceeEEEEEEEeeeEecCCeEEEecCCeEEEEEEEEeccccceeEcCCCeEEEEEccCcccCc
Q psy13961        241 PTEKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMLVTFAPANLTTEVKSVEMHHEALQEAVPGDNVGFNVKNVSVKEL  320 (459)
Q Consensus       241 ~~~~p~~~~i~~v~~~~~~G~v~~G~v~sG~l~~gd~v~~~p~~~~~~V~~I~~~~~~v~~a~aGd~v~l~l~~~~~~~i  320 (459)
                      +.++|||++|+++|.+.+.|++..|||++|.|++||+|++.|.+...+|++|++++.+++.|.|||+|+++++++..++|
T Consensus       227 ~~d~Plr~pI~~v~~i~~~gtv~vGrVEsG~i~~g~~v~~~p~~~~~evksie~~~~~~~~a~~GD~i~~~vrgv~~~dI  306 (428)
T COG5256         227 PLDKPLRLPIQDVYSISGIGTVPVGRVESGVIKPGQKVTFMPAGVVGEVKSIEMHHEEISQAEPGDNVGFNVRGVEKNDI  306 (428)
T ss_pred             CCCCCeEeEeeeEEEecCCceEEEEEEeeeeeccCCEEEEecCcceEEEeeeeecccccccCCCCCeEEEEecCCchhcc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ceeEEEccCCCCCCcccceEEEEEEEecCCCCCCCCCeeEEeeeeeeEEEEEEEEeeeecCCCCcccccCccccCCCCEE
Q psy13961        321 RRGFVAGDSKASPPKATQDFTAQVIVLNHPGQISNGYTPVLDCHTAHIACKFAEIKEKCDRRTGKTTEENPKALKSGDAA  400 (459)
Q Consensus       321 ~~G~vl~~~~~~~~~~~~~f~a~i~~l~~~~~i~~g~~~~~~~~~~~~~~~i~~i~~~~~~~~~~~~~~~~~~l~~g~~~  400 (459)
                      ++|||++++++ ++..+.+|.|+|.++.+|..|.+||.|++|+|+..++|++..|..++|+.+++..+++|.++++|+.+
T Consensus       307 ~~Gdv~~~~~n-~~t~s~~f~a~i~vl~~p~~i~~Gyt~vlh~hta~~a~~~~~l~~k~d~~t~k~~~~~p~f~k~g~~~  385 (428)
T COG5256         307 RRGDVIGHSDN-PPTVSPEFTAQIIVLWHPGIITSGYTPVLHAHTAQVACRIAELLSKLDPRTGKKLEENPQFLKRGDAA  385 (428)
T ss_pred             CCccEeccCCC-CcccccceEEEEEEEecCccccCCCccEEEecccceeeeHHHHHHhhCcccccccccChhhhhcCceE
Confidence            99999999876 66667999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEEEeCCeEEeeecCCCCCcceEEEEECCceEEEEEEEeec
Q psy13961        401 IIVLVPSKPMCVESFSEFPPLGRFAVRDMRQTVAVGVIKVNN  442 (459)
Q Consensus       401 ~v~l~l~~~i~~~~~~~~~~~grfilrd~~~tva~G~V~~v~  442 (459)
                      .|.+++.+|+|++++++++.||||+|||.++|||+|+|.++.
T Consensus       386 iv~i~~~kP~~~e~~~~~~~Lgrfalrd~g~tIA~G~v~~v~  427 (428)
T COG5256         386 IVKIEPEKPLCLEKVSEIPQLGRFALRDMGQTIAAGKVLEVK  427 (428)
T ss_pred             EEEEEecCceEeeecccCCccceEEEEeCCCeEEeEEEEecc
Confidence            999999999999999999999999999999999999999875

>PLN00043 elongation factor 1-alpha; Provisional	Back alignment and domain information

>PTZ00141 elongation factor 1- alpha; Provisional	Back alignment and domain information

>TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha	Back alignment and domain information

>PRK12317 elongation factor 1-alpha; Reviewed	Back alignment and domain information

>KOG0458\|consensus	Back alignment and domain information

>KOG0459\|consensus	Back alignment and domain information

>COG2895 CysN GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional	Back alignment and domain information

>TIGR02034 CysN sulfate adenylyltransferase, large subunit	Back alignment and domain information

>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional	Back alignment and domain information

>PLN03126 Elongation factor Tu; Provisional	Back alignment and domain information

>CHL00071 tufA elongation factor Tu	Back alignment and domain information

>PRK12735 elongation factor Tu; Reviewed	Back alignment and domain information

>PRK00049 elongation factor Tu; Reviewed	Back alignment and domain information

>PRK12736 elongation factor Tu; Reviewed	Back alignment and domain information

>TIGR00485 EF-Tu translation elongation factor TU	Back alignment and domain information

>PLN03127 Elongation factor Tu; Provisional	Back alignment and domain information

>KOG0460\|consensus	Back alignment and domain information

>COG0050 TufB GTPases - translation elongation factors [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PTZ00327 eukaryotic translation initiation factor 2 gamma subunit; Provisional	Back alignment and domain information

>COG5258 GTPBP1 GTPase [General function prediction only]	Back alignment and domain information

>PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional	Back alignment and domain information

>PRK04000 translation initiation factor IF-2 subunit gamma; Validated	Back alignment and domain information

>TIGR03680 eif2g_arch translation initiation factor 2 subunit gamma	Back alignment and domain information

>TIGR00475 selB selenocysteine-specific elongation factor SelB	Back alignment and domain information

>KOG0463\|consensus	Back alignment and domain information

>COG3276 SelB Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0052\|consensus	Back alignment and domain information

>KOG1143\|consensus	Back alignment and domain information

>COG5257 GCD11 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>TIGR01394 TypA_BipA GTP-binding protein TypA/BipA	Back alignment and domain information

>PRK10218 GTP-binding protein; Provisional	Back alignment and domain information

>COG1217 TypA Predicted membrane GTPase involved in stress response [Signal transduction mechanisms]	Back alignment and domain information

>PRK05433 GTP-binding protein LepA; Provisional	Back alignment and domain information

>TIGR01393 lepA GTP-binding protein LepA	Back alignment and domain information

>cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily	Back alignment and domain information

>KOG0462\|consensus	Back alignment and domain information

>KOG0461\|consensus	Back alignment and domain information

>COG0481 LepA Membrane GTPase LepA [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>cd04166 CysN_ATPS CysN_ATPS subfamily	Back alignment and domain information

>PRK07560 elongation factor EF-2; Reviewed	Back alignment and domain information

>cd01884 EF_Tu EF-Tu subfamily	Back alignment and domain information

>PRK00741 prfC peptide chain release factor 3; Provisional	Back alignment and domain information

>PRK00007 elongation factor G; Reviewed	Back alignment and domain information

>COG0480 FusA Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>TIGR00503 prfC peptide chain release factor 3	Back alignment and domain information

>PRK12739 elongation factor G; Reviewed	Back alignment and domain information

>PRK05306 infB translation initiation factor IF-2; Validated	Back alignment and domain information

>TIGR00484 EF-G translation elongation factor EF-G	Back alignment and domain information

>TIGR00487 IF-2 translation initiation factor IF-2	Back alignment and domain information

>PRK13351 elongation factor G; Reviewed	Back alignment and domain information

>TIGR00490 aEF-2 translation elongation factor aEF-2	Back alignment and domain information

>PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site	Back alignment and domain information

>COG4108 PrfC Peptide chain release factor RF-3 [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK12740 elongation factor G; Reviewed	Back alignment and domain information

>CHL00189 infB translation initiation factor 2; Provisional	Back alignment and domain information

>PLN00116 translation elongation factor EF-2 subunit; Provisional	Back alignment and domain information

>PRK04004 translation initiation factor IF-2; Validated	Back alignment and domain information

>TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2	Back alignment and domain information

>PTZ00416 elongation factor 2; Provisional	Back alignment and domain information

>KOG0466\|consensus	Back alignment and domain information

>KOG1145\|consensus	Back alignment and domain information

>KOG0465\|consensus	Back alignment and domain information

>COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>cd01885 EF2 EF2 (for archaea and eukarya)	Back alignment and domain information

>PRK14845 translation initiation factor IF-2; Provisional	Back alignment and domain information

>cd01889 SelB_euk SelB subfamily	Back alignment and domain information

>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2)	Back alignment and domain information

>cd04167 Snu114p Snu114p subfamily	Back alignment and domain information

>cd01886 EF-G Elongation factor G (EF-G) subfamily	Back alignment and domain information

>cd04165 GTPBP1_like GTPBP1-like	Back alignment and domain information

>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily	Back alignment and domain information

>cd04168 TetM_like Tet(M)-like subfamily	Back alignment and domain information

>cd03704 eRF3c_III This family represents eEF1alpha-like C-terminal region of eRF3 homologous to the domain III of EF-Tu	Back alignment and domain information

>cd04169 RF3 RF3 subfamily	Back alignment and domain information

>cd01890 LepA LepA subfamily	Back alignment and domain information

>KOG0464\|consensus	Back alignment and domain information

>cd04093 HBS1_C HBS1_C: this family represents the C-terminal domain of Hsp70 subfamily B suppressor 1 (HBS1) which is homologous to the domain III of EF-1alpha	Back alignment and domain information

>KOG0469\|consensus	Back alignment and domain information

>cd03705 EF1_alpha_III Domain III of EF-1	Back alignment and domain information

>cd04171 SelB SelB subfamily	Back alignment and domain information

>cd00881 GTP_translation_factor GTP translation factor family	Back alignment and domain information

>KOG1144\|consensus	Back alignment and domain information

>KOG0467\|consensus	Back alignment and domain information

>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily	Back alignment and domain information

>cd04095 CysN_NoDQ_III TCysN_NoDQ_II: This subfamily represents the domain II of the large subunit of ATP sulfurylase (ATPS): CysN or the N-terminal portion of NodQ, found mainly in proteobacteria and homologous to the domain II of EF-Tu	Back alignment and domain information

>PF03143 GTP_EFTU_D3: Elongation factor Tu C-terminal domain; InterPro: IPR004160 Translation elongation factors are responsible for two main processes during protein synthesis on the ribosome [, , ]	Back alignment and domain information

>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily	Back alignment and domain information

>COG1159 Era GTPase [General function prediction only]	Back alignment and domain information

>cd01513 Translation_factor_III Domain III of Elongation factor (EF) Tu (EF-TU) and EF-G	Back alignment and domain information

>cd04160 Arfrp1 Arfrp1 subfamily	Back alignment and domain information

>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions	Back alignment and domain information

>COG1160 Predicted GTPases [General function prediction only]	Back alignment and domain information

>PRK00093 GTP-binding protein Der; Reviewed	Back alignment and domain information

>cd03693 EF1_alpha_II EF1_alpha_II: this family represents the domain II of elongation factor 1-alpha (EF-1a) that is found in archaea and all eukaryotic lineages	Back alignment and domain information

>TIGR00436 era GTP-binding protein Era	Back alignment and domain information

>KOG0468\|consensus	Back alignment and domain information

>PRK15494 era GTPase Era; Provisional	Back alignment and domain information

>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA	Back alignment and domain information

>COG1160 Predicted GTPases [General function prediction only]	Back alignment and domain information

>cd04154 Arl2 Arl2 subfamily	Back alignment and domain information

>cd01895 EngA2 EngA2 subfamily	Back alignment and domain information

>cd04157 Arl6 Arl6 subfamily	Back alignment and domain information

>cd01864 Rab19 Rab19 subfamily	Back alignment and domain information

>cd03698 eRF3_II_like eRF3_II_like: domain similar to domain II of the eukaryotic class II release factor (eRF3)	Back alignment and domain information

>cd01894 EngA1 EngA1 subfamily	Back alignment and domain information

>cd04151 Arl1 Arl1 subfamily	Back alignment and domain information

>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB	Back alignment and domain information

>cd04149 Arf6 Arf6 subfamily	Back alignment and domain information

>cd04150 Arf1_5_like Arf1-Arf5-like subfamily	Back alignment and domain information

>cd04124 RabL2 RabL2 subfamily	Back alignment and domain information

>cd01898 Obg Obg subfamily	Back alignment and domain information

>PRK03003 GTP-binding protein Der; Reviewed	Back alignment and domain information

>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily	Back alignment and domain information

>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily	Back alignment and domain information

>cd04114 Rab30 Rab30 subfamily	Back alignment and domain information

>cd04089 eRF3_II eRF3_II: domain II of the eukaryotic class II release factor (eRF3)	Back alignment and domain information

>PLN00223 ADP-ribosylation factor; Provisional	Back alignment and domain information

>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor	Back alignment and domain information

>PRK00089 era GTPase Era; Reviewed	Back alignment and domain information

>cd03694 GTPBP_II Domain II of the GP-1 family of GTPase	Back alignment and domain information

>cd01861 Rab6 Rab6 subfamily	Back alignment and domain information

>cd04158 ARD1 ARD1 subfamily	Back alignment and domain information

>COG2229 Predicted GTPase [General function prediction only]	Back alignment and domain information

>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans	Back alignment and domain information

>cd01860 Rab5_related Rab5-related subfamily	Back alignment and domain information

>cd04113 Rab4 Rab4 subfamily	Back alignment and domain information

>cd00879 Sar1 Sar1 subfamily	Back alignment and domain information

>cd01862 Rab7 Rab7 subfamily	Back alignment and domain information

>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases	Back alignment and domain information

>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily	Back alignment and domain information

>cd04106 Rab23_lke Rab23-like subfamily	Back alignment and domain information

>smart00175 RAB Rab subfamily of small GTPases	Back alignment and domain information

>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA	Back alignment and domain information

>PRK03003 GTP-binding protein Der; Reviewed	Back alignment and domain information

>TIGR00231 small_GTP small GTP-binding protein domain	Back alignment and domain information

>cd03697 EFTU_II EFTU_II: Elongation factor Tu domain II	Back alignment and domain information

>PTZ00133 ADP-ribosylation factor; Provisional	Back alignment and domain information

>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases	Back alignment and domain information

>cd01865 Rab3 Rab3 subfamily	Back alignment and domain information

>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily	Back alignment and domain information

>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2	Back alignment and domain information

>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily	Back alignment and domain information

>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily	Back alignment and domain information

>cd04120 Rab12 Rab12 subfamily	Back alignment and domain information

>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily	Back alignment and domain information

>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes	Back alignment and domain information

>cd04116 Rab9 Rab9 subfamily	Back alignment and domain information

>cd03696 selB_II selB_II: this subfamily represents the domain of elongation factor SelB, homologous to domain II of EF-Tu	Back alignment and domain information

>PRK04213 GTP-binding protein; Provisional	Back alignment and domain information

>cd01866 Rab2 Rab2 subfamily	Back alignment and domain information

>cd01863 Rab18 Rab18 subfamily	Back alignment and domain information

>KOG0092\|consensus	Back alignment and domain information

>PRK09554 feoB ferrous iron transport protein B; Reviewed	Back alignment and domain information

>cd04140 ARHI_like ARHI subfamily	Back alignment and domain information

>cd00154 Rab Rab family	Back alignment and domain information

>cd04112 Rab26 Rab26 subfamily	Back alignment and domain information

>cd04127 Rab27A Rab27a subfamily	Back alignment and domain information

>PRK15467 ethanolamine utilization protein EutP; Provisional	Back alignment and domain information

>cd03708 GTPBP_III Domain III of the GP-1 family of GTPase	Back alignment and domain information

>TIGR02528 EutP ethanolamine utilization protein, EutP	Back alignment and domain information

>cd04155 Arl3 Arl3 subfamily	Back alignment and domain information

>cd04119 RJL RJL (RabJ-Like) subfamily	Back alignment and domain information

>cd01868 Rab11_like Rab11-like	Back alignment and domain information

>cd04159 Arl10_like Arl10-like subfamily	Back alignment and domain information

>cd04122 Rab14 Rab14 subfamily	Back alignment and domain information

>cd04156 ARLTS1 ARLTS1 subfamily	Back alignment and domain information

>smart00173 RAS Ras subfamily of RAS small GTPases	Back alignment and domain information

>cd04121 Rab40 Rab40 subfamily	Back alignment and domain information

>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways	Back alignment and domain information

>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed	Back alignment and domain information

>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily	Back alignment and domain information

>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases	Back alignment and domain information

>cd04136 Rap_like Rap-like subfamily	Back alignment and domain information

>PRK00093 GTP-binding protein Der; Reviewed	Back alignment and domain information

>cd04110 Rab35 Rab35 subfamily	Back alignment and domain information

>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily	Back alignment and domain information

>cd04142 RRP22 RRP22 subfamily	Back alignment and domain information

>PRK00454 engB GTP-binding protein YsxC; Reviewed	Back alignment and domain information

>cd01878 HflX HflX subfamily	Back alignment and domain information

>cd04163 Era Era subfamily	Back alignment and domain information

>cd04109 Rab28 Rab28 subfamily	Back alignment and domain information

>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed	Back alignment and domain information

>cd01893 Miro1 Miro1 subfamily	Back alignment and domain information

>cd03695 CysN_NodQ_II CysN_NodQ_II: This subfamily represents the domain II of the large subunit of ATP sulfurylase (ATPS): CysN or the N-terminal portion of NodQ, found mainly in proteobacteria and homologous to the domain II of EF-Tu	Back alignment and domain information

>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily	Back alignment and domain information

>PLN03118 Rab family protein; Provisional	Back alignment and domain information

>cd04147 Ras_dva Ras-dva subfamily	Back alignment and domain information

>PTZ00369 Ras-like protein; Provisional	Back alignment and domain information

>cd04128 Spg1 Spg1p	Back alignment and domain information

>cd04175 Rap1 Rap1 subgroup	Back alignment and domain information

>PRK12299 obgE GTPase CgtA; Reviewed	Back alignment and domain information

>cd04118 Rab24 Rab24 subfamily	Back alignment and domain information

>cd04126 Rab20 Rab20 subfamily	Back alignment and domain information

>PRK12298 obgE GTPase CgtA; Reviewed	Back alignment and domain information

>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily	Back alignment and domain information

>PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases	Back alignment and domain information

>cd04123 Rab21 Rab21 subfamily	Back alignment and domain information

>cd03706 mtEFTU_III Domain III of mitochondrial EF-TU (mtEF-TU)	Back alignment and domain information

>cd04176 Rap2 Rap2 subgroup	Back alignment and domain information

>cd04144 Ras2 Ras2 subfamily	Back alignment and domain information

>cd00157 Rho Rho (Ras homology) family	Back alignment and domain information

>cd01871 Rac1_like Rac1-like subfamily	Back alignment and domain information

>TIGR03156 GTP_HflX GTP-binding protein HflX	Back alignment and domain information

>cd01874 Cdc42 Cdc42 subfamily	Back alignment and domain information

>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed	Back alignment and domain information

>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily	Back alignment and domain information

>cd04143 Rhes_like Rhes_like subfamily	Back alignment and domain information

>TIGR02729 Obg_CgtA Obg family GTPase CgtA	Back alignment and domain information

>PLN03071 GTP-binding nuclear protein Ran; Provisional	Back alignment and domain information

>cd04135 Tc10 TC10 subfamily	Back alignment and domain information

>PRK12296 obgE GTPase CgtA; Reviewed	Back alignment and domain information

>cd04139 RalA_RalB RalA/RalB subfamily	Back alignment and domain information

>cd01875 RhoG RhoG subfamily	Back alignment and domain information

>cd04101 RabL4 RabL4 (Rab-like4) subfamily	Back alignment and domain information

>KOG0094\|consensus	Back alignment and domain information

>cd04132 Rho4_like Rho4-like subfamily	Back alignment and domain information

>cd00880 Era_like Era (E	Back alignment and domain information

>KOG0084\|consensus	Back alignment and domain information

>cd01892 Miro2 Miro2 subfamily	Back alignment and domain information

>cd04117 Rab15 Rab15 subfamily	Back alignment and domain information

>PLN03110 Rab GTPase; Provisional	Back alignment and domain information

>COG0486 ThdF Predicted GTPase [General function prediction only]	Back alignment and domain information

>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases	Back alignment and domain information

>cd00876 Ras Ras family	Back alignment and domain information

>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1	Back alignment and domain information

>COG0218 Predicted GTPase [General function prediction only]	Back alignment and domain information

>cd04177 RSR1 RSR1 subgroup	Back alignment and domain information

>cd04111 Rab39 Rab39 subfamily	Back alignment and domain information

>cd04125 RabA_like RabA-like subfamily	Back alignment and domain information

>PLN03108 Rab family protein; Provisional	Back alignment and domain information

>cd04134 Rho3 Rho3 subfamily	Back alignment and domain information

>PRK12297 obgE GTPase CgtA; Reviewed	Back alignment and domain information

>cd03707 EFTU_III Domain III of elongation factor (EF) Tu	Back alignment and domain information

>cd04133 Rop_like Rop subfamily	Back alignment and domain information

>PRK11058 GTPase HflX; Provisional	Back alignment and domain information

>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily	Back alignment and domain information

>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily	Back alignment and domain information

>cd04130 Wrch_1 Wrch-1 subfamily	Back alignment and domain information

>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily	Back alignment and domain information

>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE	Back alignment and domain information

>cd01882 BMS1 Bms1	Back alignment and domain information

>smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases	Back alignment and domain information

>cd01870 RhoA_like RhoA-like subfamily	Back alignment and domain information

>COG0370 FeoB Fe2+ transport system protein B [Inorganic ion transport and metabolism]	Back alignment and domain information

>cd01876 YihA_EngB The YihA (EngB) subfamily	Back alignment and domain information

>TIGR00437 feoB ferrous iron transporter FeoB	Back alignment and domain information

>cd04131 Rnd Rnd subfamily	Back alignment and domain information

>cd04148 RGK RGK subfamily	Back alignment and domain information

>cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily	Back alignment and domain information

>cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily	Back alignment and domain information

>KOG0078\|consensus	Back alignment and domain information

>KOG0098\|consensus	Back alignment and domain information

>cd00882 Ras_like_GTPase Ras-like GTPase superfamily	Back alignment and domain information

>KOG0394\|consensus	Back alignment and domain information

>cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta)	Back alignment and domain information

>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse	Back alignment and domain information

>PTZ00132 GTP-binding nuclear protein Ran; Provisional	Back alignment and domain information

>KOG1423\|consensus	Back alignment and domain information

>KOG0075\|consensus	Back alignment and domain information

>PRK09866 hypothetical protein; Provisional	Back alignment and domain information

>PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases	Back alignment and domain information

>cd04129 Rho2 Rho2 subfamily	Back alignment and domain information

>cd04103 Centaurin_gamma Centaurin gamma	Back alignment and domain information

>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1)	Back alignment and domain information

>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins	Back alignment and domain information

>cd04104 p47_IIGP_like p47 (47-kDa) family	Back alignment and domain information

>COG2262 HflX GTPases [General function prediction only]	Back alignment and domain information

>cd01873 RhoBTB RhoBTB subfamily	Back alignment and domain information

>KOG0087\|consensus	Back alignment and domain information

>KOG0073\|consensus	Back alignment and domain information

>KOG0080\|consensus	Back alignment and domain information

>cd04102 RabL3 RabL3 (Rab-like3) subfamily	Back alignment and domain information

>KOG0095\|consensus	Back alignment and domain information

>KOG1489\|consensus	Back alignment and domain information

>KOG0070\|consensus	Back alignment and domain information

>cd04094 selB_III This family represents the domain of elongation factor SelB, homologous to domain III of EF-Tu	Back alignment and domain information

>KOG0086\|consensus	Back alignment and domain information

>KOG0076\|consensus	Back alignment and domain information

>PLN00023 GTP-binding protein; Provisional	Back alignment and domain information

>KOG1532\|consensus	Back alignment and domain information

>COG3596 Predicted GTPase [General function prediction only]	Back alignment and domain information

>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases	Back alignment and domain information

>KOG1191\|consensus	Back alignment and domain information

>cd03688 eIF2_gamma_II eIF2_gamma_II: this subfamily represents the domain II of the gamma subunit of eukaryotic translation initiation factor 2 (eIF2-gamma) found in Eukaryota and Archaea	Back alignment and domain information

>COG1084 Predicted GTPase [General function prediction only]	Back alignment and domain information

>KOG0093\|consensus	Back alignment and domain information

>KOG0079\|consensus	Back alignment and domain information

>PF09439 SRPRB: Signal recognition particle receptor beta subunit; InterPro: IPR019009 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]	Back alignment and domain information

>cd01850 CDC_Septin CDC/Septin	Back alignment and domain information

>COG1100 GTPase SAR1 and related small G proteins [General function prediction only]	Back alignment and domain information

>PRK13768 GTPase; Provisional	Back alignment and domain information

>PF04670 Gtr1_RagA: Gtr1/RagA G protein conserved region; InterPro: IPR006762 GTR1 was first identified in Saccharomyces cerevisiae (Baker's yeast) as a suppressor of a mutation in RCC1	Back alignment and domain information

>cd03692 mtIF2_IVc mtIF2_IVc: this family represents the C2 subdomain of domain IV of mitochondrial translation initiation factor 2 (mtIF2) which adopts a beta-barrel fold displaying a high degree of structural similarity with domain II of the translation elongation factor EF-Tu	Back alignment and domain information

>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity	Back alignment and domain information

>COG4917 EutP Ethanolamine utilization protein [Amino acid transport and metabolism]	Back alignment and domain information

>KOG0090\|consensus	Back alignment and domain information

>KOG0091\|consensus	Back alignment and domain information

>cd01899 Ygr210 Ygr210 subfamily	Back alignment and domain information

>PTZ00099 rab6; Provisional	Back alignment and domain information

>KOG0088\|consensus	Back alignment and domain information

>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts)	Back alignment and domain information

>COG0536 Obg Predicted GTPase [General function prediction only]	Back alignment and domain information

>KOG0395\|consensus	Back alignment and domain information

>PRK09435 membrane ATPase/protein kinase; Provisional	Back alignment and domain information

>KOG0097\|consensus	Back alignment and domain information

>KOG0071\|consensus	Back alignment and domain information

>COG1163 DRG Predicted GTPase [General function prediction only]	Back alignment and domain information

>KOG0074\|consensus	Back alignment and domain information

>cd01342 Translation_Factor_II_like Translation_Factor_II_like: Elongation factor Tu (EF-Tu) domain II-like proteins	Back alignment and domain information

>KOG0072\|consensus	Back alignment and domain information

>COG5192 BMS1 GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0081\|consensus	Back alignment and domain information

>PRK09602 translation-associated GTPase; Reviewed	Back alignment and domain information

>TIGR00073 hypB hydrogenase accessory protein HypB	Back alignment and domain information

>PF03144 GTP_EFTU_D2: Elongation factor Tu domain 2; InterPro: IPR004161 Translation elongation factors are responsible for two main processes during protein synthesis on the ribosome [, , ]	Back alignment and domain information

>PF05049 IIGP: Interferon-inducible GTPase (IIGP); InterPro: IPR007743 Interferon-inducible GTPase (IIGP) is thought to play a role in in intracellular defence	Back alignment and domain information

>cd03690 Tet_II Tet_II: This subfamily represents domain II of ribosomal protection proteins Tet(M) and Tet(O)	Back alignment and domain information

>TIGR00750 lao LAO/AO transport system ATPase	Back alignment and domain information

>PF04548 AIG1: AIG1 family; InterPro: IPR006703 This entry represents a domain found in Arabidopsis protein AIG1 which appears to be involved in plant resistance to bacteria	Back alignment and domain information

>cd04092 mtEFG2_II_like mtEFG2_C: C-terminus of mitochondrial Elongation factor G2 (mtEFG2)-like proteins found in eukaryotes	Back alignment and domain information

>TIGR02836 spore_IV_A stage IV sporulation protein A	Back alignment and domain information

>cd03699 lepA_II lepA_II: This subfamily represents the domain II of LepA, a GTP-binding protein localized in the cytoplasmic membrane	Back alignment and domain information

>KOG0410\|consensus	Back alignment and domain information

>cd03689 RF3_II RF3_II: this subfamily represents the domain II of bacterial Release Factor 3 (RF3)	Back alignment and domain information

>TIGR00991 3a0901s02IAP34 GTP-binding protein (Chloroplast Envelope Protein Translocase)	Back alignment and domain information

>cd04088 EFG_mtEFG_II EFG_mtEFG_II: this subfamily represents the domain II of elongation factor G (EF-G) in bacteria and, the C-terminus of mitochondrial Elongation factor G1 (mtEFG1) and G2 (mtEFG2)_like proteins found in eukaryotes	Back alignment and domain information

>PF00350 Dynamin_N: Dynamin family; InterPro: IPR001401 Membrane transport between compartments in eukaryotic cells requires proteins that allow the budding and scission of nascent cargo vesicles from one compartment and their targeting and fusion with another	Back alignment and domain information

>smart00053 DYNc Dynamin, GTPase	Back alignment and domain information

>KOG0077\|consensus	Back alignment and domain information

>COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription]	Back alignment and domain information

>PF14578 GTP_EFTU_D4: Elongation factor Tu domain 4; PDB: 1G7R_A 1G7S_A 1G7T_A 1XE1_A	Back alignment and domain information

>KOG4252\|consensus	Back alignment and domain information

>cd03691 BipA_TypA_II BipA_TypA_II: domain II of BipA (also called TypA) having homology to domain II of the elongation factors (EFs) EF-G and EF-Tu	Back alignment and domain information

>KOG3886\|consensus	Back alignment and domain information

>cd04091 mtEFG1_II_like mtEFG1_C: C-terminus of mitochondrial Elongation factor G1 (mtEFG1)-like proteins found in eukaryotes	Back alignment and domain information

>TIGR00101 ureG urease accessory protein UreG	Back alignment and domain information

>KOG0083\|consensus	Back alignment and domain information

>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional	Back alignment and domain information

>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components	Back alignment and domain information

>KOG2486\|consensus	Back alignment and domain information

>KOG3883\|consensus	Back alignment and domain information

>PTZ00258 GTP-binding protein; Provisional	Back alignment and domain information

>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR00993 3a0901s04IAP86 chloroplast protein import component Toc86/159, G and M domains	Back alignment and domain information

>KOG0393\|consensus	Back alignment and domain information

>KOG1707\|consensus	Back alignment and domain information

>cd01900 YchF YchF subfamily	Back alignment and domain information

>PRK09601 GTP-binding protein YchF; Reviewed	Back alignment and domain information

>PF00735 Septin: Septin; InterPro: IPR000038 Septins constitute a eukaryotic family of guanine nucleotide-binding proteins, most of which polymerise to form filaments []	Back alignment and domain information

>cd03700 eEF2_snRNP_like_II EF2_snRNP_like_II: this subfamily represents domain II of elongation factor (EF) EF-2 found eukaryotes and archaea and, the C-terminal portion of the spliceosomal human 116kD U5 small nuclear ribonucleoprotein (snRNP) protein (U5-116 kD) and, its yeast counterpart Snu114p	Back alignment and domain information

>cd01859 MJ1464 MJ1464	Back alignment and domain information

>KOG1673\|consensus	Back alignment and domain information

>KOG0448\|consensus	Back alignment and domain information

>cd01857 HSR1_MMR1 HSR1/MMR1	Back alignment and domain information

>KOG0096\|consensus	Back alignment and domain information

>cd01856 YlqF YlqF	Back alignment and domain information

>cd04090 eEF2_II_snRNP Loc2 eEF2_C_snRNP, cd01514/C terminal domain:eEF2_C_snRNP: This family includes C-terminal portion of the spliceosomal human 116kD U5 small nuclear ribonucleoprotein (snRNP) protein (U5-116 kD) and, its yeast counterpart Snu114p	Back alignment and domain information

>TIGR01425 SRP54_euk signal recognition particle protein SRP54	Back alignment and domain information

>KOG1490\|consensus	Back alignment and domain information

>KOG1534\|consensus	Back alignment and domain information

>cd01858 NGP_1 NGP-1	Back alignment and domain information

>cd01858 NGP_1 NGP-1	Back alignment and domain information

>KOG1547\|consensus	Back alignment and domain information

>cd04178 Nucleostemin_like Nucleostemin-like	Back alignment and domain information

>cd01855 YqeH YqeH	Back alignment and domain information

>cd01851 GBP Guanylate-binding protein (GBP), N-terminal domain	Back alignment and domain information

>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF	Back alignment and domain information

>PF05783 DLIC: Dynein light intermediate chain (DLIC); InterPro: IPR022780 This entry consists of several eukaryotic dynein light intermediate chain proteins	Back alignment and domain information

>COG5019 CDC3 Septin family protein [Cell division and chromosome partitioning / Cytoskeleton]	Back alignment and domain information

>COG0012 Predicted GTPase, probable translation factor [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis	Back alignment and domain information

>TIGR00157 ribosome small subunit-dependent GTPase A	Back alignment and domain information

>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]	Back alignment and domain information

>KOG3905\|consensus	Back alignment and domain information

>KOG1486\|consensus	Back alignment and domain information

>cd01849 YlqF_related_GTPase YlqF-related GTPases	Back alignment and domain information

>cd01849 YlqF_related_GTPase YlqF-related GTPases	Back alignment and domain information

>PRK10416 signal recognition particle-docking protein FtsY; Provisional	Back alignment and domain information

>TIGR00064 ftsY signal recognition particle-docking protein FtsY	Back alignment and domain information

>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK12289 GTPase RsgA; Reviewed	Back alignment and domain information

>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes	Back alignment and domain information

>PRK09563 rbgA GTPase YlqF; Reviewed	Back alignment and domain information

>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>KOG1954\|consensus	Back alignment and domain information

>cd01855 YqeH YqeH	Back alignment and domain information

>cd01857 HSR1_MMR1 HSR1/MMR1	Back alignment and domain information

>PRK14974 cell division protein FtsY; Provisional	Back alignment and domain information

>cd03112 CobW_like The function of this protein family is unkown	Back alignment and domain information

>cd03114 ArgK-like The function of this protein family is unkown	Back alignment and domain information

>PRK00098 GTPase RsgA; Reviewed	Back alignment and domain information

>COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning]	Back alignment and domain information

>KOG2655\|consensus	Back alignment and domain information

>PRK00771 signal recognition particle protein Srp54; Provisional	Back alignment and domain information

>TIGR00487 IF-2 translation initiation factor IF-2	Back alignment and domain information

>PRK12288 GTPase RsgA; Reviewed	Back alignment and domain information

>COG1161 Predicted GTPases [General function prediction only]	Back alignment and domain information

>cd01856 YlqF YlqF	Back alignment and domain information

>TIGR00157 ribosome small subunit-dependent GTPase A	Back alignment and domain information

>PRK09563 rbgA GTPase YlqF; Reviewed	Back alignment and domain information

>PRK05306 infB translation initiation factor IF-2; Validated	Back alignment and domain information

>KOG4423\|consensus	Back alignment and domain information

>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF	Back alignment and domain information

>PRK12724 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>CHL00189 infB translation initiation factor 2; Provisional	Back alignment and domain information

>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion]	Back alignment and domain information

>KOG1487\|consensus	Back alignment and domain information

>cd01854 YjeQ_engC YjeQ/EngC	Back alignment and domain information

>cd03110 Fer4_NifH_child This protein family's function is unkown	Back alignment and domain information

>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>PRK12289 GTPase RsgA; Reviewed	Back alignment and domain information

>TIGR00959 ffh signal recognition particle protein	Back alignment and domain information

>PRK10867 signal recognition particle protein; Provisional	Back alignment and domain information

>TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH	Back alignment and domain information

>COG1162 Predicted GTPases [General function prediction only]	Back alignment and domain information

>TIGR00092 GTP-binding protein YchF	Back alignment and domain information

>KOG0082\|consensus	Back alignment and domain information

>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>KOG3887\|consensus	Back alignment and domain information

>KOG1533\|consensus	Back alignment and domain information

>PRK12288 GTPase RsgA; Reviewed	Back alignment and domain information

>PRK12723 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>cd02036 MinD Bacterial cell division requires the formation of a septum at mid-cell	Back alignment and domain information

>PRK12726 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>cd01854 YjeQ_engC YjeQ/EngC	Back alignment and domain information

>TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH	Back alignment and domain information

>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion]	Back alignment and domain information

>PRK13796 GTPase YqeH; Provisional	Back alignment and domain information

>KOG0780\|consensus	Back alignment and domain information

>KOG1491\|consensus	Back alignment and domain information

>PRK12727 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>cd01859 MJ1464 MJ1464	Back alignment and domain information

>cd03111 CpaE_like This protein family consists of proteins similar to the cpaE protein of the Caulobacter pilus assembly and the orf4 protein of Actinobacillus pilus formation gene cluster	Back alignment and domain information

>cd02038 FleN-like FleN is a member of the Fer4_NifH superfamily	Back alignment and domain information

>PRK01889 GTPase RsgA; Reviewed	Back alignment and domain information

>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>cd00066 G-alpha G protein alpha subunit	Back alignment and domain information

>COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>smart00275 G_alpha G protein alpha subunit	Back alignment and domain information

>PRK13796 GTPase YqeH; Provisional	Back alignment and domain information

>PF02492 cobW: CobW/HypB/UreG, nucleotide-binding domain; InterPro: IPR003495 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt	Back alignment and domain information

>PRK00098 GTPase RsgA; Reviewed	Back alignment and domain information

>KOG2485\|consensus	Back alignment and domain information

>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>KOG0447\|consensus	Back alignment and domain information

>PRK11537 putative GTP-binding protein YjiA; Provisional	Back alignment and domain information

>COG0523 Putative GTPases (G3E family) [General function prediction only]	Back alignment and domain information

>COG1162 Predicted GTPases [General function prediction only]	Back alignment and domain information

>cd03702 IF2_mtIF2_II This family represents the domain II of bacterial Initiation Factor 2 (IF2) and its eukaryotic mitochondrial homologue mtIF2	Back alignment and domain information

>cd02037 MRP-like MRP (Multiple Resistance and pH adaptation) is a homologue of the Fer4_NifH superfamily	Back alignment and domain information

>cd02042 ParA ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation	Back alignment and domain information

>TIGR02475 CobW cobalamin biosynthesis protein CobW	Back alignment and domain information

>cd03703 aeIF5B_II aeIF5B_II: This family represents the domain II of archeal and eukaryotic aeIF5B	Back alignment and domain information

>KOG4181\|consensus	Back alignment and domain information

>PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional	Back alignment and domain information

>PF09547 Spore_IV_A: Stage IV sporulation protein A (spore_IV_A); InterPro: IPR014201 This entry is designated stage IV sporulation protein A	Back alignment and domain information

>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain	Back alignment and domain information

>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion]	Back alignment and domain information

>TIGR03348 VI_IcmF type VI secretion protein IcmF	Back alignment and domain information

>TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2	Back alignment and domain information

>KOG2743\|consensus	Back alignment and domain information

>KOG2484\|consensus	Back alignment and domain information

>COG3172 NadR Predicted ATPase/kinase involved in NAD metabolism [Coenzyme metabolism]	Back alignment and domain information

>cd04178 Nucleostemin_like Nucleostemin-like	Back alignment and domain information

>PRK13695 putative NTPase; Provisional	Back alignment and domain information

>cd03701 IF2_IF5B_II IF2_IF5B_II: This family represents the domain II of prokaryotic Initiation Factor 2 (IF2) and its archeal and eukaryotic homologue aeIF5B	Back alignment and domain information

>KOG2423\|consensus	Back alignment and domain information

>KOG1424\|consensus	Back alignment and domain information

>PF09173 eIF2_C: Initiation factor eIF2 gamma, C terminal; InterPro: IPR015256 This entry represents a domain which is found in the initiation factors eIF2 and EF-Tu, adopting a beta barrel structure with Greek key topology	Back alignment and domain information

>PF06858 NOG1: Nucleolar GTP-binding protein 1 (NOG1); InterPro: IPR010674 This domain represents a conserved region of approximately 60 residues in length within nucleolar GTP-binding protein 1 (NOG1)	Back alignment and domain information

>PRK04004 translation initiation factor IF-2; Validated	Back alignment and domain information

>PRK14845 translation initiation factor IF-2; Provisional	Back alignment and domain information

>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional	Back alignment and domain information

>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A	Back alignment and domain information

>smart00010 small_GTPase Small GTPase of the Ras superfamily; ill-defined subfamily	Back alignment and domain information

>COG1341 Predicted GTPase or GTP-binding protein [General function prediction only]	Back alignment and domain information

>KOG3859\|consensus	Back alignment and domain information

>PF13555 AAA_29: P-loop containing region of AAA domain	Back alignment and domain information

>COG3523 IcmF Type VI protein secretion system component VasK [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PRK01889 GTPase RsgA; Reviewed	Back alignment and domain information

>COG1763 MobB Molybdopterin-guanine dinucleotide biosynthesis protein [Coenzyme metabolism]	Back alignment and domain information

>PF00503 G-alpha: G-protein alpha subunit; InterPro: IPR001019 Guanine nucleotide binding proteins (G proteins) are membrane-associated, heterotrimeric proteins composed of three subunits: alpha (IPR001019 from INTERPRO), beta (IPR001632 from INTERPRO) and gamma (IPR001770 from INTERPRO) []	Back alignment and domain information

>KOG2484\|consensus	Back alignment and domain information

>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ]	Back alignment and domain information

>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism]	Back alignment and domain information

>TIGR00235 udk uridine kinase	Back alignment and domain information

>PRK08118 topology modulation protein; Reviewed	Back alignment and domain information

>PRK07261 topology modulation protein; Provisional	Back alignment and domain information

>KOG1144\|consensus	Back alignment and domain information

>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars	Back alignment and domain information

>KOG0781\|consensus	Back alignment and domain information

>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B	Back alignment and domain information

>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>cd03116 MobB Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes	Back alignment and domain information

>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms]	Back alignment and domain information

>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>KOG1707\|consensus	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		459
1f60_A		458	Crystal Structure Of The Yeast Elongation Factor Co		0.0
3agj_A		437	Crystal Structure Of Archaeal Pelota And Gtp-bound		1e-136
3vmf_A		440	Archaeal Protein Length = 440		1e-136
1jny_A		435	Crystal Structure Of Sulfolobus Solfataricus Elonga		1e-136
3j2k_7		439	Cryo-Em Structure Of The Mammalian Erf1-Erf3-Associ		7e-85
1r5b_A		467	Crystal Structure Analysis Of Sup35 Length = 467		2e-80
3mca_A		592	Structure Of The Dom34-Hbs1 Complex And Implication		2e-72
3izq_1		611	Structure Of The Dom34-Hbs1-Gdpnp Complex Bound To		4e-57
3p26_A		483	Crystal Structure Of S. Cerevisiae Hbs1 Protein (Ap		6e-57
3p27_A		483	Crystal Structure Of S. Cerevisiae Hbs1 Protein (Gd		2e-54
4abr_Z		405	Complex Of Smpb, A Tmrna Fragment And Ef-Tu-Gdp-Kir		6e-45
1ttt_A		405	Phe-Trna, Elongation Factor Ef-Tu:gdpnp Ternary Com		6e-45
1eft_A		405	The Crystal Structure Of Elongation Factor Ef-Tu Fr		1e-44
2y0u_Z		405	The Crystal Structure Of Ef-Tu And A9c-Trna-Trp Bou		4e-44
2c78_A		405	Ef-Tu Complexed With A Gtp Analog And The Antibioti		4e-44
2c77_A		405	Ef-Tu Complexed With A Gtp Analog And The Antibioti		5e-44
2y0y_Z		405	The Crystal Structure Of Ef-Tu And G24a-Trna-Trp Bo		5e-44
1aip_A		405	Ef-Tu Ef-Ts Complex From Thermus Thermophilus Lengt		5e-44
2wrn_Z		406	The Crystal Structure Of The 70s Ribosome Bound To		6e-44
1exm_A		405	Crystal Structure Of Thermus Thermophilus Elongatio		2e-43
1d2e_A		397	Crystal Structure Of Mitochondrial Ef-Tu In Complex		1e-42
1mj1_A		405	Fitting The Ternary Complex Of Ef-TuTRNAGTP AND RIB		3e-40
1xb2_A		409	Crystal Structure Of Bos Taurus Mitochondrial Elong		5e-40
1zun_B		434	Crystal Structure Of A Gtp-Regulated Atp Sulfurylas		7e-39
1efc_A		393	Intact Elongation Factor From E.Coli Length = 393		5e-34
1ob2_A		393	E. Coli Elongation Factor Ef-Tu Complexed With The		5e-34
3u6b_A		394	Ef-Tu (Escherichia Coli) In Complex With Nvp-Ldi028		5e-34
1d8t_A		393	Crystal Structure Of Elongation Factor, Tu (Ef-Tu-M		5e-34
1dg1_G		394	Whole, Unmodified, Ef-Tu(Elongation Factor Tu). Len		6e-34
1efu_A		385	Elongation Factor Complex Ef-TuEF-Ts From Escherich		7e-34
3agp_A		1289	Structure Of Viral Polymerase Form I Length = 1289		8e-34
3mmp_A		678	Structure Of The Qb Replicase, An Rna-Dependent Rna		1e-33
1efm_A		379	Structure Of The Gdp Domain Of Ef-Tu And Location O		2e-32
2hcj_B		335	"trypsin-Modified Elongation Factor Tu In Complex W		2e-28
2hdn_B		335	Trypsin-Modified Elongation Factor Tu In Complex Wi		2e-28
4ac9_A		482	Crystal Structure Of Translation Elongation Factor		8e-24
3e1y_E		204	Crystal Structure Of Human Erf1ERF3 COMPLEX Length		7e-22
3e20_A		201	Crystal Structure Of S.Pombe Erf1ERF3 COMPLEX Lengt		4e-20
2d74_A		419	Crystal Structure Of Translation Initiation Factor		1e-14
1kjz_A		410	Structure Of The Large Gamma Subunit Of Initiation		2e-14
1kk3_A		410	Structure Of The Wild-Type Large Gamma Subunit Of I		2e-14
3j25_A		638	Structural Basis For Tetm-Mediated Tetracycline Res		4e-13
1kk0_A		410	Structure Of The Large Gamma Subunit Of Initiation		9e-13
2ywe_A		600	Crystal Structure Of Lepa From Aquifex Aeolicus Len		6e-11
1s0u_A		408	Eif2gamma Apo Length = 408		9e-11
3cb4_D		599	The Crystal Structure Of Lepa Length = 599		1e-10
3deg_C		545	Complex Of Elongating Escherichia Coli 70s Ribosome		1e-10
2ywg_A		600	Crystal Structure Of Gtp-Bound Lepa From Aquifex Ae		3e-10
3pen_A		403	Structure Of Archaeal Initiation Factor Aif2gamma S		3e-09
2bm1_A		691	Ribosomal Elongation Factor G (Ef-G) Fusidic Acid R		5e-09
3sjz_A		409	The Structure Of Aif2gamma Subunit Delta 41-45 From		6e-09
2bm0_A		691	Ribosomal Elongation Factor G (Ef-G) Fusidic Acid R		1e-08
2aho_A		414	Structure Of The Archaeal Initiation Factor Eif2 Al		1e-08
2pmd_A		415	The Structures Of Aif2gamma Subunit From The Archae		1e-08
2bv3_A		691	Crystal Structure Of A Mutant Elongation Factor G T		1e-08
2j7k_A		691	Crystal Structure Of The T84a Mutant Ef-G:gdpcp Com		1e-08
2elf_A		370	Crystal Structure Of The Selb-Like Elongation Facto		1e-08
1efg_A		691	The Crystal Structure Of Elongation Factor G Comple		4e-08
1ktv_A		691	Crystal Structure Of Elongation Factor G Dimer With		4e-08
1fnm_A		691	Structure Of Thermus Thermophilus Ef-G H573a Length		4e-08
3izp_E		688	Conformation Of Ef-G During Translocation Length =		5e-08
3vqt_A		548	Crystal Structure Analysis Of The Translation Facto		1e-07
3uoq_W		534	Crystal Structure Of Release Factor Rf3 Trapped In		1e-07
2h5e_A		529	Crystal Structure Of E.Coli Polypeptide Release Fac		1e-07
3zz0_A		693	Crystal Structure Of Ribosomal Elongation Factor (E		2e-07
1u2r_A		842	Crystal Structure Of Adp-Ribosylated Ribosomal Tran		3e-07
1n0v_C		842	Crystal Structure Of Elongation Factor 2 Length = 8		3e-07
2xex_A		693	Crystal Structure Of Staphylococcus Aureus Elongati		4e-07
4fn5_A		709	Elongation Factor G 1 (Pseudomonas Aeruginosa) In C		8e-07
3zzu_A		693	Crystal Structure Of Staphylococcus Aureus Elongati		8e-07
3tr5_A		528	Structure Of A Peptide Chain Release Factor 3 (Prfc		9e-07
3zzt_A		693	Crystal Structure Of Staphylococcus Aureus Elongati		2e-06
3j0e_H		702	Models For The T. Thermophilus Ribosome Recycling F		9e-06
2rdo_7		704	50s Subunit With Ef-G(Gdpnp) And Rrf Bound Length =		9e-06
1wdt_A		665	Crystal Structure Of Ttk003000868 From Thermus Ther		9e-05
3izy_P		537	Mammalian Mitochondrial Translation Initiation Fact		2e-04

>pdb|1F60|A Chain A, Crystal Structure Of The Yeast Elongation Factor Complex Eef1a:eef1ba Length = 458