Psyllid ID: psy13961


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------46
MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETSKFYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEARFEEIKKEVSGYIKKIGYNPATVAFVPISGWHGDNMLEVSDKMPWFKGWAIERKEGKADGKCLIEALDAILPPSRPTEKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMLVTFAPANLTTEVKSVEMHHEALQEAVPGDNVGFNVKNVSVKELRRGFVAGDSKASPPKATQDFTAQVIVLNHPGQISNGYTPVLDCHTAHIACKFAEIKEKCDRRTGKTTEENPKALKSGDAAIIVLVPSKPMCVESFSEFPPLGRFAVRDMRQTVAVGVIKVNNNHGNKYLPTYLDDNYSS
ccccccEEEEEEEEEccccccccccEEEEccccccHHHHHHHHHHHHHccccccEEEEEEEHHccccccccEEEEEEcccccccEEEEEEEcccccccccccccccccccEEEEEEEccccEEEccccccccHHHHHHHHHcccccEEEEEEEccccccccccHHHHHHHHHHHHHHHHHHccccccccEEEccccccccccccccccccccccEEEEcccccccccHHHHHccccccccccccccccccccEEEEccEEEEEcEEEEEcccccccEEEEcccccEEEEEEEEEcHHHHccccccccEEEEEcccccccccccccccccccccccccccEEEEEEEcccccccccccccccccccccccHHHHHHHHHHHccccccccccccccccccEEEEEEEccccEEEEcccccccccccEEEccccEEEEEEEEEEEccccccccccccccccc
cccccEEEEEEEEEcccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccccccccEEEEcccEEEEEEEccccccHHHHHHHccccccEEEEEEEccHHHHHHHcccccHHHHHHHHHHHccccEEEEEEEcHHHHcccccHHHHHHHHHHHHHHHHHHcccHHHccEEEccccccEcccEccccccccccEEEEccccEEEEccHHHHHHcccccccccccccEEEEEEEEEEcccEEEEEEEccEccEccccEEEEEcccEEEEEEEEEEccEEcccEccccEEEEEEccccccccccccEEEEccccccccccEEEEEEEEccccccEccccccEEEEccEEEEEEEEEEEEEEccccccEEEEccccEccccEEEEEEEEccccccccccccHHHcEEEEEEccEEEEEEEEEEEEcccccccEccccccccc
MGKEKTHINIVVIGhvdsgkstttghliykcggidkRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETSKFYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGtgefeagiskngqTREHALLAFTLGVKQLIVGVnkmdsteppyseaRFEEIKKEVSGYIKkigynpatvafvpisgwhgdnmlevsdkmpwfkgWAIERKEGKADGKCLIEALdailppsrptekplrlplqdvykiggigtvpvgrvetgvikpgmlvtfapanlttEVKSVEMHHEALqeavpgdnvgfnvkNVSVKELRrgfvagdskasppkatqdFTAQVIVLnhpgqisngytpvldcHTAHIACKFAEIKEkcdrrtgktteenpkalksgdaAIIVlvpskpmcvesfsefpplgrfavrDMRQTVAVGVIKVnnnhgnkylptylddnyss
mgkekthiNIVVighvdsgkstttghLIYKCGGIDKRTIEKFEKEAqemgkgsfkyAWVLDKLKAERERGITIdialwkfetsKFYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMdsteppysearfEEIKKEVSGYIKKIGYNPATVAFVPISGWHGDNMLEVSDKMPWFKGWAIERKEGKADGKCLIEALdailppsrptekplrlplqdvykiggigtvPVGRVETGVIKPGMLVTFAPANLTTEVKSVEMHHEALqeavpgdnvgfNVKNVSVKELRRGFvagdskasppkaTQDFTAQVIVLNHPGQISNGYTPVLDCHTAHIACKFAEikekcdrrtgktteenpkalksgdaAIIVLVPSKPMCVESFSEFPPLGRFAVRDMRQTVAVGVikvnnnhgnkylptylddnyss
MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETSKFYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEARFEEIKKEVSGYIKKIGYNPATVAFVPISGWHGDNMLEVSDKMPWFKGWAIERKEGKADGKCLIEALDAILPPSRPTEKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMLVTFAPANLTTEVKSVEMHHEALQEAVPGDNVGFNVKNVSVKELRRGFVAGDSKASPPKATQDFTAQVIVLNHPGQISNGYTPVLDCHTAHIACKFAEIKEKCDRRTGKTTEENPKALKSGDAAIIVLVPSKPMCVESFSEFPPLGRFAVRDMRQTVAVGVIKVNNNHGNKYLPTYLDDNYSS
******HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETSKFYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKM***********FEEIKKEVSGYIKKIGYNPATVAFVPISGWHGDNMLEVSDKMPWFKGWAIERKEGKADGKCLIEALDAILP********LRLPLQDVYKIGGIGTVPVGRVETGVIKPGMLVTFAPANLTTEVKSVEMHHEALQEAVPGDNVGFNVKNVSVKELRRGFV*************DFTAQVIVLNHPGQISNGYTPVLDCHTAHIACKFAEIKEKC******************DAAIIVLVPSKPMCVESFSEFPPLGRFAVRDMRQTVAVGVIKVNNNHGNKYLPTYL******
***EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEK*****GKGSFKYAWVLDKLKAERERGITIDIALWKFETSKFYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEARFEEIKKEVSGYIKKIGYNPATVAFVPISGWHGDNMLEVSDKMPWFKGWAIERKEGKADGKCLIEALDAILPPSRPTEKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMLVTFAPANLTTEVKSVEMHHEALQEAVPGDNVGFNVKNVSVKELRRGFVAGDSKASPPKATQDFTAQVIVLNHPGQISNGYTPVLDCHTAHIACKFAEIKEKCDRRTGKTTEENPKALKSGDAAIIVLVPSKPMCVESFSEFPPLGRFAVRDMRQTVAVGVIKVNNNHGNKYLPTYL******
MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETSKFYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEARFEEIKKEVSGYIKKIGYNPATVAFVPISGWHGDNMLEVSDKMPWFKGWAIERKEGKADGKCLIEALDAILPPSRPTEKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMLVTFAPANLTTEVKSVEMHHEALQEAVPGDNVGFNVKNVSVKELRRGFVAG*********TQDFTAQVIVLNHPGQISNGYTPVLDCHTAHIACKFAEIKEKCDRRTGKTTEENPKALKSGDAAIIVLVPSKPMCVESFSEFPPLGRFAVRDMRQTVAVGVIKVNNNHGNKYLPTYLDDNYSS
***EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETSKFYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEARFEEIKKEVSGYIKKIGYNPATVAFVPISGWHGDNMLEVSDKMPWFKGWAIERKEGKADGKCLIEALDAILPPSRPTEKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMLVTFAPANLTTEVKSVEMHHEALQEAVPGDNVGFNVKNVSVKELRRGFVAGDSKASPPKATQDFTAQVIVLNHPGQISNGYTPVLDCHTAHIACKFAEIKEKCDRRTGKTTEENPKALKSGDAAIIVLVPSKPMCVESFSEFPPLGRFAVRDMRQTVAVGVIKVNNNHGNKYLPTY*******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETSKFYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEARFEEIKKEVSGYIKKIGYNPATVAFVPISGWHGDNMLEVSDKMPWFKGWAIERKEGKADGKCLIEALDAILPPSRPTEKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMLVTFAPANLTTEVKSVEMHHEALQEAVPGDNVGFNVKNVSVKELRRGFVAGDSKASPPKATQDFTAQVIVLNHPGQISNGYTPVLDCHTAHIACKFAEIKEKCDRRTGKTTEENPKALKSGDAAIIVLVPSKPMCVESFSEFPPLGRFAVRDMRQTVAVGVIKVNNNHGNKYLPTYLDDNYSS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query459 2.2.26 [Sep-21-2011]
P29520463 Elongation factor 1-alpha N/A N/A 0.962 0.954 0.925 0.0
P05303462 Elongation factor 1-alpha yes N/A 0.962 0.956 0.916 0.0
P08736463 Elongation factor 1-alpha no N/A 0.962 0.954 0.909 0.0
P02993462 Elongation factor 1-alpha N/A N/A 0.962 0.956 0.902 0.0
P19039461 Elongation factor 1-alpha no N/A 0.956 0.952 0.906 0.0
Q92005462 Elongation factor 1-alpha yes N/A 0.956 0.950 0.881 0.0
Q9YIC0461 Elongation factor 1-alpha N/A N/A 0.956 0.952 0.874 0.0
Q26487413 Elongation factor 1-alpha N/A N/A 0.899 1.0 0.920 0.0
P62632463 Elongation factor 1-alpha yes N/A 0.956 0.948 0.856 0.0
P62631463 Elongation factor 1-alpha yes N/A 0.956 0.948 0.856 0.0
>sp|P29520|EF1A_BOMMO Elongation factor 1-alpha OS=Bombyx mori PE=2 SV=1 Back     alignment and function desciption
 Score =  850 bits (2196), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/442 (92%), Positives = 423/442 (95%)

Query: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60

Query: 61  DKLKAERERGITIDIALWKFETSKFYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 120
           DKLKAERERGITIDIALWKFETSK+YVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT
Sbjct: 61  DKLKAERERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 120

Query: 121 GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEARFEEIKKEVSGYIKK 180
           GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSE RFEEIKKEVS YIKK
Sbjct: 121 GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKK 180

Query: 181 IGYNPATVAFVPISGWHGDNMLEVSDKMPWFKGWAIERKEGKADGKCLIEALDAILPPSR 240
           IGYNPA VAFVPISGWHGDNMLE S KMPWFKGW +ERKEGKADGK LIEALDAILPP+R
Sbjct: 181 IGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKSLIEALDAILPPAR 240

Query: 241 PTEKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMLVTFAPANLTTEVKSVEMHHEALQ 300
           PT+KPLRLPLQDVYKIGGIGTVPVGRVETGV+KPG +V FAPAN+TTEVKSVEMHHEALQ
Sbjct: 241 PTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGTIVVFAPANITTEVKSVEMHHEALQ 300

Query: 301 EAVPGDNVGFNVKNVSVKELRRGFVAGDSKASPPKATQDFTAQVIVLNHPGQISNGYTPV 360
           EAVPGDNVGFNVKNVSVKELRRG+VAGDSK +PPK   DFTAQVIVLNHPGQISNGYTPV
Sbjct: 301 EAVPGDNVGFNVKNVSVKELRRGYVAGDSKNNPPKGAADFTAQVIVLNHPGQISNGYTPV 360

Query: 361 LDCHTAHIACKFAEIKEKCDRRTGKTTEENPKALKSGDAAIIVLVPSKPMCVESFSEFPP 420
           LDCHTAHIACKFAEIKEK DRRTGK+TE NPK++KSGDAAI+ LVPSKP+CVESF EFPP
Sbjct: 361 LDCHTAHIACKFAEIKEKVDRRTGKSTEVNPKSIKSGDAAIVNLVPSKPLCVESFQEFPP 420

Query: 421 LGRFAVRDMRQTVAVGVIKVNN 442
           LGRFAVRDMRQTVAVGVIK  N
Sbjct: 421 LGRFAVRDMRQTVAVGVIKAVN 442




This protein promotes the GTP-dependent binding of aminoacyl-tRNA to the A-site of ribosomes during protein biosynthesis.
Bombyx mori (taxid: 7091)
>sp|P05303|EF1A2_DROME Elongation factor 1-alpha 2 OS=Drosophila melanogaster GN=Ef1alpha100E PE=2 SV=2 Back     alignment and function description
>sp|P08736|EF1A1_DROME Elongation factor 1-alpha 1 OS=Drosophila melanogaster GN=Ef1alpha48D PE=1 SV=2 Back     alignment and function description
>sp|P02993|EF1A_ARTSA Elongation factor 1-alpha OS=Artemia salina PE=1 SV=2 Back     alignment and function description
>sp|P19039|EF1A_APIME Elongation factor 1-alpha OS=Apis mellifera PE=3 SV=1 Back     alignment and function description
>sp|Q92005|EF1A_DANRE Elongation factor 1-alpha OS=Danio rerio GN=eef1a PE=2 SV=1 Back     alignment and function description
>sp|Q9YIC0|EF1A_ORYLA Elongation factor 1-alpha OS=Oryzias latipes GN=eef1a PE=2 SV=1 Back     alignment and function description
>sp|Q26487|EF1A_SPOFR Elongation factor 1-alpha (Fragment) OS=Spodoptera frugiperda PE=1 SV=1 Back     alignment and function description
>sp|P62632|EF1A2_RAT Elongation factor 1-alpha 2 OS=Rattus norvegicus GN=Eef1a2 PE=2 SV=1 Back     alignment and function description
>sp|P62631|EF1A2_MOUSE Elongation factor 1-alpha 2 OS=Mus musculus GN=Eef1a2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query459
40786900462 putative elongation factor 1-alpha [Homa 0.965 0.958 0.948 0.0
307095102462 putative elongation factor 1-alpha [Tria 0.965 0.958 0.941 0.0
388523593462 elongation factor 1-alpha [Cryptocercus 0.956 0.950 0.949 0.0
389607689462 elongation factor 1 alpha [Riptortus ped 0.965 0.958 0.934 0.0
305377016462 elongation factor 1 alpha [Locusta migra 0.956 0.950 0.943 0.0
332027063461 Elongation factor 1-alpha [Acromyrmex ec 0.956 0.952 0.940 0.0
307187377461 Elongation factor 1-alpha [Camponotus fl 0.956 0.952 0.940 0.0
289629288461 elongation factor 1-alpha [Nasonia vitri 0.962 0.958 0.938 0.0
307196337461 Elongation factor 1-alpha [Harpegnathos 0.956 0.952 0.936 0.0
167234441462 elongation factor 1-alpha [Tribolium cas 0.962 0.956 0.936 0.0
>gi|40786900|gb|AAR89978.1| putative elongation factor 1-alpha [Homalodisca vitripennis] gi|45387425|gb|AAS60203.1| putative elongation factor 1-alpha [Oncometopia nigricans] Back     alignment and taxonomy information
 Score =  872 bits (2252), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/443 (94%), Positives = 432/443 (97%)

Query: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60
           MGKEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL
Sbjct: 1   MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60

Query: 61  DKLKAERERGITIDIALWKFETSKFYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 120
           DKLKAERERGITIDIALWKFET+K+YVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT
Sbjct: 61  DKLKAERERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 120

Query: 121 GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEARFEEIKKEVSGYIKK 180
           GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEP YSE+RFEEIKKEVS YIKK
Sbjct: 121 GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPAYSESRFEEIKKEVSNYIKK 180

Query: 181 IGYNPATVAFVPISGWHGDNMLEVSDKMPWFKGWAIERKEGKADGKCLIEALDAILPPSR 240
           IGYNPA VAFVPISGWHGDNMLE SDKMPWFKGWAIERKEGKA+GKCLIEALDAILPPSR
Sbjct: 181 IGYNPAAVAFVPISGWHGDNMLEPSDKMPWFKGWAIERKEGKAEGKCLIEALDAILPPSR 240

Query: 241 PTEKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMLVTFAPANLTTEVKSVEMHHEALQ 300
           PTEKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGM+VTFAPANLTTEVKSVEMHHEALQ
Sbjct: 241 PTEKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPANLTTEVKSVEMHHEALQ 300

Query: 301 EAVPGDNVGFNVKNVSVKELRRGFVAGDSKASPPKATQDFTAQVIVLNHPGQISNGYTPV 360
           EAVPGDNVGFNVKNVSVKELRRGFVAGDSK++PPKA  DFTAQVIVLNHPGQISNGYTPV
Sbjct: 301 EAVPGDNVGFNVKNVSVKELRRGFVAGDSKSNPPKAAADFTAQVIVLNHPGQISNGYTPV 360

Query: 361 LDCHTAHIACKFAEIKEKCDRRTGKTTEENPKALKSGDAAIIVLVPSKPMCVESFSEFPP 420
           LDCHTAHIACKFAEIKEKCDRRTGKTTE+NPK++KSGDAAII LVPSKPMCVESF EFPP
Sbjct: 361 LDCHTAHIACKFAEIKEKCDRRTGKTTEDNPKSIKSGDAAIITLVPSKPMCVESFQEFPP 420

Query: 421 LGRFAVRDMRQTVAVGVIKVNNN 443
           LGRFAVRDMRQTVAVGVIK  N+
Sbjct: 421 LGRFAVRDMRQTVAVGVIKSVNH 443




Source: Homalodisca vitripennis

Species: Homalodisca vitripennis

Genus: Homalodisca

Family: Cicadellidae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|307095102|gb|ADN29857.1| putative elongation factor 1-alpha [Triatoma matogrossensis] Back     alignment and taxonomy information
>gi|388523593|gb|AFK49795.1| elongation factor 1-alpha [Cryptocercus punctulatus] Back     alignment and taxonomy information
>gi|389607689|dbj|BAK08877.2| elongation factor 1 alpha [Riptortus pedestris] Back     alignment and taxonomy information
>gi|305377016|dbj|BAJ15871.1| elongation factor 1 alpha [Locusta migratoria] Back     alignment and taxonomy information
>gi|332027063|gb|EGI67159.1| Elongation factor 1-alpha [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307187377|gb|EFN72500.1| Elongation factor 1-alpha [Camponotus floridanus] Back     alignment and taxonomy information
>gi|289629288|ref|NP_001166227.1| elongation factor 1-alpha [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|307196337|gb|EFN77947.1| Elongation factor 1-alpha [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|167234441|ref|NP_001107835.1| elongation factor 1-alpha [Tribolium castaneum] gi|270016369|gb|EFA12815.1| hypothetical protein TcasGA2_TC001880 [Tribolium castaneum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query459
FB|FBgn0000557462 Ef1alpha100E "Elongation facto 0.960 0.954 0.918 6.7e-223
FB|FBgn0000556463 Ef1alpha48D "Elongation factor 0.962 0.954 0.909 6.2e-220
ZFIN|ZDB-GENE-990415-52462 eef1a1l1 "eukaryotic translati 0.956 0.950 0.881 1.1e-211
ZFIN|ZDB-GENE-050706-188462 eef1a1l2 "eukaryotic translati 0.956 0.950 0.872 3.5e-210
MGI|MGI:1096317463 Eef1a2 "eukaryotic translation 0.956 0.948 0.856 4e-209
RGD|3781463 Eef1a2 "eukaryotic translation 0.956 0.948 0.856 4e-209
UNIPROTKB|Q32PH8463 EEF1A2 "Elongation factor 1-al 0.956 0.948 0.854 8.3e-209
UNIPROTKB|Q05639463 EEF1A2 "Elongation factor 1-al 0.956 0.948 0.854 8.3e-209
UNIPROTKB|F1N9H4466 EEF1A2 "Elongation factor 1-al 0.956 0.942 0.849 1.4e-208
UNIPROTKB|Q90835462 EEF1A "Elongation factor 1-alp 0.956 0.950 0.861 1.5e-207
FB|FBgn0000557 Ef1alpha100E "Elongation factor 1alpha100E" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 2152 (762.6 bits), Expect = 6.7e-223, P = 6.7e-223
 Identities = 406/442 (91%), Positives = 426/442 (96%)

Query:     1 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL
Sbjct:     1 MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60

Query:    61 DKLKAERERGITIDIALWKFETSKFYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 120
             DKLKAERERGITIDIALWKFETSK+YVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT
Sbjct:    61 DKLKAERERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 120

Query:   121 GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEARFEEIKKEVSGYIKK 180
             GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEAR+EEIKKEVS YIKK
Sbjct:   121 GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEARYEEIKKEVSSYIKK 180

Query:   181 IGYNPATVAFVPISGWHGDNMLEVSDKMPWFKGWAIERKEGKADGKCLIEALDAILPPSR 240
             IGYNPA+VAFVPISGWHGDNMLE S+KMPWFKGW++ERKEGKA+GKCLI+ALDAILPP R
Sbjct:   181 IGYNPASVAFVPISGWHGDNMLEPSEKMPWFKGWSVERKEGKAEGKCLIDALDAILPPQR 240

Query:   241 PTEKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMLVTFAPANLTTEVKSVEMHHEALQ 300
             PT+KPLRLPLQDVYKIGGIGTVPVGRVETG++KPGM+V FAP NL TEVKSVEMHHEAL 
Sbjct:   241 PTDKPLRLPLQDVYKIGGIGTVPVGRVETGLLKPGMVVNFAPVNLVTEVKSVEMHHEALT 300

Query:   301 EAVPGDNVGFNVKNVSVKELRRGFVAGDSKASPPKATQDFTAQVIVLNHPGQISNGYTPV 360
             EA+PGDNVGFNVKNVSVKELRRG+VAGDSK +PP+   DFTAQVIVLNHPGQI+NGYTPV
Sbjct:   301 EAMPGDNVGFNVKNVSVKELRRGYVAGDSKNNPPRGAADFTAQVIVLNHPGQIANGYTPV 360

Query:   361 LDCHTAHIACKFAEIKEKCDRRTGKTTEENPKALKSGDAAIIVLVPSKPMCVESFSEFPP 420
             LDCHTAHIACKF+EIKEKCDRRTGKTTE  PKA+KSGDAAIIVLVPSKP+CVESF EFPP
Sbjct:   361 LDCHTAHIACKFSEIKEKCDRRTGKTTETEPKAIKSGDAAIIVLVPSKPLCVESFQEFPP 420

Query:   421 LGRFAVRDMRQTVAVGVIK-VN 441
             LGRFAVRDMRQTVAVGVIK VN
Sbjct:   421 LGRFAVRDMRQTVAVGVIKSVN 442




GO:0006414 "translational elongation" evidence=IEA;ISS;NAS
GO:0003746 "translation elongation factor activity" evidence=ISS;NAS
GO:0005737 "cytoplasm" evidence=NAS
GO:0005853 "eukaryotic translation elongation factor 1 complex" evidence=ISS
GO:0006412 "translation" evidence=NAS
GO:0003924 "GTPase activity" evidence=IEA;NAS
GO:0005525 "GTP binding" evidence=IEA
GO:0005811 "lipid particle" evidence=IDA
GO:0022008 "neurogenesis" evidence=IMP
FB|FBgn0000556 Ef1alpha48D "Elongation factor 1alpha48D" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-990415-52 eef1a1l1 "eukaryotic translation elongation factor 1 alpha 1, like 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050706-188 eef1a1l2 "eukaryotic translation elongation factor 1 alpha 1, like 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:1096317 Eef1a2 "eukaryotic translation elongation factor 1 alpha 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|3781 Eef1a2 "eukaryotic translation elongation factor 1 alpha 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q32PH8 EEF1A2 "Elongation factor 1-alpha 2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q05639 EEF1A2 "Elongation factor 1-alpha 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1N9H4 EEF1A2 "Elongation factor 1-alpha" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q90835 EEF1A "Elongation factor 1-alpha 1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P84318EF1A_HELGLNo assigned EC number0.91760.89971.0N/AN/A
P84319EF1A_HELALNo assigned EC number0.91760.89971.0N/AN/A
Q01372EF1A_NEUCRNo assigned EC number0.80680.95200.95N/AN/A
P84316EF1A_HELZENo assigned EC number0.91760.89971.0N/AN/A
P84317EF1A_HELAMNo assigned EC number0.91760.89971.0N/AN/A
Q71V39EF1A2_RABITNo assigned EC number0.85420.95640.9481yesN/A
Q5R4R8EF1A1_PONABNo assigned EC number0.86330.95640.9502yesN/A
Q5R1X2EF1A1_PANTRNo assigned EC number0.86330.95640.9502yesN/A
Q26487EF1A_SPOFRNo assigned EC number0.92000.89971.0N/AN/A
Q90835EF1A_CHICKNo assigned EC number0.86100.95640.9502noN/A
Q05639EF1A2_HUMANNo assigned EC number0.85420.95640.9481yesN/A
P62631EF1A2_MOUSENo assigned EC number0.85640.95640.9481yesN/A
P62630EF1A1_RATNo assigned EC number0.86330.95640.9502noN/A
P62632EF1A2_RATNo assigned EC number0.85640.95640.9481yesN/A
P02993EF1A_ARTSANo assigned EC number0.90270.96290.9567N/AN/A
P10126EF1A1_MOUSENo assigned EC number0.86330.95640.9502noN/A
Q01765EF1A_PODCUNo assigned EC number0.81130.95200.9479N/AN/A
P13549EF1A0_XENLANo assigned EC number0.86780.95640.9502N/AN/A
P84322EF1A_ANIIFNo assigned EC number0.91760.89971.0N/AN/A
P84321EF1A_ADIBENo assigned EC number0.91760.89971.0N/AN/A
P84320EF1A_HELDINo assigned EC number0.91760.89971.0N/AN/A
Q92005EF1A_DANRENo assigned EC number0.88150.95640.9502yesN/A
Q2HJN4EF1A1_OSCTINo assigned EC number0.83140.95640.9564N/AN/A
P53013EF1A_CAEELNo assigned EC number0.84050.95640.9481yesN/A
P19039EF1A_APIMENo assigned EC number0.90660.95640.9522noN/A
P29520EF1A_BOMMONo assigned EC number0.92530.96290.9546N/AN/A
A5DPE3EF1A_PICGUNo assigned EC number0.80180.95200.9541N/AN/A
P0CY35EF1A1_CANALNo assigned EC number0.80410.95200.9541N/AN/A
P17507EF1A2_XENLANo assigned EC number0.85870.95640.9522N/AN/A
Q5VTE0EF1A3_HUMANNo assigned EC number0.85870.95640.9502noN/A
Q2HJN9EF1A4_OSCTINo assigned EC number0.83140.95640.9564N/AN/A
Q2HJN8EF1A2_OSCTINo assigned EC number0.83370.95640.9564N/AN/A
Q01520EF1A_PODASNo assigned EC number0.81130.95200.95yesN/A
P84315EF1A_HELVINo assigned EC number0.91760.89971.0N/AN/A
Q66RN5EF1A1_FELCANo assigned EC number0.86330.95640.9502N/AN/A
Q2HJN6EF1A3_OSCTINo assigned EC number0.83180.95640.9543N/AN/A
A2Q0Z0EF1A1_HORSENo assigned EC number0.86100.95640.9502yesN/A
P17508EF1A3_XENLANo assigned EC number0.85190.95640.9522N/AN/A
P28295EF1A_ABSGLNo assigned EC number0.79950.95200.9541N/AN/A
P68103EF1A1_BOVINNo assigned EC number0.86330.95640.9502noN/A
P68105EF1A1_RABITNo assigned EC number0.86330.95640.9502yesN/A
P68104EF1A1_HUMANNo assigned EC number0.86330.95640.9502noN/A
Q59QD6EF1A2_CANALNo assigned EC number0.80410.95200.9541N/AN/A
P62629EF1A1_CRIGRNo assigned EC number0.86330.95640.9502noN/A
Q32PH8EF1A2_BOVINNo assigned EC number0.85420.95640.9481yesN/A
Q9YIC0EF1A_ORYLANo assigned EC number0.87470.95640.9522N/AN/A
P05303EF1A2_DROMENo assigned EC number0.91620.96290.9567yesN/A
P08736EF1A1_DROMENo assigned EC number0.90950.96290.9546noN/A
Q09069EF1A_SORMANo assigned EC number0.80450.95200.95N/AN/A
P27592EF1A_ONCVONo assigned EC number0.83370.95640.9461N/AN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query459
PTZ00141446 PTZ00141, PTZ00141, elongation factor 1- alpha; Pr 0.0
TIGR00483426 TIGR00483, EF-1_alpha, translation elongation fact 0.0
PLN00043447 PLN00043, PLN00043, elongation factor 1-alpha; Pro 0.0
COG5256428 COG5256, TEF1, Translation elongation factor EF-1a 0.0
PRK12317425 PRK12317, PRK12317, elongation factor 1-alpha; Rev 0.0
cd01883219 cd01883, EF1_alpha, Elongation Factor 1-alpha (EF1 1e-161
COG2895431 COG2895, CysN, GTPases - Sulfate adenylate transfe 1e-80
pfam00009184 pfam00009, GTP_EFTU, Elongation factor Tu GTP bind 4e-76
cd03705104 cd03705, EF1_alpha_III, Domain III of EF-1 4e-65
COG0050394 COG0050, TufB, GTPases - translation elongation fa 7e-63
TIGR02034406 TIGR02034, CysN, sulfate adenylyltransferase, larg 8e-62
cd04166209 cd04166, CysN_ATPS, CysN, together with protein Cy 2e-61
PRK05506 632 PRK05506, PRK05506, bifunctional sulfate adenylylt 1e-58
cd0369391 cd03693, EF1_alpha_II, EF1_alpha_II: this family r 1e-56
cd00881183 cd00881, GTP_translation_factor, GTP translation f 4e-56
PRK05124474 PRK05124, cysN, sulfate adenylyltransferase subuni 1e-53
PRK12735396 PRK12735, PRK12735, elongation factor Tu; Reviewed 6e-53
PRK00049396 PRK00049, PRK00049, elongation factor Tu; Reviewed 7e-53
CHL00071409 CHL00071, tufA, elongation factor Tu 3e-52
TIGR00485394 TIGR00485, EF-Tu, translation elongation factor TU 1e-51
PLN03127447 PLN03127, PLN03127, Elongation factor Tu; Provisio 2e-51
PRK12736394 PRK12736, PRK12736, elongation factor Tu; Reviewed 3e-50
PLN03126478 PLN03126, PLN03126, Elongation factor Tu; Provisio 8e-50
COG3276447 COG3276, SelB, Selenocysteine-specific translation 1e-40
COG5258527 COG5258, GTPBP1, GTPase [General function predicti 5e-39
pfam0314391 pfam03143, GTP_EFTU_D3, Elongation factor Tu C-ter 3e-37
cd01884195 cd01884, EF_Tu, Elongation Factor Tu (EF-Tu) GTP-b 1e-33
TIGR00475 581 TIGR00475, selB, selenocysteine-specific elongatio 6e-32
cd01513102 cd01513, Translation_factor_III, Domain III of Elo 2e-31
cd04171170 cd04171, SelB, SelB, the dedicated elongation fact 1e-24
cd03704108 cd03704, eRF3c_III, This family represents eEF1alp 4e-22
COG0481 603 COG0481, LepA, Membrane GTPase LepA [Cell envelope 2e-19
TIGR03680406 TIGR03680, eif2g_arch, translation initiation fact 2e-19
pfam0314470 pfam03144, GTP_EFTU_D2, Elongation factor Tu domai 4e-18
cd0369683 cd03696, selB_II, selB_II: this subfamily represen 7e-18
TIGR01393 595 TIGR01393, lepA, GTP-binding protein LepA 1e-17
cd01890179 cd01890, LepA, LepA also known as Elongation Facto 2e-17
cd04093107 cd04093, HBS1_C, HBS1_C: this family represents th 2e-17
PRK04000411 PRK04000, PRK04000, translation initiation factor 4e-17
COG0480 697 COG0480, FusA, Translation elongation factors (GTP 9e-17
COG5257415 COG5257, GCD11, Translation initiation factor 2, g 1e-16
cd0369787 cd03697, EFTU_II, EFTU_II: Elongation factor Tu do 3e-16
PRK05433 600 PRK05433, PRK05433, GTP-binding protein LepA; Prov 6e-16
cd0134283 cd01342, Translation_Factor_II_like, Translation_F 7e-16
PRK10512 614 PRK10512, PRK10512, selenocysteinyl-tRNA-specific 2e-15
cd0369883 cd03698, eRF3_II_like, eRF3_II_like: domain simila 2e-15
cd04168237 cd04168, TetM_like, Tet(M)-like family includes Te 4e-15
TIGR01394 594 TIGR01394, TypA_BipA, GTP-binding protein TypA/Bip 6e-15
cd01889192 cd01889, SelB_euk, SelB, the dedicated elongation 2e-13
cd01888197 cd01888, eIF2_gamma, Gamma subunit of initiation f 2e-13
cd01891194 cd01891, TypA_BipA, Tyrosine phosphorylated protei 7e-13
cd01885218 cd01885, EF2, Elongation Factor 2 (EF2) in archaea 3e-12
PRK10218 607 PRK10218, PRK10218, GTP-binding protein; Provision 3e-12
COG1217 603 COG1217, TypA, Predicted membrane GTPase involved 3e-12
cd0408982 cd04089, eRF3_II, eRF3_II: domain II of the eukary 3e-12
PRK13351 687 PRK13351, PRK13351, elongation factor G; Reviewed 1e-11
PRK12740 668 PRK12740, PRK12740, elongation factor G; Reviewed 1e-11
cd01886270 cd01886, EF-G, Elongation factor G (EF-G) family i 3e-11
cd04170268 cd04170, EF-G_bact, Elongation factor G (EF-G) fam 6e-11
TIGR00484 689 TIGR00484, EF-G, translation elongation factor EF- 4e-10
cd01887169 cd01887, IF2_eIF5B, Initiation Factor 2 (IF2)/ euk 1e-09
cd04167213 cd04167, Snu114p, Snu114p, a spliceosome protein, 1e-09
cd04165224 cd04165, GTPBP1_like, GTP binding protein 1 (GTPBP 2e-09
cd0369581 cd03695, CysN_NodQ_II, CysN_NodQ_II: This subfamil 4e-09
cd04169268 cd04169, RF3, Release Factor 3 (RF3) protein invol 6e-09
TIGR00503527 TIGR00503, prfC, peptide chain release factor 3 1e-08
cd0369487 cd03694, GTPBP_II, Domain II of the GP-1 family of 3e-08
COG4108528 COG4108, PrfC, Peptide chain release factor RF-3 [ 4e-08
PTZ00327460 PTZ00327, PTZ00327, eukaryotic translation initiat 1e-07
TIGR00490 720 TIGR00490, aEF-2, translation elongation factor aE 1e-07
PTZ00416 836 PTZ00416, PTZ00416, elongation factor 2; Provision 2e-07
PRK07560 731 PRK07560, PRK07560, elongation factor EF-2; Review 3e-07
PRK12739 691 PRK12739, PRK12739, elongation factor G; Reviewed 5e-07
TIGR00487587 TIGR00487, IF-2, translation initiation factor IF- 2e-06
PLN00116 843 PLN00116, PLN00116, translation elongation factor 2e-06
COG0532509 COG0532, InfB, Translation initiation factor 2 (IF 6e-06
PRK00007 693 PRK00007, PRK00007, elongation factor G; Reviewed 3e-05
cd00882161 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like s 5e-05
TIGR00231162 TIGR00231, small_GTP, small GTP-binding protein do 3e-04
CHL00189742 CHL00189, infB, translation initiation factor 2; P 4e-04
cd0370887 cd03708, GTPBP_III, Domain III of the GP-1 family 0.002
>gnl|CDD|185474 PTZ00141, PTZ00141, elongation factor 1- alpha; Provisional Back     alignment and domain information
 Score =  860 bits (2225), Expect = 0.0
 Identities = 347/440 (78%), Positives = 384/440 (87%), Gaps = 12/440 (2%)

Query: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60
           MGKEKTHIN+VVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINLVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 61  DKLKAERERGITIDIALWKFETSKFYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 120
           DKLKAERERGITIDIALWKFET K+Y TIIDAPGHRDFIKNMITGTSQAD A+L+VA+  
Sbjct: 61  DKLKAERERGITIDIALWKFETPKYYFTIIDAPGHRDFIKNMITGTSQADVAILVVASTA 120

Query: 121 GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEARFEEIKKEVSGYIKK 180
           GEFEAGISK+GQTREHALLAFTLGVKQ+IV +NKMD     YS+ R++EIKKEVS Y+KK
Sbjct: 121 GEFEAGISKDGQTREHALLAFTLGVKQMIVCINKMDDKTVNYSQERYDEIKKEVSAYLKK 180

Query: 181 IGYNPATVAFVPISGWHGDNMLEVSDKMPWFKGWAIERKEGKADGKCLIEALDAILPPSR 240
           +GYNP  V F+PISGW GDNM+E SD MPW+K            G  L+EALD + PP R
Sbjct: 181 VGYNPEKVPFIPISGWQGDNMIEKSDNMPWYK------------GPTLLEALDTLEPPKR 228

Query: 241 PTEKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMLVTFAPANLTTEVKSVEMHHEALQ 300
           P +KPLRLPLQDVYKIGGIGTVPVGRVETG++KPGM+VTFAP+ +TTEVKSVEMHHE L 
Sbjct: 229 PVDKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPSGVTTEVKSVEMHHEQLA 288

Query: 301 EAVPGDNVGFNVKNVSVKELRRGFVAGDSKASPPKATQDFTAQVIVLNHPGQISNGYTPV 360
           EAVPGDNVGFNVKNVSVK+++RG+VA DSK  P K   DFTAQVIVLNHPGQI NGYTPV
Sbjct: 289 EAVPGDNVGFNVKNVSVKDIKRGYVASDSKNDPAKECADFTAQVIVLNHPGQIKNGYTPV 348

Query: 361 LDCHTAHIACKFAEIKEKCDRRTGKTTEENPKALKSGDAAIIVLVPSKPMCVESFSEFPP 420
           LDCHTAHIACKFAEI+ K DRR+GK  EENPKA+KSGDAAI+ +VP+KPMCVE F+E+PP
Sbjct: 349 LDCHTAHIACKFAEIESKIDRRSGKVLEENPKAIKSGDAAIVKMVPTKPMCVEVFNEYPP 408

Query: 421 LGRFAVRDMRQTVAVGVIKV 440
           LGRFAVRDM+QTVAVGVIK 
Sbjct: 409 LGRFAVRDMKQTVAVGVIKS 428


Length = 446

>gnl|CDD|129574 TIGR00483, EF-1_alpha, translation elongation factor EF-1 alpha Back     alignment and domain information
>gnl|CDD|165621 PLN00043, PLN00043, elongation factor 1-alpha; Provisional Back     alignment and domain information
>gnl|CDD|227581 COG5256, TEF1, Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|237055 PRK12317, PRK12317, elongation factor 1-alpha; Reviewed Back     alignment and domain information
>gnl|CDD|206670 cd01883, EF1_alpha, Elongation Factor 1-alpha (EF1-alpha) protein family Back     alignment and domain information
>gnl|CDD|225448 COG2895, CysN, GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|215653 pfam00009, GTP_EFTU, Elongation factor Tu GTP binding domain Back     alignment and domain information
>gnl|CDD|239676 cd03705, EF1_alpha_III, Domain III of EF-1 Back     alignment and domain information
>gnl|CDD|223128 COG0050, TufB, GTPases - translation elongation factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|213679 TIGR02034, CysN, sulfate adenylyltransferase, large subunit Back     alignment and domain information
>gnl|CDD|206729 cd04166, CysN_ATPS, CysN, together with protein CysD, forms the ATP sulfurylase (ATPS) complex Back     alignment and domain information
>gnl|CDD|180120 PRK05506, PRK05506, bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>gnl|CDD|239664 cd03693, EF1_alpha_II, EF1_alpha_II: this family represents the domain II of elongation factor 1-alpha (EF-1a) that is found in archaea and all eukaryotic lineages Back     alignment and domain information
>gnl|CDD|206647 cd00881, GTP_translation_factor, GTP translation factor family primarily contains translation initiation, elongation and release factors Back     alignment and domain information
>gnl|CDD|235349 PRK05124, cysN, sulfate adenylyltransferase subunit 1; Provisional Back     alignment and domain information
>gnl|CDD|183708 PRK12735, PRK12735, elongation factor Tu; Reviewed Back     alignment and domain information
>gnl|CDD|234596 PRK00049, PRK00049, elongation factor Tu; Reviewed Back     alignment and domain information
>gnl|CDD|177010 CHL00071, tufA, elongation factor Tu Back     alignment and domain information
>gnl|CDD|129576 TIGR00485, EF-Tu, translation elongation factor TU Back     alignment and domain information
>gnl|CDD|178673 PLN03127, PLN03127, Elongation factor Tu; Provisional Back     alignment and domain information
>gnl|CDD|237184 PRK12736, PRK12736, elongation factor Tu; Reviewed Back     alignment and domain information
>gnl|CDD|215592 PLN03126, PLN03126, Elongation factor Tu; Provisional Back     alignment and domain information
>gnl|CDD|225815 COG3276, SelB, Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|227583 COG5258, GTPBP1, GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|217387 pfam03143, GTP_EFTU_D3, Elongation factor Tu C-terminal domain Back     alignment and domain information
>gnl|CDD|206671 cd01884, EF_Tu, Elongation Factor Tu (EF-Tu) GTP-binding proteins Back     alignment and domain information
>gnl|CDD|129567 TIGR00475, selB, selenocysteine-specific elongation factor SelB Back     alignment and domain information
>gnl|CDD|238771 cd01513, Translation_factor_III, Domain III of Elongation factor (EF) Tu (EF-TU) and EF-G Back     alignment and domain information
>gnl|CDD|206734 cd04171, SelB, SelB, the dedicated elongation factor for delivery of selenocysteinyl-tRNA to the ribosome Back     alignment and domain information
>gnl|CDD|239675 cd03704, eRF3c_III, This family represents eEF1alpha-like C-terminal region of eRF3 homologous to the domain III of EF-Tu Back     alignment and domain information
>gnl|CDD|223557 COG0481, LepA, Membrane GTPase LepA [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|211860 TIGR03680, eif2g_arch, translation initiation factor 2 subunit gamma Back     alignment and domain information
>gnl|CDD|217388 pfam03144, GTP_EFTU_D2, Elongation factor Tu domain 2 Back     alignment and domain information
>gnl|CDD|239667 cd03696, selB_II, selB_II: this subfamily represents the domain of elongation factor SelB, homologous to domain II of EF-Tu Back     alignment and domain information
>gnl|CDD|130460 TIGR01393, lepA, GTP-binding protein LepA Back     alignment and domain information
>gnl|CDD|206677 cd01890, LepA, LepA also known as Elongation Factor 4 (EF4) Back     alignment and domain information
>gnl|CDD|239760 cd04093, HBS1_C, HBS1_C: this family represents the C-terminal domain of Hsp70 subfamily B suppressor 1 (HBS1) which is homologous to the domain III of EF-1alpha Back     alignment and domain information
>gnl|CDD|235194 PRK04000, PRK04000, translation initiation factor IF-2 subunit gamma; Validated Back     alignment and domain information
>gnl|CDD|223556 COG0480, FusA, Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|227582 COG5257, GCD11, Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|239668 cd03697, EFTU_II, EFTU_II: Elongation factor Tu domain II Back     alignment and domain information
>gnl|CDD|235462 PRK05433, PRK05433, GTP-binding protein LepA; Provisional Back     alignment and domain information
>gnl|CDD|238652 cd01342, Translation_Factor_II_like, Translation_Factor_II_like: Elongation factor Tu (EF-Tu) domain II-like proteins Back     alignment and domain information
>gnl|CDD|182508 PRK10512, PRK10512, selenocysteinyl-tRNA-specific translation factor; Provisional Back     alignment and domain information
>gnl|CDD|239669 cd03698, eRF3_II_like, eRF3_II_like: domain similar to domain II of the eukaryotic class II release factor (eRF3) Back     alignment and domain information
>gnl|CDD|206731 cd04168, TetM_like, Tet(M)-like family includes Tet(M), Tet(O), Tet(W), and OtrA, containing tetracycline resistant proteins Back     alignment and domain information
>gnl|CDD|233394 TIGR01394, TypA_BipA, GTP-binding protein TypA/BipA Back     alignment and domain information
>gnl|CDD|206676 cd01889, SelB_euk, SelB, the dedicated elongation factor for delivery of selenocysteinyl-tRNA to the ribosome Back     alignment and domain information
>gnl|CDD|206675 cd01888, eIF2_gamma, Gamma subunit of initiation factor 2 (eIF2 gamma) Back     alignment and domain information
>gnl|CDD|206678 cd01891, TypA_BipA, Tyrosine phosphorylated protein A (TypA)/BipA family belongs to ribosome-binding GTPases Back     alignment and domain information
>gnl|CDD|206672 cd01885, EF2, Elongation Factor 2 (EF2) in archaea and eukarya Back     alignment and domain information
>gnl|CDD|104396 PRK10218, PRK10218, GTP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|224138 COG1217, TypA, Predicted membrane GTPase involved in stress response [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|239756 cd04089, eRF3_II, eRF3_II: domain II of the eukaryotic class II release factor (eRF3) Back     alignment and domain information
>gnl|CDD|237358 PRK13351, PRK13351, elongation factor G; Reviewed Back     alignment and domain information
>gnl|CDD|237186 PRK12740, PRK12740, elongation factor G; Reviewed Back     alignment and domain information
>gnl|CDD|206673 cd01886, EF-G, Elongation factor G (EF-G) family involved in both the elongation and ribosome recycling phases of protein synthesis Back     alignment and domain information
>gnl|CDD|206733 cd04170, EF-G_bact, Elongation factor G (EF-G) family Back     alignment and domain information
>gnl|CDD|129575 TIGR00484, EF-G, translation elongation factor EF-G Back     alignment and domain information
>gnl|CDD|206674 cd01887, IF2_eIF5B, Initiation Factor 2 (IF2)/ eukaryotic Initiation Factor 5B (eIF5B) family Back     alignment and domain information
>gnl|CDD|206730 cd04167, Snu114p, Snu114p, a spliceosome protein, is a GTPase Back     alignment and domain information
>gnl|CDD|206728 cd04165, GTPBP1_like, GTP binding protein 1 (GTPBP1)-like family includes GTPBP2 Back     alignment and domain information
>gnl|CDD|239666 cd03695, CysN_NodQ_II, CysN_NodQ_II: This subfamily represents the domain II of the large subunit of ATP sulfurylase (ATPS): CysN or the N-terminal portion of NodQ, found mainly in proteobacteria and homologous to the domain II of EF-Tu Back     alignment and domain information
>gnl|CDD|206732 cd04169, RF3, Release Factor 3 (RF3) protein involved in the terminal step of translocation in bacteria Back     alignment and domain information
>gnl|CDD|129594 TIGR00503, prfC, peptide chain release factor 3 Back     alignment and domain information
>gnl|CDD|239665 cd03694, GTPBP_II, Domain II of the GP-1 family of GTPase Back     alignment and domain information
>gnl|CDD|226593 COG4108, PrfC, Peptide chain release factor RF-3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|240362 PTZ00327, PTZ00327, eukaryotic translation initiation factor 2 gamma subunit; Provisional Back     alignment and domain information
>gnl|CDD|129581 TIGR00490, aEF-2, translation elongation factor aEF-2 Back     alignment and domain information
>gnl|CDD|240409 PTZ00416, PTZ00416, elongation factor 2; Provisional Back     alignment and domain information
>gnl|CDD|236047 PRK07560, PRK07560, elongation factor EF-2; Reviewed Back     alignment and domain information
>gnl|CDD|237185 PRK12739, PRK12739, elongation factor G; Reviewed Back     alignment and domain information
>gnl|CDD|232995 TIGR00487, IF-2, translation initiation factor IF-2 Back     alignment and domain information
>gnl|CDD|177730 PLN00116, PLN00116, translation elongation factor EF-2 subunit; Provisional Back     alignment and domain information
>gnl|CDD|223606 COG0532, InfB, Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|234569 PRK00007, PRK00007, elongation factor G; Reviewed Back     alignment and domain information
>gnl|CDD|206648 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like superfamily of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|232886 TIGR00231, small_GTP, small GTP-binding protein domain Back     alignment and domain information
>gnl|CDD|177089 CHL00189, infB, translation initiation factor 2; Provisional Back     alignment and domain information
>gnl|CDD|239679 cd03708, GTPBP_III, Domain III of the GP-1 family of GTPase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 459
COG5256428 TEF1 Translation elongation factor EF-1alpha (GTPa 100.0
PLN00043447 elongation factor 1-alpha; Provisional 100.0
PTZ00141446 elongation factor 1- alpha; Provisional 100.0
TIGR00483426 EF-1_alpha translation elongation factor EF-1 alph 100.0
PRK12317425 elongation factor 1-alpha; Reviewed 100.0
KOG0458|consensus603 100.0
KOG0459|consensus501 100.0
COG2895431 CysN GTPases - Sulfate adenylate transferase subun 100.0
PRK05124474 cysN sulfate adenylyltransferase subunit 1; Provis 100.0
TIGR02034406 CysN sulfate adenylyltransferase, large subunit. H 100.0
PRK05506 632 bifunctional sulfate adenylyltransferase subunit 1 100.0
PLN03126478 Elongation factor Tu; Provisional 100.0
CHL00071409 tufA elongation factor Tu 100.0
PRK12735396 elongation factor Tu; Reviewed 100.0
PRK00049396 elongation factor Tu; Reviewed 100.0
PRK12736394 elongation factor Tu; Reviewed 100.0
TIGR00485394 EF-Tu translation elongation factor TU. This align 100.0
PLN03127447 Elongation factor Tu; Provisional 100.0
KOG0460|consensus449 100.0
COG0050394 TufB GTPases - translation elongation factors [Tra 100.0
PTZ00327460 eukaryotic translation initiation factor 2 gamma s 100.0
COG5258527 GTPBP1 GTPase [General function prediction only] 100.0
PRK10512 614 selenocysteinyl-tRNA-specific translation factor; 100.0
PRK04000411 translation initiation factor IF-2 subunit gamma; 100.0
TIGR03680406 eif2g_arch translation initiation factor 2 subunit 100.0
TIGR00475 581 selB selenocysteine-specific elongation factor Sel 100.0
KOG0463|consensus641 100.0
COG3276447 SelB Selenocysteine-specific translation elongatio 100.0
KOG0052|consensus391 100.0
KOG1143|consensus591 100.0
COG5257415 GCD11 Translation initiation factor 2, gamma subun 100.0
TIGR01394 594 TypA_BipA GTP-binding protein TypA/BipA. This bact 100.0
PRK10218 607 GTP-binding protein; Provisional 100.0
COG1217 603 TypA Predicted membrane GTPase involved in stress 100.0
PRK05433 600 GTP-binding protein LepA; Provisional 100.0
TIGR01393 595 lepA GTP-binding protein LepA. LepA (GUF1 in Sacca 100.0
cd01883219 EF1_alpha Eukaryotic elongation factor 1 (EF1) alp 100.0
KOG0462|consensus 650 100.0
KOG0461|consensus522 100.0
COG0481 603 LepA Membrane GTPase LepA [Cell envelope biogenesi 100.0
cd04166208 CysN_ATPS CysN_ATPS subfamily. CysN, together with 100.0
PRK07560 731 elongation factor EF-2; Reviewed 100.0
cd01884195 EF_Tu EF-Tu subfamily. This subfamily includes ort 100.0
PRK00741526 prfC peptide chain release factor 3; Provisional 100.0
PRK00007 693 elongation factor G; Reviewed 100.0
COG0480 697 FusA Translation elongation factors (GTPases) [Tra 100.0
TIGR00503527 prfC peptide chain release factor 3. This translat 100.0
PRK12739 691 elongation factor G; Reviewed 100.0
PRK05306 787 infB translation initiation factor IF-2; Validated 100.0
TIGR00484 689 EF-G translation elongation factor EF-G. After pep 100.0
TIGR00487 587 IF-2 translation initiation factor IF-2. This mode 100.0
PRK13351 687 elongation factor G; Reviewed 100.0
TIGR00490 720 aEF-2 translation elongation factor aEF-2. This mo 100.0
PF00009188 GTP_EFTU: Elongation factor Tu GTP binding domain; 100.0
COG4108528 PrfC Peptide chain release factor RF-3 [Translatio 100.0
PRK12740 668 elongation factor G; Reviewed 100.0
CHL00189 742 infB translation initiation factor 2; Provisional 100.0
PLN00116 843 translation elongation factor EF-2 subunit; Provis 99.98
PRK04004 586 translation initiation factor IF-2; Validated 99.97
TIGR00491 590 aIF-2 translation initiation factor aIF-2/yIF-2. T 99.97
PTZ00416 836 elongation factor 2; Provisional 99.97
KOG0466|consensus466 99.97
KOG1145|consensus 683 99.97
KOG0465|consensus 721 99.97
COG0532 509 InfB Translation initiation factor 2 (IF-2; GTPase 99.97
cd01885222 EF2 EF2 (for archaea and eukarya). Translocation r 99.96
PRK14845 1049 translation initiation factor IF-2; Provisional 99.94
cd01889192 SelB_euk SelB subfamily. SelB is an elongation fac 99.94
cd01888203 eIF2_gamma eIF2-gamma (gamma subunit of initiation 99.94
cd04167213 Snu114p Snu114p subfamily. Snu114p is one of sever 99.93
cd01886270 EF-G Elongation factor G (EF-G) subfamily. Translo 99.93
cd04165224 GTPBP1_like GTPBP1-like. Mammalian GTP binding pro 99.93
cd01891194 TypA_BipA TypA (tyrosine phosphorylated protein A) 99.93
cd04168237 TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T 99.93
cd03704108 eRF3c_III This family represents eEF1alpha-like C- 99.93
cd04169267 RF3 RF3 subfamily. Peptide chain release factor 3 99.92
cd01890179 LepA LepA subfamily. LepA belongs to the GTPase fa 99.92
KOG0464|consensus 753 99.92
cd04093107 HBS1_C HBS1_C: this family represents the C-termin 99.92
KOG0469|consensus 842 99.92
cd03705104 EF1_alpha_III Domain III of EF-1. Eukaryotic elong 99.91
cd04171164 SelB SelB subfamily. SelB is an elongation factor 99.91
cd00881189 GTP_translation_factor GTP translation factor fami 99.9
KOG1144|consensus 1064 99.89
KOG0467|consensus 887 99.89
cd04170268 EF-G_bact Elongation factor G (EF-G) subfamily. Tr 99.88
cd04095103 CysN_NoDQ_III TCysN_NoDQ_II: This subfamily repres 99.87
PF0314399 GTP_EFTU_D3: Elongation factor Tu C-terminal domai 99.87
cd01887168 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo 99.85
COG1159298 Era GTPase [General function prediction only] 99.85
cd01513102 Translation_factor_III Domain III of Elongation fa 99.85
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 99.82
PF02421156 FeoB_N: Ferrous iron transport protein B; InterPro 99.82
COG1160444 Predicted GTPases [General function prediction onl 99.81
PRK00093435 GTP-binding protein Der; Reviewed 99.81
cd0369391 EF1_alpha_II EF1_alpha_II: this family represents 99.8
TIGR00436270 era GTP-binding protein Era. Era is an essential G 99.8
KOG0468|consensus 971 99.8
PRK15494339 era GTPase Era; Provisional 99.79
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA 99.79
COG1160444 Predicted GTPases [General function prediction onl 99.79
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are 99.78
cd01895174 EngA2 EngA2 subfamily. This CD represents the seco 99.78
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub 99.78
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associat 99.77
cd0369883 eRF3_II_like eRF3_II_like: domain similar to domai 99.77
cd01894157 EngA1 EngA1 subfamily. This CD represents the firs 99.76
cd04151158 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t 99.76
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protei 99.76
cd04149168 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 99.75
cd04150159 Arf1_5_like Arf1-Arf5-like subfamily. This subfami 99.75
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily 99.75
cd01898170 Obg Obg subfamily. The Obg nucleotide binding prot 99.74
PRK03003472 GTP-binding protein Der; Reviewed 99.74
cd01879158 FeoB Ferrous iron transport protein B (FeoB) subfa 99.74
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a 99.74
cd04114169 Rab30 Rab30 subfamily. Rab30 appears to be associa 99.74
cd0408982 eRF3_II eRF3_II: domain II of the eukaryotic class 99.74
PLN00223181 ADP-ribosylation factor; Provisional 99.74
smart00177175 ARF ARF-like small GTPases; ARF, ADP-ribosylation 99.74
PRK00089292 era GTPase Era; Reviewed 99.73
cd0369487 GTPBP_II Domain II of the GP-1 family of GTPase. T 99.73
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubu 99.73
cd04158169 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor 99.73
COG2229187 Predicted GTPase [General function prediction only 99.73
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein presen 99.73
cd01860163 Rab5_related Rab5-related subfamily. This subfamil 99.73
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 99.73
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential componen 99.73
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th 99.72
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik 99.72
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf 99.72
cd04106162 Rab23_lke Rab23-like subfamily. Rab23 is a member 99.72
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 99.72
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA 99.72
PRK03003472 GTP-binding protein Der; Reviewed 99.72
TIGR00231161 small_GTP small GTP-binding protein domain. This m 99.72
cd0369787 EFTU_II EFTU_II: Elongation factor Tu domain II. E 99.71
PTZ00133182 ADP-ribosylation factor; Provisional 99.71
smart00178184 SAR Sar1p-like members of the Ras-family of small 99.71
cd01865165 Rab3 Rab3 subfamily. The Rab3 subfamily contains R 99.71
cd04107201 Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 99.71
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp 99.71
cd04152183 Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i 99.71
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev 99.71
cd04120202 Rab12 Rab12 subfamily. Rab12 was first identified 99.71
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 99.71
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein 99.71
cd04116170 Rab9 Rab9 subfamily. Rab9 is found in late endosom 99.71
cd0369683 selB_II selB_II: this subfamily represents the dom 99.7
PRK04213201 GTP-binding protein; Provisional 99.7
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg 99.7
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicat 99.7
KOG0092|consensus200 99.7
PRK09554 772 feoB ferrous iron transport protein B; Reviewed 99.7
cd04140165 ARHI_like ARHI subfamily. ARHI (A Ras homolog memb 99.7
cd00154159 Rab Rab family. Rab GTPases form the largest famil 99.7
cd04112191 Rab26 Rab26 subfamily. First identified in rat pan 99.7
cd04127180 Rab27A Rab27a subfamily. The Rab27a subfamily cons 99.7
PRK15467158 ethanolamine utilization protein EutP; Provisional 99.7
cd0370887 GTPBP_III Domain III of the GP-1 family of GTPase. 99.7
TIGR02528142 EutP ethanolamine utilization protein, EutP. This 99.69
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 99.69
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 99.69
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a 99.69
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 99.69
cd04122166 Rab14 Rab14 subfamily. Rab14 GTPases are localized 99.69
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su 99.69
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in 99.69
cd04121189 Rab40 Rab40 subfamily. This subfamily contains Rab 99.69
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 99.69
PRK09518712 bifunctional cytidylate kinase/GTPase Der; Reviewe 99.69
cd04108170 Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr 99.69
cd00877166 Ran Ran (Ras-related nuclear proteins) /TC4 subfam 99.69
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily con 99.68
PRK00093435 GTP-binding protein Der; Reviewed 99.68
cd04110199 Rab35 Rab35 subfamily. Rab35 is one of several Rab 99.68
cd04161167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( 99.68
cd04142198 RRP22 RRP22 subfamily. RRP22 (Ras-related protein 99.68
PRK00454196 engB GTP-binding protein YsxC; Reviewed 99.68
cd01878204 HflX HflX subfamily. A distinct conserved domain w 99.68
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 99.68
cd04109215 Rab28 Rab28 subfamily. First identified in maize, 99.68
PRK09518712 bifunctional cytidylate kinase/GTPase Der; Reviewe 99.67
cd01893166 Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr 99.67
cd0369581 CysN_NodQ_II CysN_NodQ_II: This subfamily represen 99.67
cd04162164 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 99.67
PLN03118211 Rab family protein; Provisional 99.67
cd04147198 Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v 99.67
PTZ00369189 Ras-like protein; Provisional 99.67
cd04128182 Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi 99.67
cd04175164 Rap1 Rap1 subgroup. The Rap1 subgroup is part of t 99.67
PRK12299335 obgE GTPase CgtA; Reviewed 99.67
cd04118193 Rab24 Rab24 subfamily. Rab24 is distinct from othe 99.66
cd04126220 Rab20 Rab20 subfamily. Rab20 is one of several Rab 99.66
PRK12298390 obgE GTPase CgtA; Reviewed 99.66
cd04115170 Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u 99.66
PF00025175 Arf: ADP-ribosylation factor family The prints ent 99.66
cd04123162 Rab21 Rab21 subfamily. The localization and functi 99.66
cd0370693 mtEFTU_III Domain III of mitochondrial EF-TU (mtEF 99.66
cd04176163 Rap2 Rap2 subgroup. The Rap2 subgroup is part of t 99.66
cd04144190 Ras2 Ras2 subfamily. The Ras2 subfamily, found exc 99.66
cd00157171 Rho Rho (Ras homology) family. Members of the Rho 99.66
cd01871174 Rac1_like Rac1-like subfamily. The Rac1-like subfa 99.66
TIGR03156351 GTP_HflX GTP-binding protein HflX. This protein fa 99.65
cd01874175 Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas 99.65
PRK05291449 trmE tRNA modification GTPase TrmE; Reviewed 99.65
cd04141172 Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p 99.65
cd04143247 Rhes_like Rhes_like subfamily. This subfamily incl 99.65
TIGR02729329 Obg_CgtA Obg family GTPase CgtA. This model descri 99.65
PLN03071219 GTP-binding nuclear protein Ran; Provisional 99.64
cd04135174 Tc10 TC10 subfamily. TC10 is a Rho family protein 99.64
PRK12296500 obgE GTPase CgtA; Reviewed 99.64
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 99.64
cd01875191 RhoG RhoG subfamily. RhoG is a GTPase with high se 99.64
cd04101164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove 99.64
KOG0094|consensus221 99.64
cd04132187 Rho4_like Rho4-like subfamily. Rho4 is a GTPase th 99.63
cd00880163 Era_like Era (E. coli Ras-like protein)-like. This 99.63
KOG0084|consensus205 99.63
cd01892169 Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr 99.63
cd04117161 Rab15 Rab15 subfamily. Rab15 colocalizes with the 99.63
PLN03110216 Rab GTPase; Provisional 99.63
COG0486454 ThdF Predicted GTPase [General function prediction 99.63
smart00174174 RHO Rho (Ras homology) subfamily of Ras-like small 99.63
cd00876160 Ras Ras family. The Ras family of the Ras superfam 99.63
cd01881176 Obg_like The Obg-like subfamily consists of five w 99.63
COG0218200 Predicted GTPase [General function prediction only 99.63
cd04177168 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the 99.63
cd04111211 Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 99.62
cd04125188 RabA_like RabA-like subfamily. RabA was first iden 99.62
PLN03108210 Rab family protein; Provisional 99.62
cd04134189 Rho3 Rho3 subfamily. Rho3 is a member of the Rho f 99.62
PRK12297424 obgE GTPase CgtA; Reviewed 99.62
cd0370790 EFTU_III Domain III of elongation factor (EF) Tu. 99.61
cd04133176 Rop_like Rop subfamily. The Rop (Rho-related prote 99.61
PRK11058426 GTPase HflX; Provisional 99.61
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamil 99.6
cd04146165 RERG_RasL11_like RERG/RasL11-like subfamily. RERG 99.6
cd04130173 Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive 99.6
cd04172182 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE 99.6
TIGR00450442 mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE 99.6
cd01882225 BMS1 Bms1. Bms1 is an essential, evolutionarily co 99.6
smart00176200 RAN Ran (Ras-related nuclear proteins) /TC4 subfam 99.59
cd01870175 RhoA_like RhoA-like subfamily. The RhoA subfamily 99.59
COG0370 653 FeoB Fe2+ transport system protein B [Inorganic io 99.59
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamil 99.58
TIGR00437 591 feoB ferrous iron transporter FeoB. FeoB (773 amin 99.58
cd04131178 Rnd Rnd subfamily. The Rnd subfamily contains Rnd1 99.57
cd04148221 RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki 99.56
cd04174232 Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a memb 99.56
cd04173222 Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a memb 99.55
KOG0078|consensus207 99.54
KOG0098|consensus216 99.53
cd00882157 Ras_like_GTPase Ras-like GTPase superfamily. The R 99.53
KOG0394|consensus210 99.52
cd04105203 SR_beta Signal recognition particle receptor, beta 99.52
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 99.52
PTZ00132215 GTP-binding nuclear protein Ran; Provisional 99.52
KOG1423|consensus379 99.5
KOG0075|consensus186 99.5
PRK09866 741 hypothetical protein; Provisional 99.49
PF00071162 Ras: Ras family; InterPro: IPR001806 Small GTPases 99.49
cd04129187 Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that 99.49
cd04103158 Centaurin_gamma Centaurin gamma. The centaurins (a 99.49
cd01852196 AIG1 AIG1 (avrRpt2-induced gene 1). This represent 99.48
cd01896233 DRG The developmentally regulated GTP-binding prot 99.48
cd04104197 p47_IIGP_like p47 (47-kDa) family. The p47 GTPase 99.47
COG2262411 HflX GTPases [General function prediction only] 99.46
cd01873195 RhoBTB RhoBTB subfamily. Members of the RhoBTB sub 99.45
KOG0087|consensus222 99.45
KOG0073|consensus185 99.45
KOG0080|consensus209 99.45
cd04102202 RabL3 RabL3 (Rab-like3) subfamily. RabL3s are nove 99.43
KOG0095|consensus213 99.42
KOG1489|consensus366 99.42
KOG0070|consensus181 99.41
cd0409497 selB_III This family represents the domain of elon 99.41
KOG0086|consensus214 99.4
KOG0076|consensus197 99.4
PLN00023334 GTP-binding protein; Provisional 99.4
KOG1532|consensus366 99.39
COG3596296 Predicted GTPase [General function prediction only 99.38
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 99.38
KOG1191|consensus531 99.37
cd03688113 eIF2_gamma_II eIF2_gamma_II: this subfamily repres 99.36
COG1084346 Predicted GTPase [General function prediction only 99.35
KOG0093|consensus193 99.34
KOG0079|consensus198 99.33
PF09439181 SRPRB: Signal recognition particle receptor beta s 99.33
cd01850276 CDC_Septin CDC/Septin. Septins are a conserved fam 99.32
COG1100219 GTPase SAR1 and related small G proteins [General 99.3
PRK13768253 GTPase; Provisional 99.29
PF04670232 Gtr1_RagA: Gtr1/RagA G protein conserved region; I 99.29
cd0369284 mtIF2_IVc mtIF2_IVc: this family represents the C2 99.29
PF03029238 ATP_bind_1: Conserved hypothetical ATP binding pro 99.28
COG4917148 EutP Ethanolamine utilization protein [Amino acid 99.24
KOG0090|consensus238 99.22
KOG0091|consensus213 99.19
cd01899318 Ygr210 Ygr210 subfamily. Ygr210 is a member of Obg 99.19
PTZ00099176 rab6; Provisional 99.18
KOG0088|consensus218 99.18
cd01853249 Toc34_like Toc34-like (Translocon at the Outer-env 99.17
COG0536369 Obg Predicted GTPase [General function prediction 99.17
KOG0395|consensus196 99.16
PRK09435332 membrane ATPase/protein kinase; Provisional 99.16
KOG0097|consensus215 99.15
KOG0071|consensus180 99.15
COG1163365 DRG Predicted GTPase [General function prediction 99.08
KOG0074|consensus185 99.07
cd0134283 Translation_Factor_II_like Translation_Factor_II_l 99.06
KOG0072|consensus182 99.05
COG5192 1077 BMS1 GTP-binding protein required for 40S ribosome 99.04
KOG0081|consensus219 99.02
PRK09602396 translation-associated GTPase; Reviewed 99.02
TIGR00073207 hypB hydrogenase accessory protein HypB. HypB is i 99.01
PF0314474 GTP_EFTU_D2: Elongation factor Tu domain 2; InterP 99.0
PF05049376 IIGP: Interferon-inducible GTPase (IIGP); InterPro 99.0
cd0369085 Tet_II Tet_II: This subfamily represents domain II 98.95
TIGR00750300 lao LAO/AO transport system ATPase. Mutations have 98.94
PF04548212 AIG1: AIG1 family; InterPro: IPR006703 This entry 98.92
cd0409283 mtEFG2_II_like mtEFG2_C: C-terminus of mitochondri 98.9
TIGR02836492 spore_IV_A stage IV sporulation protein A. A compa 98.9
cd0369986 lepA_II lepA_II: This subfamily represents the dom 98.87
KOG0410|consensus410 98.87
cd0368985 RF3_II RF3_II: this subfamily represents the domai 98.86
TIGR00991313 3a0901s02IAP34 GTP-binding protein (Chloroplast En 98.85
cd0408883 EFG_mtEFG_II EFG_mtEFG_II: this subfamily represen 98.85
PF00350168 Dynamin_N: Dynamin family; InterPro: IPR001401 Mem 98.84
smart00053240 DYNc Dynamin, GTPase. Large GTPases that mediate v 98.84
KOG0077|consensus193 98.84
COG0378202 HypB Ni2+-binding GTPase involved in regulation of 98.83
PF1457881 GTP_EFTU_D4: Elongation factor Tu domain 4; PDB: 1 98.82
KOG4252|consensus246 98.8
cd0369186 BipA_TypA_II BipA_TypA_II: domain II of BipA (also 98.79
KOG3886|consensus295 98.79
cd0409181 mtEFG1_II_like mtEFG1_C: C-terminus of mitochondri 98.77
TIGR00101199 ureG urease accessory protein UreG. This model rep 98.76
KOG0083|consensus192 98.76
PRK10463290 hydrogenase nickel incorporation protein HypB; Pro 98.71
PF03308266 ArgK: ArgK protein; InterPro: IPR005129 Bacterial 98.68
KOG2486|consensus320 98.62
KOG3883|consensus198 98.61
PTZ00258390 GTP-binding protein; Provisional 98.6
COG1703323 ArgK Putative periplasmic protein kinase ArgK and 98.58
TIGR00993 763 3a0901s04IAP86 chloroplast protein import componen 98.57
KOG0393|consensus198 98.57
KOG1707|consensus 625 98.57
cd01900274 YchF YchF subfamily. YchF is a member of the Obg f 98.57
PRK09601364 GTP-binding protein YchF; Reviewed 98.55
PF00735281 Septin: Septin; InterPro: IPR000038 Septins consti 98.54
cd0370093 eEF2_snRNP_like_II EF2_snRNP_like_II: this subfami 98.48
cd01859156 MJ1464 MJ1464. This family represents archaeal GTP 98.46
KOG1673|consensus205 98.44
KOG0448|consensus 749 98.42
cd01857141 HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t 98.32
KOG0096|consensus216 98.29
cd01856171 YlqF YlqF. Proteins of the YlqF family contain all 98.29
cd0409094 eEF2_II_snRNP Loc2 eEF2_C_snRNP, cd01514/C termina 98.29
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 98.28
KOG1490|consensus620 98.25
KOG1534|consensus273 98.25
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei 98.25
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei 98.24
KOG1547|consensus336 98.17
cd04178172 Nucleostemin_like Nucleostemin-like. Nucleostemin 98.17
cd01855190 YqeH YqeH. YqeH is an essential GTP-binding protei 98.17
cd01851224 GBP Guanylate-binding protein (GBP), N-terminal do 98.16
TIGR03596276 GTPase_YlqF ribosome biogenesis GTP-binding protei 98.16
PF05783472 DLIC: Dynein light intermediate chain (DLIC); Inte 98.15
COG5019373 CDC3 Septin family protein [Cell division and chro 98.14
COG0012372 Predicted GTPase, probable translation factor [Tra 98.13
PF03193161 DUF258: Protein of unknown function, DUF258; Inter 98.09
TIGR00157245 ribosome small subunit-dependent GTPase A. The Aqu 98.09
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 98.09
KOG3905|consensus473 98.08
KOG1486|consensus364 98.07
cd01849155 YlqF_related_GTPase YlqF-related GTPases. These pr 98.03
cd01849155 YlqF_related_GTPase YlqF-related GTPases. These pr 98.03
PRK10416318 signal recognition particle-docking protein FtsY; 98.02
TIGR00064272 ftsY signal recognition particle-docking protein F 98.02
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 98.02
PRK12289352 GTPase RsgA; Reviewed 98.02
cd03115173 SRP The signal recognition particle (SRP) mediates 98.01
PRK09563287 rbgA GTPase YlqF; Reviewed 98.0
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 97.97
KOG1954|consensus532 97.97
cd01855190 YqeH YqeH. YqeH is an essential GTP-binding protei 97.95
cd01857141 HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t 97.91
PRK14974336 cell division protein FtsY; Provisional 97.91
cd03112158 CobW_like The function of this protein family is u 97.9
cd03114148 ArgK-like The function of this protein family is u 97.88
PRK00098298 GTPase RsgA; Reviewed 97.88
COG3640255 CooC CO dehydrogenase maturation factor [Cell divi 97.87
KOG2655|consensus366 97.87
PRK00771437 signal recognition particle protein Srp54; Provisi 97.86
TIGR00487587 IF-2 translation initiation factor IF-2. This mode 97.84
PRK12288347 GTPase RsgA; Reviewed 97.84
COG1161322 Predicted GTPases [General function prediction onl 97.81
cd01856171 YlqF YlqF. Proteins of the YlqF family contain all 97.8
TIGR00157245 ribosome small subunit-dependent GTPase A. The Aqu 97.79
PRK09563287 rbgA GTPase YlqF; Reviewed 97.79
PRK05306787 infB translation initiation factor IF-2; Validated 97.78
KOG4423|consensus229 97.77
TIGR03596276 GTPase_YlqF ribosome biogenesis GTP-binding protei 97.76
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 97.76
CHL00189742 infB translation initiation factor 2; Provisional 97.76
COG0541451 Ffh Signal recognition particle GTPase [Intracellu 97.76
KOG1487|consensus358 97.75
cd01854287 YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil 97.74
cd03110179 Fer4_NifH_child This protein family's function is 97.72
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 97.71
PRK12289352 GTPase RsgA; Reviewed 97.7
TIGR00959428 ffh signal recognition particle protein. This mode 97.67
PRK10867433 signal recognition particle protein; Provisional 97.67
TIGR03597360 GTPase_YqeH ribosome biogenesis GTPase YqeH. This 97.67
COG1162301 Predicted GTPases [General function prediction onl 97.66
TIGR00092368 GTP-binding protein YchF. This predicted GTP-bindi 97.66
KOG0082|consensus354 97.65
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 97.64
KOG3887|consensus347 97.61
KOG1533|consensus290 97.6
PRK12288347 GTPase RsgA; Reviewed 97.59
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 97.59
cd02036179 MinD Bacterial cell division requires the formatio 97.58
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 97.58
cd01854287 YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil 97.58
TIGR03597360 GTPase_YqeH ribosome biogenesis GTPase YqeH. This 97.58
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 97.57
PRK13796365 GTPase YqeH; Provisional 97.57
KOG0780|consensus483 97.56
KOG1491|consensus391 97.52
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 97.51
cd01859156 MJ1464 MJ1464. This family represents archaeal GTP 97.5
cd03111106 CpaE_like This protein family consists of proteins 97.5
cd02038139 FleN-like FleN is a member of the Fer4_NifH superf 97.42
PRK01889356 GTPase RsgA; Reviewed 97.38
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 97.35
cd00066317 G-alpha G protein alpha subunit. The alpha subunit 97.32
COG0532509 InfB Translation initiation factor 2 (IF-2; GTPase 97.32
smart00275342 G_alpha G protein alpha subunit. Subunit of G prot 97.32
PRK13796365 GTPase YqeH; Provisional 97.32
PF02492178 cobW: CobW/HypB/UreG, nucleotide-binding domain; I 97.31
PRK00098298 GTPase RsgA; Reviewed 97.28
KOG2485|consensus335 97.22
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 97.21
PRK14723 767 flhF flagellar biosynthesis regulator FlhF; Provis 97.21
KOG0447|consensus 980 97.19
PRK11537318 putative GTP-binding protein YjiA; Provisional 97.17
COG0523323 Putative GTPases (G3E family) [General function pr 97.16
COG1162301 Predicted GTPases [General function prediction onl 97.15
cd0370295 IF2_mtIF2_II This family represents the domain II 97.14
cd02037169 MRP-like MRP (Multiple Resistance and pH adaptatio 97.09
cd02042104 ParA ParA and ParB of Caulobacter crescentus belon 97.06
TIGR02475341 CobW cobalamin biosynthesis protein CobW. A broade 96.96
cd03703110 aeIF5B_II aeIF5B_II: This family represents the do 96.93
KOG4181|consensus491 96.89
PRK08099399 bifunctional DNA-binding transcriptional repressor 96.89
PF09547492 Spore_IV_A: Stage IV sporulation protein A (spore_ 96.86
cd0198399 Fer4_NifH The Fer4_NifH superfamily contains a var 96.85
COG0552340 FtsY Signal recognition particle GTPase [Intracell 96.83
TIGR03348 1169 VI_IcmF type VI secretion protein IcmF. Members of 96.75
TIGR00491590 aIF-2 translation initiation factor aIF-2/yIF-2. T 96.66
KOG2743|consensus391 96.63
KOG2484|consensus435 96.55
COG3172187 NadR Predicted ATPase/kinase involved in NAD metab 96.49
cd04178172 Nucleostemin_like Nucleostemin-like. Nucleostemin 96.49
PRK13695174 putative NTPase; Provisional 96.49
cd0370195 IF2_IF5B_II IF2_IF5B_II: This family represents th 96.49
KOG2423|consensus572 96.45
KOG1424|consensus562 96.38
PF0917388 eIF2_C: Initiation factor eIF2 gamma, C terminal; 96.37
PF0685858 NOG1: Nucleolar GTP-binding protein 1 (NOG1); Inte 96.34
PRK04004586 translation initiation factor IF-2; Validated 96.27
PRK148451049 translation initiation factor IF-2; Provisional 96.09
PRK10751173 molybdopterin-guanine dinucleotide biosynthesis pr 96.05
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 95.87
smart00010124 small_GTPase Small GTPase of the Ras superfamily; 95.83
COG1341398 Predicted GTPase or GTP-binding protein [General f 95.82
KOG3859|consensus406 95.82
PF1355562 AAA_29: P-loop containing region of AAA domain 95.75
COG3523 1188 IcmF Type VI protein secretion system component Va 95.73
PRK01889356 GTPase RsgA; Reviewed 95.72
COG1763161 MobB Molybdopterin-guanine dinucleotide biosynthes 95.69
PF00503389 G-alpha: G-protein alpha subunit; InterPro: IPR001 95.59
KOG2484|consensus435 95.56
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 95.45
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 95.4
TIGR00235207 udk uridine kinase. Model contains a number of lon 95.36
PRK08118167 topology modulation protein; Reviewed 95.34
PRK07261171 topology modulation protein; Provisional 95.3
KOG1144|consensus1064 95.27
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 95.21
KOG0781|consensus587 95.2
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 95.19
COG1126240 GlnQ ABC-type polar amino acid transport system, A 95.17
cd03116159 MobB Molybdenum is an essential trace element in t 95.1
COG1136226 SalX ABC-type antimicrobial peptide transport syst 95.06
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 95.0
KOG1707|consensus625 95.0
>COG5256 TEF1 Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
Probab=100.00  E-value=1.5e-101  Score=734.16  Aligned_cols=427  Identities=63%  Similarity=1.031  Sum_probs=416.7

Q ss_pred             CCCCCceeEEEEEecCCCChHHHHhHHHHhcCCCChHHHHHHHHHHHHhCCCcceeeeeccCchhHHhcCceEEeeeeEE
Q psy13961          1 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKF   80 (459)
Q Consensus         1 ~~~~k~~~~v~v~G~~~~GKSTLi~~Ll~~~~~i~~~~~~~~~~~~~~~g~~~~~~~~~~d~~~~e~~~g~Ti~~~~~~~   80 (459)
                      |...|+++|++++||+|||||||+++|+|++|.++.+.++++++++.+.|+++|.|+|+||++++||+||+|++.++..|
T Consensus         1 ~~~~Kph~nl~~iGHVD~GKSTl~GrLly~~G~id~~tmeK~~~ea~~~gK~sf~fawvlD~tkeERerGvTi~~~~~~f   80 (428)
T COG5256           1 MASEKPHLNLVFIGHVDAGKSTLVGRLLYDLGEIDKRTMEKLEKEAKELGKESFKFAWVLDKTKEERERGVTIDVAHSKF   80 (428)
T ss_pred             CCCCCCceEEEEEcCCCCCchhhhhhhHHHhCCCCHHHHHHHHHHHHhcCCCceEEEEEecCChhHHhcceEEEEEEEEe
Confidence            66789999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eeCCEEEEEEeCCCccchHhHHHHhhcccCEEEEEEECCCCceeccccCCCchHHHHHHHHHcCCceEEEEEEccCCCCC
Q psy13961         81 ETSKFYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEP  160 (459)
Q Consensus        81 ~~~~~~~~liDtpG~~~~~~~~~~~~~~aD~~ilVvda~~g~~~~~~~~~~qt~e~~~~~~~~~ip~iivviNK~D~~~~  160 (459)
                      +++.+.++|+|||||.+|.++|+.|+++||++||||||+.+.||+||...+||+||+.+++.+|+.++||++||||.++ 
T Consensus        81 et~k~~~tIiDaPGHrdFvknmItGasqAD~aVLVV~a~~~efE~g~~~~gQtrEH~~La~tlGi~~lIVavNKMD~v~-  159 (428)
T COG5256          81 ETDKYNFTIIDAPGHRDFVKNMITGASQADVAVLVVDARDGEFEAGFGVGGQTREHAFLARTLGIKQLIVAVNKMDLVS-  159 (428)
T ss_pred             ecCCceEEEeeCCchHHHHHHhhcchhhccEEEEEEECCCCccccccccCCchhHHHHHHHhcCCceEEEEEEcccccc-
Confidence            9999999999999999999999999999999999999999999999999999999999999999999999999999998 


Q ss_pred             CCcHHHHHHHHHHHHhhhhhcCcCCceeeEeecCCCCCCccccccCCCCCccccccccccCCCChhhHHHhccccCCCCC
Q psy13961        161 PYSEARFEEIKKEVSGYIKKIGYNPATVAFVPISGWHGDNMLEVSDKMPWFKGWAIERKEGKADGKCLIEALDAILPPSR  240 (459)
Q Consensus       161 ~~~~~~~~~i~~~l~~~l~~~g~~~~~~~~i~iSa~~g~~i~~~~~~~~w~~~~~~~~~~~~~~g~~Ll~~l~~~~~~~~  240 (459)
                       |++++|+++++++..+++.+||++++++|+|+||+.|+|+.+.++.+|||+|            ++|+++|+.+.+|.+
T Consensus       160 -wde~rf~ei~~~v~~l~k~~G~~~~~v~FIPiSg~~G~Nl~~~s~~~pWY~G------------pTLleaLd~~~~p~~  226 (428)
T COG5256         160 -WDEERFEEIVSEVSKLLKMVGYNPKDVPFIPISGFKGDNLTKKSENMPWYKG------------PTLLEALDQLEPPER  226 (428)
T ss_pred             -cCHHHHHHHHHHHHHHHHHcCCCccCCeEEecccccCCcccccCcCCcCccC------------ChHHHHHhccCCCCC
Confidence             9999999999999999999999988999999999999999999999999986            999999999888988


Q ss_pred             CCCCCeeEEeEEEEEeCCceeEEEEEEEeeeEecCCeEEEecCCeEEEEEEEEeccccceeEcCCCeEEEEEccCcccCc
Q psy13961        241 PTEKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMLVTFAPANLTTEVKSVEMHHEALQEAVPGDNVGFNVKNVSVKEL  320 (459)
Q Consensus       241 ~~~~p~~~~i~~v~~~~~~G~v~~G~v~sG~l~~gd~v~~~p~~~~~~V~~I~~~~~~v~~a~aGd~v~l~l~~~~~~~i  320 (459)
                      +.++|||++|+++|.+.+.|++..|||++|.|++||+|++.|.+...+|++|++++.+++.|.|||+|+++++++..++|
T Consensus       227 ~~d~Plr~pI~~v~~i~~~gtv~vGrVEsG~i~~g~~v~~~p~~~~~evksie~~~~~~~~a~~GD~i~~~vrgv~~~dI  306 (428)
T COG5256         227 PLDKPLRLPIQDVYSISGIGTVPVGRVESGVIKPGQKVTFMPAGVVGEVKSIEMHHEEISQAEPGDNVGFNVRGVEKNDI  306 (428)
T ss_pred             CCCCCeEeEeeeEEEecCCceEEEEEEeeeeeccCCEEEEecCcceEEEeeeeecccccccCCCCCeEEEEecCCchhcc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ceeEEEccCCCCCCcccceEEEEEEEecCCCCCCCCCeeEEeeeeeeEEEEEEEEeeeecCCCCcccccCccccCCCCEE
Q psy13961        321 RRGFVAGDSKASPPKATQDFTAQVIVLNHPGQISNGYTPVLDCHTAHIACKFAEIKEKCDRRTGKTTEENPKALKSGDAA  400 (459)
Q Consensus       321 ~~G~vl~~~~~~~~~~~~~f~a~i~~l~~~~~i~~g~~~~~~~~~~~~~~~i~~i~~~~~~~~~~~~~~~~~~l~~g~~~  400 (459)
                      ++|||++++++ ++..+.+|.|+|.++.+|..|.+||.|++|+|+..++|++..|..++|+.+++..+++|.++++|+.+
T Consensus       307 ~~Gdv~~~~~n-~~t~s~~f~a~i~vl~~p~~i~~Gyt~vlh~hta~~a~~~~~l~~k~d~~t~k~~~~~p~f~k~g~~~  385 (428)
T COG5256         307 RRGDVIGHSDN-PPTVSPEFTAQIIVLWHPGIITSGYTPVLHAHTAQVACRIAELLSKLDPRTGKKLEENPQFLKRGDAA  385 (428)
T ss_pred             CCccEeccCCC-CcccccceEEEEEEEecCccccCCCccEEEecccceeeeHHHHHHhhCcccccccccChhhhhcCceE
Confidence            99999999876 66667999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEEEeCCeEEeeecCCCCCcceEEEEECCceEEEEEEEeec
Q psy13961        401 IIVLVPSKPMCVESFSEFPPLGRFAVRDMRQTVAVGVIKVNN  442 (459)
Q Consensus       401 ~v~l~l~~~i~~~~~~~~~~~grfilrd~~~tva~G~V~~v~  442 (459)
                      .|.+++.+|+|++++++++.||||+|||.++|||+|+|.++.
T Consensus       386 iv~i~~~kP~~~e~~~~~~~Lgrfalrd~g~tIA~G~v~~v~  427 (428)
T COG5256         386 IVKIEPEKPLCLEKVSEIPQLGRFALRDMGQTIAAGKVLEVK  427 (428)
T ss_pred             EEEEEecCceEeeecccCCccceEEEEeCCCeEEeEEEEecc
Confidence            999999999999999999999999999999999999999875



>PLN00043 elongation factor 1-alpha; Provisional Back     alignment and domain information
>PTZ00141 elongation factor 1- alpha; Provisional Back     alignment and domain information
>TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha Back     alignment and domain information
>PRK12317 elongation factor 1-alpha; Reviewed Back     alignment and domain information
>KOG0458|consensus Back     alignment and domain information
>KOG0459|consensus Back     alignment and domain information
>COG2895 CysN GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional Back     alignment and domain information
>TIGR02034 CysN sulfate adenylyltransferase, large subunit Back     alignment and domain information
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>PLN03126 Elongation factor Tu; Provisional Back     alignment and domain information
>CHL00071 tufA elongation factor Tu Back     alignment and domain information
>PRK12735 elongation factor Tu; Reviewed Back     alignment and domain information
>PRK00049 elongation factor Tu; Reviewed Back     alignment and domain information
>PRK12736 elongation factor Tu; Reviewed Back     alignment and domain information
>TIGR00485 EF-Tu translation elongation factor TU Back     alignment and domain information
>PLN03127 Elongation factor Tu; Provisional Back     alignment and domain information
>KOG0460|consensus Back     alignment and domain information
>COG0050 TufB GTPases - translation elongation factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PTZ00327 eukaryotic translation initiation factor 2 gamma subunit; Provisional Back     alignment and domain information
>COG5258 GTPBP1 GTPase [General function prediction only] Back     alignment and domain information
>PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional Back     alignment and domain information
>PRK04000 translation initiation factor IF-2 subunit gamma; Validated Back     alignment and domain information
>TIGR03680 eif2g_arch translation initiation factor 2 subunit gamma Back     alignment and domain information
>TIGR00475 selB selenocysteine-specific elongation factor SelB Back     alignment and domain information
>KOG0463|consensus Back     alignment and domain information
>COG3276 SelB Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0052|consensus Back     alignment and domain information
>KOG1143|consensus Back     alignment and domain information
>COG5257 GCD11 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01394 TypA_BipA GTP-binding protein TypA/BipA Back     alignment and domain information
>PRK10218 GTP-binding protein; Provisional Back     alignment and domain information
>COG1217 TypA Predicted membrane GTPase involved in stress response [Signal transduction mechanisms] Back     alignment and domain information
>PRK05433 GTP-binding protein LepA; Provisional Back     alignment and domain information
>TIGR01393 lepA GTP-binding protein LepA Back     alignment and domain information
>cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily Back     alignment and domain information
>KOG0462|consensus Back     alignment and domain information
>KOG0461|consensus Back     alignment and domain information
>COG0481 LepA Membrane GTPase LepA [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd04166 CysN_ATPS CysN_ATPS subfamily Back     alignment and domain information
>PRK07560 elongation factor EF-2; Reviewed Back     alignment and domain information
>cd01884 EF_Tu EF-Tu subfamily Back     alignment and domain information
>PRK00741 prfC peptide chain release factor 3; Provisional Back     alignment and domain information
>PRK00007 elongation factor G; Reviewed Back     alignment and domain information
>COG0480 FusA Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00503 prfC peptide chain release factor 3 Back     alignment and domain information
>PRK12739 elongation factor G; Reviewed Back     alignment and domain information
>PRK05306 infB translation initiation factor IF-2; Validated Back     alignment and domain information
>TIGR00484 EF-G translation elongation factor EF-G Back     alignment and domain information
>TIGR00487 IF-2 translation initiation factor IF-2 Back     alignment and domain information
>PRK13351 elongation factor G; Reviewed Back     alignment and domain information
>TIGR00490 aEF-2 translation elongation factor aEF-2 Back     alignment and domain information
>PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site Back     alignment and domain information
>COG4108 PrfC Peptide chain release factor RF-3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK12740 elongation factor G; Reviewed Back     alignment and domain information
>CHL00189 infB translation initiation factor 2; Provisional Back     alignment and domain information
>PLN00116 translation elongation factor EF-2 subunit; Provisional Back     alignment and domain information
>PRK04004 translation initiation factor IF-2; Validated Back     alignment and domain information
>TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2 Back     alignment and domain information
>PTZ00416 elongation factor 2; Provisional Back     alignment and domain information
>KOG0466|consensus Back     alignment and domain information
>KOG1145|consensus Back     alignment and domain information
>KOG0465|consensus Back     alignment and domain information
>COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd01885 EF2 EF2 (for archaea and eukarya) Back     alignment and domain information
>PRK14845 translation initiation factor IF-2; Provisional Back     alignment and domain information
>cd01889 SelB_euk SelB subfamily Back     alignment and domain information
>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2) Back     alignment and domain information
>cd04167 Snu114p Snu114p subfamily Back     alignment and domain information
>cd01886 EF-G Elongation factor G (EF-G) subfamily Back     alignment and domain information
>cd04165 GTPBP1_like GTPBP1-like Back     alignment and domain information
>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily Back     alignment and domain information
>cd04168 TetM_like Tet(M)-like subfamily Back     alignment and domain information
>cd03704 eRF3c_III This family represents eEF1alpha-like C-terminal region of eRF3 homologous to the domain III of EF-Tu Back     alignment and domain information
>cd04169 RF3 RF3 subfamily Back     alignment and domain information
>cd01890 LepA LepA subfamily Back     alignment and domain information
>KOG0464|consensus Back     alignment and domain information
>cd04093 HBS1_C HBS1_C: this family represents the C-terminal domain of Hsp70 subfamily B suppressor 1 (HBS1) which is homologous to the domain III of EF-1alpha Back     alignment and domain information
>KOG0469|consensus Back     alignment and domain information
>cd03705 EF1_alpha_III Domain III of EF-1 Back     alignment and domain information
>cd04171 SelB SelB subfamily Back     alignment and domain information
>cd00881 GTP_translation_factor GTP translation factor family Back     alignment and domain information
>KOG1144|consensus Back     alignment and domain information
>KOG0467|consensus Back     alignment and domain information
>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily Back     alignment and domain information
>cd04095 CysN_NoDQ_III TCysN_NoDQ_II: This subfamily represents the domain II of the large subunit of ATP sulfurylase (ATPS): CysN or the N-terminal portion of NodQ, found mainly in proteobacteria and homologous to the domain II of EF-Tu Back     alignment and domain information
>PF03143 GTP_EFTU_D3: Elongation factor Tu C-terminal domain; InterPro: IPR004160 Translation elongation factors are responsible for two main processes during protein synthesis on the ribosome [, , ] Back     alignment and domain information
>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily Back     alignment and domain information
>COG1159 Era GTPase [General function prediction only] Back     alignment and domain information
>cd01513 Translation_factor_III Domain III of Elongation factor (EF) Tu (EF-TU) and EF-G Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd03693 EF1_alpha_II EF1_alpha_II: this family represents the domain II of elongation factor 1-alpha (EF-1a) that is found in archaea and all eukaryotic lineages Back     alignment and domain information
>TIGR00436 era GTP-binding protein Era Back     alignment and domain information
>KOG0468|consensus Back     alignment and domain information
>PRK15494 era GTPase Era; Provisional Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>cd04154 Arl2 Arl2 subfamily Back     alignment and domain information
>cd01895 EngA2 EngA2 subfamily Back     alignment and domain information
>cd04157 Arl6 Arl6 subfamily Back     alignment and domain information
>cd01864 Rab19 Rab19 subfamily Back     alignment and domain information
>cd03698 eRF3_II_like eRF3_II_like: domain similar to domain II of the eukaryotic class II release factor (eRF3) Back     alignment and domain information
>cd01894 EngA1 EngA1 subfamily Back     alignment and domain information
>cd04151 Arl1 Arl1 subfamily Back     alignment and domain information
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>cd04149 Arf6 Arf6 subfamily Back     alignment and domain information
>cd04150 Arf1_5_like Arf1-Arf5-like subfamily Back     alignment and domain information
>cd04124 RabL2 RabL2 subfamily Back     alignment and domain information
>cd01898 Obg Obg subfamily Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily Back     alignment and domain information
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily Back     alignment and domain information
>cd04114 Rab30 Rab30 subfamily Back     alignment and domain information
>cd04089 eRF3_II eRF3_II: domain II of the eukaryotic class II release factor (eRF3) Back     alignment and domain information
>PLN00223 ADP-ribosylation factor; Provisional Back     alignment and domain information
>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor Back     alignment and domain information
>PRK00089 era GTPase Era; Reviewed Back     alignment and domain information
>cd03694 GTPBP_II Domain II of the GP-1 family of GTPase Back     alignment and domain information
>cd01861 Rab6 Rab6 subfamily Back     alignment and domain information
>cd04158 ARD1 ARD1 subfamily Back     alignment and domain information
>COG2229 Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans Back     alignment and domain information
>cd01860 Rab5_related Rab5-related subfamily Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>cd01862 Rab7 Rab7 subfamily Back     alignment and domain information
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases Back     alignment and domain information
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily Back     alignment and domain information
>cd04106 Rab23_lke Rab23-like subfamily Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>TIGR00231 small_GTP small GTP-binding protein domain Back     alignment and domain information
>cd03697 EFTU_II EFTU_II: Elongation factor Tu domain II Back     alignment and domain information
>PTZ00133 ADP-ribosylation factor; Provisional Back     alignment and domain information
>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases Back     alignment and domain information
>cd01865 Rab3 Rab3 subfamily Back     alignment and domain information
>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily Back     alignment and domain information
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 Back     alignment and domain information
>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily Back     alignment and domain information
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily Back     alignment and domain information
>cd04120 Rab12 Rab12 subfamily Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes Back     alignment and domain information
>cd04116 Rab9 Rab9 subfamily Back     alignment and domain information
>cd03696 selB_II selB_II: this subfamily represents the domain of elongation factor SelB, homologous to domain II of EF-Tu Back     alignment and domain information
>PRK04213 GTP-binding protein; Provisional Back     alignment and domain information
>cd01866 Rab2 Rab2 subfamily Back     alignment and domain information
>cd01863 Rab18 Rab18 subfamily Back     alignment and domain information
>KOG0092|consensus Back     alignment and domain information
>PRK09554 feoB ferrous iron transport protein B; Reviewed Back     alignment and domain information
>cd04140 ARHI_like ARHI subfamily Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>cd04112 Rab26 Rab26 subfamily Back     alignment and domain information
>cd04127 Rab27A Rab27a subfamily Back     alignment and domain information
>PRK15467 ethanolamine utilization protein EutP; Provisional Back     alignment and domain information
>cd03708 GTPBP_III Domain III of the GP-1 family of GTPase Back     alignment and domain information
>TIGR02528 EutP ethanolamine utilization protein, EutP Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>cd01868 Rab11_like Rab11-like Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>cd04122 Rab14 Rab14 subfamily Back     alignment and domain information
>cd04156 ARLTS1 ARLTS1 subfamily Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>cd04121 Rab40 Rab40 subfamily Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily Back     alignment and domain information
>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>cd04136 Rap_like Rap-like subfamily Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd04110 Rab35 Rab35 subfamily Back     alignment and domain information
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily Back     alignment and domain information
>cd04142 RRP22 RRP22 subfamily Back     alignment and domain information
>PRK00454 engB GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>cd04109 Rab28 Rab28 subfamily Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>cd01893 Miro1 Miro1 subfamily Back     alignment and domain information
>cd03695 CysN_NodQ_II CysN_NodQ_II: This subfamily represents the domain II of the large subunit of ATP sulfurylase (ATPS): CysN or the N-terminal portion of NodQ, found mainly in proteobacteria and homologous to the domain II of EF-Tu Back     alignment and domain information
>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily Back     alignment and domain information
>PLN03118 Rab family protein; Provisional Back     alignment and domain information
>cd04147 Ras_dva Ras-dva subfamily Back     alignment and domain information
>PTZ00369 Ras-like protein; Provisional Back     alignment and domain information
>cd04128 Spg1 Spg1p Back     alignment and domain information
>cd04175 Rap1 Rap1 subgroup Back     alignment and domain information
>PRK12299 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd04118 Rab24 Rab24 subfamily Back     alignment and domain information
>cd04126 Rab20 Rab20 subfamily Back     alignment and domain information
>PRK12298 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily Back     alignment and domain information
>PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>cd04123 Rab21 Rab21 subfamily Back     alignment and domain information
>cd03706 mtEFTU_III Domain III of mitochondrial EF-TU (mtEF-TU) Back     alignment and domain information
>cd04176 Rap2 Rap2 subgroup Back     alignment and domain information
>cd04144 Ras2 Ras2 subfamily Back     alignment and domain information
>cd00157 Rho Rho (Ras homology) family Back     alignment and domain information
>cd01871 Rac1_like Rac1-like subfamily Back     alignment and domain information
>TIGR03156 GTP_HflX GTP-binding protein HflX Back     alignment and domain information
>cd01874 Cdc42 Cdc42 subfamily Back     alignment and domain information
>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed Back     alignment and domain information
>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily Back     alignment and domain information
>cd04143 Rhes_like Rhes_like subfamily Back     alignment and domain information
>TIGR02729 Obg_CgtA Obg family GTPase CgtA Back     alignment and domain information
>PLN03071 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd04135 Tc10 TC10 subfamily Back     alignment and domain information
>PRK12296 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>cd01875 RhoG RhoG subfamily Back     alignment and domain information
>cd04101 RabL4 RabL4 (Rab-like4) subfamily Back     alignment and domain information
>KOG0094|consensus Back     alignment and domain information
>cd04132 Rho4_like Rho4-like subfamily Back     alignment and domain information
>cd00880 Era_like Era (E Back     alignment and domain information
>KOG0084|consensus Back     alignment and domain information
>cd01892 Miro2 Miro2 subfamily Back     alignment and domain information
>cd04117 Rab15 Rab15 subfamily Back     alignment and domain information
>PLN03110 Rab GTPase; Provisional Back     alignment and domain information
>COG0486 ThdF Predicted GTPase [General function prediction only] Back     alignment and domain information
>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases Back     alignment and domain information
>cd00876 Ras Ras family Back     alignment and domain information
>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>COG0218 Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd04177 RSR1 RSR1 subgroup Back     alignment and domain information
>cd04111 Rab39 Rab39 subfamily Back     alignment and domain information
>cd04125 RabA_like RabA-like subfamily Back     alignment and domain information
>PLN03108 Rab family protein; Provisional Back     alignment and domain information
>cd04134 Rho3 Rho3 subfamily Back     alignment and domain information
>PRK12297 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd03707 EFTU_III Domain III of elongation factor (EF) Tu Back     alignment and domain information
>cd04133 Rop_like Rop subfamily Back     alignment and domain information
>PRK11058 GTPase HflX; Provisional Back     alignment and domain information
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily Back     alignment and domain information
>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily Back     alignment and domain information
>cd04130 Wrch_1 Wrch-1 subfamily Back     alignment and domain information
>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily Back     alignment and domain information
>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE Back     alignment and domain information
>cd01882 BMS1 Bms1 Back     alignment and domain information
>smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>cd01870 RhoA_like RhoA-like subfamily Back     alignment and domain information
>COG0370 FeoB Fe2+ transport system protein B [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd01876 YihA_EngB The YihA (EngB) subfamily Back     alignment and domain information
>TIGR00437 feoB ferrous iron transporter FeoB Back     alignment and domain information
>cd04131 Rnd Rnd subfamily Back     alignment and domain information
>cd04148 RGK RGK subfamily Back     alignment and domain information
>cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily Back     alignment and domain information
>cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily Back     alignment and domain information
>KOG0078|consensus Back     alignment and domain information
>KOG0098|consensus Back     alignment and domain information
>cd00882 Ras_like_GTPase Ras-like GTPase superfamily Back     alignment and domain information
>KOG0394|consensus Back     alignment and domain information
>cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta) Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>PTZ00132 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>KOG1423|consensus Back     alignment and domain information
>KOG0075|consensus Back     alignment and domain information
>PRK09866 hypothetical protein; Provisional Back     alignment and domain information
>PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>cd04129 Rho2 Rho2 subfamily Back     alignment and domain information
>cd04103 Centaurin_gamma Centaurin gamma Back     alignment and domain information
>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1) Back     alignment and domain information
>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins Back     alignment and domain information
>cd04104 p47_IIGP_like p47 (47-kDa) family Back     alignment and domain information
>COG2262 HflX GTPases [General function prediction only] Back     alignment and domain information
>cd01873 RhoBTB RhoBTB subfamily Back     alignment and domain information
>KOG0087|consensus Back     alignment and domain information
>KOG0073|consensus Back     alignment and domain information
>KOG0080|consensus Back     alignment and domain information
>cd04102 RabL3 RabL3 (Rab-like3) subfamily Back     alignment and domain information
>KOG0095|consensus Back     alignment and domain information
>KOG1489|consensus Back     alignment and domain information
>KOG0070|consensus Back     alignment and domain information
>cd04094 selB_III This family represents the domain of elongation factor SelB, homologous to domain III of EF-Tu Back     alignment and domain information
>KOG0086|consensus Back     alignment and domain information
>KOG0076|consensus Back     alignment and domain information
>PLN00023 GTP-binding protein; Provisional Back     alignment and domain information
>KOG1532|consensus Back     alignment and domain information
>COG3596 Predicted GTPase [General function prediction only] Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>KOG1191|consensus Back     alignment and domain information
>cd03688 eIF2_gamma_II eIF2_gamma_II: this subfamily represents the domain II of the gamma subunit of eukaryotic translation initiation factor 2 (eIF2-gamma) found in Eukaryota and Archaea Back     alignment and domain information
>COG1084 Predicted GTPase [General function prediction only] Back     alignment and domain information
>KOG0093|consensus Back     alignment and domain information
>KOG0079|consensus Back     alignment and domain information
>PF09439 SRPRB: Signal recognition particle receptor beta subunit; InterPro: IPR019009 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>cd01850 CDC_Septin CDC/Septin Back     alignment and domain information
>COG1100 GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>PF04670 Gtr1_RagA: Gtr1/RagA G protein conserved region; InterPro: IPR006762 GTR1 was first identified in Saccharomyces cerevisiae (Baker's yeast) as a suppressor of a mutation in RCC1 Back     alignment and domain information
>cd03692 mtIF2_IVc mtIF2_IVc: this family represents the C2 subdomain of domain IV of mitochondrial translation initiation factor 2 (mtIF2) which adopts a beta-barrel fold displaying a high degree of structural similarity with domain II of the translation elongation factor EF-Tu Back     alignment and domain information
>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity Back     alignment and domain information
>COG4917 EutP Ethanolamine utilization protein [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0090|consensus Back     alignment and domain information
>KOG0091|consensus Back     alignment and domain information
>cd01899 Ygr210 Ygr210 subfamily Back     alignment and domain information
>PTZ00099 rab6; Provisional Back     alignment and domain information
>KOG0088|consensus Back     alignment and domain information
>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts) Back     alignment and domain information
>COG0536 Obg Predicted GTPase [General function prediction only] Back     alignment and domain information
>KOG0395|consensus Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>KOG0097|consensus Back     alignment and domain information
>KOG0071|consensus Back     alignment and domain information
>COG1163 DRG Predicted GTPase [General function prediction only] Back     alignment and domain information
>KOG0074|consensus Back     alignment and domain information
>cd01342 Translation_Factor_II_like Translation_Factor_II_like: Elongation factor Tu (EF-Tu) domain II-like proteins Back     alignment and domain information
>KOG0072|consensus Back     alignment and domain information
>COG5192 BMS1 GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0081|consensus Back     alignment and domain information
>PRK09602 translation-associated GTPase; Reviewed Back     alignment and domain information
>TIGR00073 hypB hydrogenase accessory protein HypB Back     alignment and domain information
>PF03144 GTP_EFTU_D2: Elongation factor Tu domain 2; InterPro: IPR004161 Translation elongation factors are responsible for two main processes during protein synthesis on the ribosome [, , ] Back     alignment and domain information
>PF05049 IIGP: Interferon-inducible GTPase (IIGP); InterPro: IPR007743 Interferon-inducible GTPase (IIGP) is thought to play a role in in intracellular defence Back     alignment and domain information
>cd03690 Tet_II Tet_II: This subfamily represents domain II of ribosomal protection proteins Tet(M) and Tet(O) Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>PF04548 AIG1: AIG1 family; InterPro: IPR006703 This entry represents a domain found in Arabidopsis protein AIG1 which appears to be involved in plant resistance to bacteria Back     alignment and domain information
>cd04092 mtEFG2_II_like mtEFG2_C: C-terminus of mitochondrial Elongation factor G2 (mtEFG2)-like proteins found in eukaryotes Back     alignment and domain information
>TIGR02836 spore_IV_A stage IV sporulation protein A Back     alignment and domain information
>cd03699 lepA_II lepA_II: This subfamily represents the domain II of LepA, a GTP-binding protein localized in the cytoplasmic membrane Back     alignment and domain information
>KOG0410|consensus Back     alignment and domain information
>cd03689 RF3_II RF3_II: this subfamily represents the domain II of bacterial Release Factor 3 (RF3) Back     alignment and domain information
>TIGR00991 3a0901s02IAP34 GTP-binding protein (Chloroplast Envelope Protein Translocase) Back     alignment and domain information
>cd04088 EFG_mtEFG_II EFG_mtEFG_II: this subfamily represents the domain II of elongation factor G (EF-G) in bacteria and, the C-terminus of mitochondrial Elongation factor G1 (mtEFG1) and G2 (mtEFG2)_like proteins found in eukaryotes Back     alignment and domain information
>PF00350 Dynamin_N: Dynamin family; InterPro: IPR001401 Membrane transport between compartments in eukaryotic cells requires proteins that allow the budding and scission of nascent cargo vesicles from one compartment and their targeting and fusion with another Back     alignment and domain information
>smart00053 DYNc Dynamin, GTPase Back     alignment and domain information
>KOG0077|consensus Back     alignment and domain information
>COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] Back     alignment and domain information
>PF14578 GTP_EFTU_D4: Elongation factor Tu domain 4; PDB: 1G7R_A 1G7S_A 1G7T_A 1XE1_A Back     alignment and domain information
>KOG4252|consensus Back     alignment and domain information
>cd03691 BipA_TypA_II BipA_TypA_II: domain II of BipA (also called TypA) having homology to domain II of the elongation factors (EFs) EF-G and EF-Tu Back     alignment and domain information
>KOG3886|consensus Back     alignment and domain information
>cd04091 mtEFG1_II_like mtEFG1_C: C-terminus of mitochondrial Elongation factor G1 (mtEFG1)-like proteins found in eukaryotes Back     alignment and domain information
>TIGR00101 ureG urease accessory protein UreG Back     alignment and domain information
>KOG0083|consensus Back     alignment and domain information
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional Back     alignment and domain information
>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>KOG2486|consensus Back     alignment and domain information
>KOG3883|consensus Back     alignment and domain information
>PTZ00258 GTP-binding protein; Provisional Back     alignment and domain information
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00993 3a0901s04IAP86 chloroplast protein import component Toc86/159, G and M domains Back     alignment and domain information
>KOG0393|consensus Back     alignment and domain information
>KOG1707|consensus Back     alignment and domain information
>cd01900 YchF YchF subfamily Back     alignment and domain information
>PRK09601 GTP-binding protein YchF; Reviewed Back     alignment and domain information
>PF00735 Septin: Septin; InterPro: IPR000038 Septins constitute a eukaryotic family of guanine nucleotide-binding proteins, most of which polymerise to form filaments [] Back     alignment and domain information
>cd03700 eEF2_snRNP_like_II EF2_snRNP_like_II: this subfamily represents domain II of elongation factor (EF) EF-2 found eukaryotes and archaea and, the C-terminal portion of the spliceosomal human 116kD U5 small nuclear ribonucleoprotein (snRNP) protein (U5-116 kD) and, its yeast counterpart Snu114p Back     alignment and domain information
>cd01859 MJ1464 MJ1464 Back     alignment and domain information
>KOG1673|consensus Back     alignment and domain information
>KOG0448|consensus Back     alignment and domain information
>cd01857 HSR1_MMR1 HSR1/MMR1 Back     alignment and domain information
>KOG0096|consensus Back     alignment and domain information
>cd01856 YlqF YlqF Back     alignment and domain information
>cd04090 eEF2_II_snRNP Loc2 eEF2_C_snRNP, cd01514/C terminal domain:eEF2_C_snRNP: This family includes C-terminal portion of the spliceosomal human 116kD U5 small nuclear ribonucleoprotein (snRNP) protein (U5-116 kD) and, its yeast counterpart Snu114p Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>KOG1490|consensus Back     alignment and domain information
>KOG1534|consensus Back     alignment and domain information
>cd01858 NGP_1 NGP-1 Back     alignment and domain information
>cd01858 NGP_1 NGP-1 Back     alignment and domain information
>KOG1547|consensus Back     alignment and domain information
>cd04178 Nucleostemin_like Nucleostemin-like Back     alignment and domain information
>cd01855 YqeH YqeH Back     alignment and domain information
>cd01851 GBP Guanylate-binding protein (GBP), N-terminal domain Back     alignment and domain information
>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>PF05783 DLIC: Dynein light intermediate chain (DLIC); InterPro: IPR022780 This entry consists of several eukaryotic dynein light intermediate chain proteins Back     alignment and domain information
>COG5019 CDC3 Septin family protein [Cell division and chromosome partitioning / Cytoskeleton] Back     alignment and domain information
>COG0012 Predicted GTPase, probable translation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis Back     alignment and domain information
>TIGR00157 ribosome small subunit-dependent GTPase A Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>KOG3905|consensus Back     alignment and domain information
>KOG1486|consensus Back     alignment and domain information
>cd01849 YlqF_related_GTPase YlqF-related GTPases Back     alignment and domain information
>cd01849 YlqF_related_GTPase YlqF-related GTPases Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK12289 GTPase RsgA; Reviewed Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PRK09563 rbgA GTPase YlqF; Reviewed Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG1954|consensus Back     alignment and domain information
>cd01855 YqeH YqeH Back     alignment and domain information
>cd01857 HSR1_MMR1 HSR1/MMR1 Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>cd03112 CobW_like The function of this protein family is unkown Back     alignment and domain information
>cd03114 ArgK-like The function of this protein family is unkown Back     alignment and domain information
>PRK00098 GTPase RsgA; Reviewed Back     alignment and domain information
>COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning] Back     alignment and domain information
>KOG2655|consensus Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>TIGR00487 IF-2 translation initiation factor IF-2 Back     alignment and domain information
>PRK12288 GTPase RsgA; Reviewed Back     alignment and domain information
>COG1161 Predicted GTPases [General function prediction only] Back     alignment and domain information
>cd01856 YlqF YlqF Back     alignment and domain information
>TIGR00157 ribosome small subunit-dependent GTPase A Back     alignment and domain information
>PRK09563 rbgA GTPase YlqF; Reviewed Back     alignment and domain information
>PRK05306 infB translation initiation factor IF-2; Validated Back     alignment and domain information
>KOG4423|consensus Back     alignment and domain information
>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>CHL00189 infB translation initiation factor 2; Provisional Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1487|consensus Back     alignment and domain information
>cd01854 YjeQ_engC YjeQ/EngC Back     alignment and domain information
>cd03110 Fer4_NifH_child This protein family's function is unkown Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK12289 GTPase RsgA; Reviewed Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH Back     alignment and domain information
>COG1162 Predicted GTPases [General function prediction only] Back     alignment and domain information
>TIGR00092 GTP-binding protein YchF Back     alignment and domain information
>KOG0082|consensus Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG3887|consensus Back     alignment and domain information
>KOG1533|consensus Back     alignment and domain information
>PRK12288 GTPase RsgA; Reviewed Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd02036 MinD Bacterial cell division requires the formation of a septum at mid-cell Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd01854 YjeQ_engC YjeQ/EngC Back     alignment and domain information
>TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>PRK13796 GTPase YqeH; Provisional Back     alignment and domain information
>KOG0780|consensus Back     alignment and domain information
>KOG1491|consensus Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd01859 MJ1464 MJ1464 Back     alignment and domain information
>cd03111 CpaE_like This protein family consists of proteins similar to the cpaE protein of the Caulobacter pilus assembly and the orf4 protein of Actinobacillus pilus formation gene cluster Back     alignment and domain information
>cd02038 FleN-like FleN is a member of the Fer4_NifH superfamily Back     alignment and domain information
>PRK01889 GTPase RsgA; Reviewed Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>cd00066 G-alpha G protein alpha subunit Back     alignment and domain information
>COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>smart00275 G_alpha G protein alpha subunit Back     alignment and domain information
>PRK13796 GTPase YqeH; Provisional Back     alignment and domain information
>PF02492 cobW: CobW/HypB/UreG, nucleotide-binding domain; InterPro: IPR003495 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt Back     alignment and domain information
>PRK00098 GTPase RsgA; Reviewed Back     alignment and domain information
>KOG2485|consensus Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG0447|consensus Back     alignment and domain information
>PRK11537 putative GTP-binding protein YjiA; Provisional Back     alignment and domain information
>COG0523 Putative GTPases (G3E family) [General function prediction only] Back     alignment and domain information
>COG1162 Predicted GTPases [General function prediction only] Back     alignment and domain information
>cd03702 IF2_mtIF2_II This family represents the domain II of bacterial Initiation Factor 2 (IF2) and its eukaryotic mitochondrial homologue mtIF2 Back     alignment and domain information
>cd02037 MRP-like MRP (Multiple Resistance and pH adaptation) is a homologue of the Fer4_NifH superfamily Back     alignment and domain information
>cd02042 ParA ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation Back     alignment and domain information
>TIGR02475 CobW cobalamin biosynthesis protein CobW Back     alignment and domain information
>cd03703 aeIF5B_II aeIF5B_II: This family represents the domain II of archeal and eukaryotic aeIF5B Back     alignment and domain information
>KOG4181|consensus Back     alignment and domain information
>PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional Back     alignment and domain information
>PF09547 Spore_IV_A: Stage IV sporulation protein A (spore_IV_A); InterPro: IPR014201 This entry is designated stage IV sporulation protein A Back     alignment and domain information
>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR03348 VI_IcmF type VI secretion protein IcmF Back     alignment and domain information
>TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2 Back     alignment and domain information
>KOG2743|consensus Back     alignment and domain information
>KOG2484|consensus Back     alignment and domain information
>COG3172 NadR Predicted ATPase/kinase involved in NAD metabolism [Coenzyme metabolism] Back     alignment and domain information
>cd04178 Nucleostemin_like Nucleostemin-like Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>cd03701 IF2_IF5B_II IF2_IF5B_II: This family represents the domain II of prokaryotic Initiation Factor 2 (IF2) and its archeal and eukaryotic homologue aeIF5B Back     alignment and domain information
>KOG2423|consensus Back     alignment and domain information
>KOG1424|consensus Back     alignment and domain information
>PF09173 eIF2_C: Initiation factor eIF2 gamma, C terminal; InterPro: IPR015256 This entry represents a domain which is found in the initiation factors eIF2 and EF-Tu, adopting a beta barrel structure with Greek key topology Back     alignment and domain information
>PF06858 NOG1: Nucleolar GTP-binding protein 1 (NOG1); InterPro: IPR010674 This domain represents a conserved region of approximately 60 residues in length within nucleolar GTP-binding protein 1 (NOG1) Back     alignment and domain information
>PRK04004 translation initiation factor IF-2; Validated Back     alignment and domain information
>PRK14845 translation initiation factor IF-2; Provisional Back     alignment and domain information
>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>smart00010 small_GTPase Small GTPase of the Ras superfamily; ill-defined subfamily Back     alignment and domain information
>COG1341 Predicted GTPase or GTP-binding protein [General function prediction only] Back     alignment and domain information
>KOG3859|consensus Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>COG3523 IcmF Type VI protein secretion system component VasK [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK01889 GTPase RsgA; Reviewed Back     alignment and domain information
>COG1763 MobB Molybdopterin-guanine dinucleotide biosynthesis protein [Coenzyme metabolism] Back     alignment and domain information
>PF00503 G-alpha: G-protein alpha subunit; InterPro: IPR001019 Guanine nucleotide binding proteins (G proteins) are membrane-associated, heterotrimeric proteins composed of three subunits: alpha (IPR001019 from INTERPRO), beta (IPR001632 from INTERPRO) and gamma (IPR001770 from INTERPRO) [] Back     alignment and domain information
>KOG2484|consensus Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>KOG1144|consensus Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>KOG0781|consensus Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03116 MobB Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1707|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query459
1f60_A458 Crystal Structure Of The Yeast Elongation Factor Co 0.0
3agj_A437 Crystal Structure Of Archaeal Pelota And Gtp-bound 1e-136
3vmf_A440 Archaeal Protein Length = 440 1e-136
1jny_A435 Crystal Structure Of Sulfolobus Solfataricus Elonga 1e-136
3j2k_7439 Cryo-Em Structure Of The Mammalian Erf1-Erf3-Associ 7e-85
1r5b_A467 Crystal Structure Analysis Of Sup35 Length = 467 2e-80
3mca_A592 Structure Of The Dom34-Hbs1 Complex And Implication 2e-72
3izq_1611 Structure Of The Dom34-Hbs1-Gdpnp Complex Bound To 4e-57
3p26_A483 Crystal Structure Of S. Cerevisiae Hbs1 Protein (Ap 6e-57
3p27_A483 Crystal Structure Of S. Cerevisiae Hbs1 Protein (Gd 2e-54
4abr_Z405 Complex Of Smpb, A Tmrna Fragment And Ef-Tu-Gdp-Kir 6e-45
1ttt_A405 Phe-Trna, Elongation Factor Ef-Tu:gdpnp Ternary Com 6e-45
1eft_A405 The Crystal Structure Of Elongation Factor Ef-Tu Fr 1e-44
2y0u_Z405 The Crystal Structure Of Ef-Tu And A9c-Trna-Trp Bou 4e-44
2c78_A405 Ef-Tu Complexed With A Gtp Analog And The Antibioti 4e-44
2c77_A405 Ef-Tu Complexed With A Gtp Analog And The Antibioti 5e-44
2y0y_Z405 The Crystal Structure Of Ef-Tu And G24a-Trna-Trp Bo 5e-44
1aip_A405 Ef-Tu Ef-Ts Complex From Thermus Thermophilus Lengt 5e-44
2wrn_Z406 The Crystal Structure Of The 70s Ribosome Bound To 6e-44
1exm_A405 Crystal Structure Of Thermus Thermophilus Elongatio 2e-43
1d2e_A397 Crystal Structure Of Mitochondrial Ef-Tu In Complex 1e-42
1mj1_A405 Fitting The Ternary Complex Of Ef-TuTRNAGTP AND RIB 3e-40
1xb2_A409 Crystal Structure Of Bos Taurus Mitochondrial Elong 5e-40
1zun_B434 Crystal Structure Of A Gtp-Regulated Atp Sulfurylas 7e-39
1efc_A393 Intact Elongation Factor From E.Coli Length = 393 5e-34
1ob2_A393 E. Coli Elongation Factor Ef-Tu Complexed With The 5e-34
3u6b_A394 Ef-Tu (Escherichia Coli) In Complex With Nvp-Ldi028 5e-34
1d8t_A393 Crystal Structure Of Elongation Factor, Tu (Ef-Tu-M 5e-34
1dg1_G394 Whole, Unmodified, Ef-Tu(Elongation Factor Tu). Len 6e-34
1efu_A385 Elongation Factor Complex Ef-TuEF-Ts From Escherich 7e-34
3agp_A 1289 Structure Of Viral Polymerase Form I Length = 1289 8e-34
3mmp_A678 Structure Of The Qb Replicase, An Rna-Dependent Rna 1e-33
1efm_A379 Structure Of The Gdp Domain Of Ef-Tu And Location O 2e-32
2hcj_B335 "trypsin-Modified Elongation Factor Tu In Complex W 2e-28
2hdn_B335 Trypsin-Modified Elongation Factor Tu In Complex Wi 2e-28
4ac9_A482 Crystal Structure Of Translation Elongation Factor 8e-24
3e1y_E204 Crystal Structure Of Human Erf1ERF3 COMPLEX Length 7e-22
3e20_A201 Crystal Structure Of S.Pombe Erf1ERF3 COMPLEX Lengt 4e-20
2d74_A419 Crystal Structure Of Translation Initiation Factor 1e-14
1kjz_A410 Structure Of The Large Gamma Subunit Of Initiation 2e-14
1kk3_A410 Structure Of The Wild-Type Large Gamma Subunit Of I 2e-14
3j25_A 638 Structural Basis For Tetm-Mediated Tetracycline Res 4e-13
1kk0_A410 Structure Of The Large Gamma Subunit Of Initiation 9e-13
2ywe_A 600 Crystal Structure Of Lepa From Aquifex Aeolicus Len 6e-11
1s0u_A408 Eif2gamma Apo Length = 408 9e-11
3cb4_D 599 The Crystal Structure Of Lepa Length = 599 1e-10
3deg_C545 Complex Of Elongating Escherichia Coli 70s Ribosome 1e-10
2ywg_A 600 Crystal Structure Of Gtp-Bound Lepa From Aquifex Ae 3e-10
3pen_A403 Structure Of Archaeal Initiation Factor Aif2gamma S 3e-09
2bm1_A 691 Ribosomal Elongation Factor G (Ef-G) Fusidic Acid R 5e-09
3sjz_A409 The Structure Of Aif2gamma Subunit Delta 41-45 From 6e-09
2bm0_A 691 Ribosomal Elongation Factor G (Ef-G) Fusidic Acid R 1e-08
2aho_A414 Structure Of The Archaeal Initiation Factor Eif2 Al 1e-08
2pmd_A415 The Structures Of Aif2gamma Subunit From The Archae 1e-08
2bv3_A 691 Crystal Structure Of A Mutant Elongation Factor G T 1e-08
2j7k_A 691 Crystal Structure Of The T84a Mutant Ef-G:gdpcp Com 1e-08
2elf_A370 Crystal Structure Of The Selb-Like Elongation Facto 1e-08
1efg_A 691 The Crystal Structure Of Elongation Factor G Comple 4e-08
1ktv_A 691 Crystal Structure Of Elongation Factor G Dimer With 4e-08
1fnm_A 691 Structure Of Thermus Thermophilus Ef-G H573a Length 4e-08
3izp_E 688 Conformation Of Ef-G During Translocation Length = 5e-08
3vqt_A548 Crystal Structure Analysis Of The Translation Facto 1e-07
3uoq_W534 Crystal Structure Of Release Factor Rf3 Trapped In 1e-07
2h5e_A529 Crystal Structure Of E.Coli Polypeptide Release Fac 1e-07
3zz0_A 693 Crystal Structure Of Ribosomal Elongation Factor (E 2e-07
1u2r_A 842 Crystal Structure Of Adp-Ribosylated Ribosomal Tran 3e-07
1n0v_C 842 Crystal Structure Of Elongation Factor 2 Length = 8 3e-07
2xex_A 693 Crystal Structure Of Staphylococcus Aureus Elongati 4e-07
4fn5_A 709 Elongation Factor G 1 (Pseudomonas Aeruginosa) In C 8e-07
3zzu_A 693 Crystal Structure Of Staphylococcus Aureus Elongati 8e-07
3tr5_A528 Structure Of A Peptide Chain Release Factor 3 (Prfc 9e-07
3zzt_A 693 Crystal Structure Of Staphylococcus Aureus Elongati 2e-06
3j0e_H 702 Models For The T. Thermophilus Ribosome Recycling F 9e-06
2rdo_7 704 50s Subunit With Ef-G(Gdpnp) And Rrf Bound Length = 9e-06
1wdt_A 665 Crystal Structure Of Ttk003000868 From Thermus Ther 9e-05
3izy_P 537 Mammalian Mitochondrial Translation Initiation Fact 2e-04
>pdb|1F60|A Chain A, Crystal Structure Of The Yeast Elongation Factor Complex Eef1a:eef1ba Length = 458 Back     alignment and structure

Iteration: 1

Score = 732 bits (1890), Expect = 0.0, Method: Compositional matrix adjust. Identities = 350/439 (79%), Positives = 388/439 (88%), Gaps = 2/439 (0%) Query: 1 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60 MGKEK+HIN+VVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA E+GKGSFKYAWVL Sbjct: 1 MGKEKSHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVL 60 Query: 61 DKLKAERERGITIDIALWKFETSKFYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 120 DKLKAERERGITIDIALWKFET K+ VT+IDAPGHRDFIKNMITGTSQADCA+LI+A G Sbjct: 61 DKLKAERERGITIDIALWKFETPKYQVTVIDAPGHRDFIKNMITGTSQADCAILIIAGGV 120 Query: 121 GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEARFEEIKKEVSGYIKK 180 GEFEAGISK+GQTREHALLAFTLGV+QLIV VNKMDS + + E+RF+EI KE S +IKK Sbjct: 121 GEFEAGISKDGQTREHALLAFTLGVRQLIVAVNKMDSVK--WDESRFQEIVKETSNFIKK 178 Query: 181 IGYNPATVAFVPISGWHGDNMLEVSDKMPWFKGWAIERKEGKADGKCLIEALDAILPPSR 240 +GYNP TV FVPISGW+GDNM+E + PW+KGW E K G GK L+EA+DAI PSR Sbjct: 179 VGYNPKTVPFVPISGWNGDNMIEATTNAPWYKGWEKETKAGVVKGKTLLEAIDAIEQPSR 238 Query: 241 PTEKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMLVTFAPANLTTEVKSVEMHHEALQ 300 PT+KPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGM+VTFAPA +TTEVKSVEMHHE L+ Sbjct: 239 PTDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFAPAGVTTEVKSVEMHHEQLE 298 Query: 301 EAVPGDNVGFNVKNVSVKELRRGFVAGDSKASPPKATQDFTAQVIVLNHPGQISNGYTPV 360 + VPGDNVGFNVKNVSVKE+RRG V GD+K PPK F A VIVLNHPGQIS GY+PV Sbjct: 299 QGVPGDNVGFNVKNVSVKEIRRGNVCGDAKNDPPKGCASFNATVIVLNHPGQISAGYSPV 358 Query: 361 LDCHTAHIACKFAEIKEKCDRRTGKTTEENPKALKSGDAAIIVLVPSKPMCVESFSEFPP 420 LDCHTAHIAC+F E+ EK DRR+GK E++PK LKSGDAA++ VPSKPMCVE+FSE+PP Sbjct: 359 LDCHTAHIACRFDELLEKNDRRSGKKLEDHPKFLKSGDAALVKFVPSKPMCVEAFSEYPP 418 Query: 421 LGRFAVRDMRQTVAVGVIK 439 LGRFAVRDMRQTVAVGVIK Sbjct: 419 LGRFAVRDMRQTVAVGVIK 437
>pdb|3AGJ|A Chain A, Crystal Structure Of Archaeal Pelota And Gtp-bound Ef1 Alpha Complex Length = 437 Back     alignment and structure
>pdb|3VMF|A Chain A, Archaeal Protein Length = 440 Back     alignment and structure
>pdb|1JNY|A Chain A, Crystal Structure Of Sulfolobus Solfataricus Elongation Factor 1 Alpha In Complex With Gdp Length = 435 Back     alignment and structure
>pdb|3J2K|7 Chain 7, Cryo-Em Structure Of The Mammalian Erf1-Erf3-Associated Termination Complex Length = 439 Back     alignment and structure
>pdb|1R5B|A Chain A, Crystal Structure Analysis Of Sup35 Length = 467 Back     alignment and structure
>pdb|3MCA|A Chain A, Structure Of The Dom34-Hbs1 Complex And Implications For Its Role In No-Go Decay Length = 592 Back     alignment and structure
>pdb|3IZQ|1 Chain 1, Structure Of The Dom34-Hbs1-Gdpnp Complex Bound To A Translating Ribosome Length = 611 Back     alignment and structure
>pdb|3P26|A Chain A, Crystal Structure Of S. Cerevisiae Hbs1 Protein (Apo-Form), A Translational Gtpase Involved In Rna Quality Control Pathways And Interacting With Dom34PELOTA Length = 483 Back     alignment and structure
>pdb|3P27|A Chain A, Crystal Structure Of S. Cerevisiae Hbs1 Protein (Gdp-Bound Form), A Translational Gtpase Involved In Rna Quality Control Pathways And Interacting With Dom34PELOTA Length = 483 Back     alignment and structure
>pdb|4ABR|Z Chain Z, Complex Of Smpb, A Tmrna Fragment And Ef-Tu-Gdp-Kirromycin With The 70s Ribosome Length = 405 Back     alignment and structure
>pdb|1TTT|A Chain A, Phe-Trna, Elongation Factor Ef-Tu:gdpnp Ternary Complex Length = 405 Back     alignment and structure
>pdb|1EFT|A Chain A, The Crystal Structure Of Elongation Factor Ef-Tu From Thermus Aquaticus In The Gtp Conformation Length = 405 Back     alignment and structure
>pdb|2Y0U|Z Chain Z, The Crystal Structure Of Ef-Tu And A9c-Trna-Trp Bound To A Near-Cognate Codon On The 70s Ribosome Length = 405 Back     alignment and structure
>pdb|2C78|A Chain A, Ef-Tu Complexed With A Gtp Analog And The Antibiotic Pulvomycin Length = 405 Back     alignment and structure
>pdb|2C77|A Chain A, Ef-Tu Complexed With A Gtp Analog And The Antibiotic Ge2270 A Length = 405 Back     alignment and structure
>pdb|2Y0Y|Z Chain Z, The Crystal Structure Of Ef-Tu And G24a-Trna-Trp Bound To A Near-Cognate Codon On The 70s Ribosome Length = 405 Back     alignment and structure
>pdb|1AIP|A Chain A, Ef-Tu Ef-Ts Complex From Thermus Thermophilus Length = 405 Back     alignment and structure
>pdb|2WRN|Z Chain Z, The Crystal Structure Of The 70s Ribosome Bound To Ef-Tu And Trna (Part 1 Of 4). Length = 406 Back     alignment and structure
>pdb|1EXM|A Chain A, Crystal Structure Of Thermus Thermophilus Elongation Factor Tu (Ef-Tu) In Complex With The Gtp Analogue Gppnhp. Length = 405 Back     alignment and structure
>pdb|1D2E|A Chain A, Crystal Structure Of Mitochondrial Ef-Tu In Complex With Gdp Length = 397 Back     alignment and structure
>pdb|1MJ1|A Chain A, Fitting The Ternary Complex Of Ef-TuTRNAGTP AND RIBOSOMAL PROTEINS Into A 13 A Cryo-Em Map Of The Coli 70s Ribosome Length = 405 Back     alignment and structure
>pdb|1XB2|A Chain A, Crystal Structure Of Bos Taurus Mitochondrial Elongation Factor TuTS COMPLEX Length = 409 Back     alignment and structure
>pdb|1ZUN|B Chain B, Crystal Structure Of A Gtp-Regulated Atp Sulfurylase Heterodimer From Pseudomonas Syringae Length = 434 Back     alignment and structure
>pdb|1EFC|A Chain A, Intact Elongation Factor From E.Coli Length = 393 Back     alignment and structure
>pdb|1OB2|A Chain A, E. Coli Elongation Factor Ef-Tu Complexed With The Antibiotic Kirromycin, A Gtp Analog, And Phe-Trna Length = 393 Back     alignment and structure
>pdb|3U6B|A Chain A, Ef-Tu (Escherichia Coli) In Complex With Nvp-Ldi028 Length = 394 Back     alignment and structure
>pdb|1D8T|A Chain A, Crystal Structure Of Elongation Factor, Tu (Ef-Tu-Mggdp) Complexed With Ge2270a, A Thiazolyl Peptide Antibiotic Length = 393 Back     alignment and structure
>pdb|1DG1|G Chain G, Whole, Unmodified, Ef-Tu(Elongation Factor Tu). Length = 394 Back     alignment and structure
>pdb|1EFU|A Chain A, Elongation Factor Complex Ef-TuEF-Ts From Escherichia Coli Length = 385 Back     alignment and structure
>pdb|3AGP|A Chain A, Structure Of Viral Polymerase Form I Length = 1289 Back     alignment and structure
>pdb|3MMP|A Chain A, Structure Of The Qb Replicase, An Rna-Dependent Rna Polymerase Consisting Of Viral And Host Proteins Length = 678 Back     alignment and structure
>pdb|1EFM|A Chain A, Structure Of The Gdp Domain Of Ef-Tu And Location Of The Amino Acids Homologous To Ras Oncogene Proteins Length = 379 Back     alignment and structure
>pdb|2HCJ|B Chain B, "trypsin-Modified Elongation Factor Tu In Complex With Tetracycline" Length = 335 Back     alignment and structure
>pdb|2HDN|B Chain B, Trypsin-Modified Elongation Factor Tu In Complex With Tetracycline At 2.8 Angstrom Resolution Length = 335 Back     alignment and structure
>pdb|4AC9|A Chain A, Crystal Structure Of Translation Elongation Factor Selb From Methanococcus Maripaludis In Complex With Gdp Length = 482 Back     alignment and structure
>pdb|3E1Y|E Chain E, Crystal Structure Of Human Erf1ERF3 COMPLEX Length = 204 Back     alignment and structure
>pdb|3E20|A Chain A, Crystal Structure Of S.Pombe Erf1ERF3 COMPLEX Length = 201 Back     alignment and structure
>pdb|2D74|A Chain A, Crystal Structure Of Translation Initiation Factor Aif2betagamma Heterodimer Length = 419 Back     alignment and structure
>pdb|1KJZ|A Chain A, Structure Of The Large Gamma Subunit Of Initiation Factor Eif2 From Pyrococcus Abyssi-G235d Mutant Length = 410 Back     alignment and structure
>pdb|1KK3|A Chain A, Structure Of The Wild-Type Large Gamma Subunit Of Initiation Factor Eif2 From Pyrococcus Abyssi Complexed With Gdp-Mg2+ Length = 410 Back     alignment and structure
>pdb|3J25|A Chain A, Structural Basis For Tetm-Mediated Tetracycline Resistance Length = 638 Back     alignment and structure
>pdb|1KK0|A Chain A, Structure Of The Large Gamma Subunit Of Initiation Factor Eif2 From Pyrococcus Abyssi Length = 410 Back     alignment and structure
>pdb|2YWE|A Chain A, Crystal Structure Of Lepa From Aquifex Aeolicus Length = 600 Back     alignment and structure
>pdb|1S0U|A Chain A, Eif2gamma Apo Length = 408 Back     alignment and structure
>pdb|3CB4|D Chain D, The Crystal Structure Of Lepa Length = 599 Back     alignment and structure
>pdb|3DEG|C Chain C, Complex Of Elongating Escherichia Coli 70s Ribosome And Ef4(Lepa)- Gmppnp Length = 545 Back     alignment and structure
>pdb|2YWG|A Chain A, Crystal Structure Of Gtp-Bound Lepa From Aquifex Aeolicus Length = 600 Back     alignment and structure
>pdb|3PEN|A Chain A, Structure Of Archaeal Initiation Factor Aif2gamma Subunit Delta 37-47 From Sulfolobus Solfataricus In The Gdp-Bound Form. Length = 403 Back     alignment and structure
>pdb|2BM1|A Chain A, Ribosomal Elongation Factor G (Ef-G) Fusidic Acid Resistant Mutant G16v Length = 691 Back     alignment and structure
>pdb|3SJZ|A Chain A, The Structure Of Aif2gamma Subunit Delta 41-45 From Archaeon Sulfolobus Solfataricus Complexed With Gdp And Gdpnp Length = 409 Back     alignment and structure
>pdb|2BM0|A Chain A, Ribosomal Elongation Factor G (Ef-G) Fusidic Acid Resistant Mutant T84a Length = 691 Back     alignment and structure
>pdb|2AHO|A Chain A, Structure Of The Archaeal Initiation Factor Eif2 Alpha- Gamma Heterodimer From Sulfolobus Solfataricus Complexed With Gdpnp Length = 414 Back     alignment and structure
>pdb|2PMD|A Chain A, The Structures Of Aif2gamma Subunit From The Archaeon Sulfolobus Solfataricus In The Gdp-Bound Form. Length = 415 Back     alignment and structure
>pdb|2BV3|A Chain A, Crystal Structure Of A Mutant Elongation Factor G Trapped With A Gtp Analogue Length = 691 Back     alignment and structure
>pdb|2J7K|A Chain A, Crystal Structure Of The T84a Mutant Ef-G:gdpcp Complex Length = 691 Back     alignment and structure
>pdb|2ELF|A Chain A, Crystal Structure Of The Selb-Like Elongation Factor Ef-Pyl From Methanosarcina Mazei Length = 370 Back     alignment and structure
>pdb|1EFG|A Chain A, The Crystal Structure Of Elongation Factor G Complexed With Gdp, At 2.7 Angstroms Resolution Length = 691 Back     alignment and structure
>pdb|1KTV|A Chain A, Crystal Structure Of Elongation Factor G Dimer Without Nucleotide Length = 691 Back     alignment and structure
>pdb|1FNM|A Chain A, Structure Of Thermus Thermophilus Ef-G H573a Length = 691 Back     alignment and structure
>pdb|3IZP|E Chain E, Conformation Of Ef-G During Translocation Length = 688 Back     alignment and structure
>pdb|3VQT|A Chain A, Crystal Structure Analysis Of The Translation Factor Rf3 Length = 548 Back     alignment and structure
>pdb|3UOQ|W Chain W, Crystal Structure Of Release Factor Rf3 Trapped In The Gtp State On A Rotated Conformation Of The Ribosome (Without Viomycin) Length = 534 Back     alignment and structure
>pdb|2H5E|A Chain A, Crystal Structure Of E.Coli Polypeptide Release Factor Rf3 Length = 529 Back     alignment and structure
>pdb|3ZZ0|A Chain A, Crystal Structure Of Ribosomal Elongation Factor (Ef)-G From Staphylococcus Aureus With A Fusidic Acid Hyper-Sensitivity Mutation M16i Length = 693 Back     alignment and structure
>pdb|1U2R|A Chain A, Crystal Structure Of Adp-Ribosylated Ribosomal Translocase From Saccharomyces Cerevisiae Length = 842 Back     alignment and structure
>pdb|1N0V|C Chain C, Crystal Structure Of Elongation Factor 2 Length = 842 Back     alignment and structure
>pdb|2XEX|A Chain A, Crystal Structure Of Staphylococcus Aureus Elongation Factor G Length = 693 Back     alignment and structure
>pdb|4FN5|A Chain A, Elongation Factor G 1 (Pseudomonas Aeruginosa) In Complex With Argyrin B Length = 709 Back     alignment and structure
>pdb|3ZZU|A Chain A, Crystal Structure Of Staphylococcus Aureus Elongation Factor G With Mutations M16i And F88l Length = 693 Back     alignment and structure
>pdb|3TR5|A Chain A, Structure Of A Peptide Chain Release Factor 3 (Prfc) From Coxiella Burnetii Length = 528 Back     alignment and structure
>pdb|3ZZT|A Chain A, Crystal Structure Of Staphylococcus Aureus Elongation Factor G With A Fusidic-Acid-Resistant Mutation F88l Length = 693 Back     alignment and structure
>pdb|3J0E|H Chain H, Models For The T. Thermophilus Ribosome Recycling Factor And The E. Coli Elongation Factor G Bound To The E. Coli Post-Termination Complex Length = 702 Back     alignment and structure
>pdb|2RDO|7 Chain 7, 50s Subunit With Ef-G(Gdpnp) And Rrf Bound Length = 704 Back     alignment and structure
>pdb|1WDT|A Chain A, Crystal Structure Of Ttk003000868 From Thermus Thermophilus Hb8 Length = 665 Back     alignment and structure
>pdb|3IZY|P Chain P, Mammalian Mitochondrial Translation Initiation Factor 2 Length = 537 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query459
1f60_A458 Elongation factor EEF1A; protein-protein complex, 0.0
1jny_A435 EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- 0.0
3p26_A483 Elongation factor 1 alpha-like protein; GTP/GDP bi 0.0
3izq_1611 HBS1P, elongation factor 1 alpha-like protein; NO- 0.0
1r5b_A467 Eukaryotic peptide chain release factor GTP-bindi 0.0
3mca_A592 HBS1, elongation factor 1 alpha-like protein; prot 0.0
3e1y_E204 Eukaryotic peptide chain release factor GTP-bindi 1e-138
1zun_B434 Sulfate adenylate transferase, subunit 1/adenylyls 1e-108
2elf_A370 Protein translation elongation factor 1A; tRNA, py 9e-72
1wb1_A482 Translation elongation factor SELB; selenocysteine 2e-70
1d2e_A397 Elongation factor TU (EF-TU); G-protein, beta-barr 6e-61
2c78_A405 Elongation factor TU-A; hydrolase, GTPase, transla 4e-59
3avx_A 1289 Elongation factor TS, elongation factor TU, linke 1e-58
1s0u_A408 EIF-2-gamma, translation initiation factor 2 gamma 1e-48
3sjy_A403 Translation initiation factor 2 subunit gamma; zin 2e-47
1kk1_A410 EIF2gamma; initiation of translation; HET: GNP; 1. 4e-47
1xe1_A116 Hypothetical protein PF0907; structural genomics, 4e-42
2ywe_A 600 GTP-binding protein LEPA; G domain, beta-barrel, f 3e-18
3cb4_D 599 GTP-binding protein LEPA; GTPase, OB-fold, membran 7e-18
1n0u_A 842 EF-2, elongation factor 2; G-protein, CIS-proline, 7e-16
2dy1_A 665 Elongation factor G; translocation, GTP complex, s 4e-09
3tr5_A528 RF-3, peptide chain release factor 3; protein synt 1e-08
2h5e_A529 Peptide chain release factor RF-3; beta barrel, tr 2e-08
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 1e-07
2rdo_7 704 EF-G, elongation factor G; elongation factor G, EF 3e-06
1dar_A 691 EF-G, elongation factor G; ribosomal translocase, 6e-06
2xex_A 693 Elongation factor G; GTPase, translation, biosynth 6e-06
1g7s_A 594 Translation initiation factor IF2/EIF5B; translati 9e-05
2j69_A 695 Bacterial dynamin-like protein; FZO, FZL, GTPase, 2e-04
3llu_A196 RAS-related GTP-binding protein C; structural geno 5e-04
1zo1_I501 IF2, translation initiation factor 2; E. coli, rib 6e-04
>1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A Length = 458 Back     alignment and structure
 Score =  892 bits (2307), Expect = 0.0
 Identities = 350/439 (79%), Positives = 388/439 (88%), Gaps = 2/439 (0%)

Query: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60
           MGKEK+HIN+VVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA E+GKGSFKYAWVL
Sbjct: 1   MGKEKSHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVL 60

Query: 61  DKLKAERERGITIDIALWKFETSKFYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 120
           DKLKAERERGITIDIALWKFET K+ VT+IDAPGHRDFIKNMITGTSQADCA+LI+A G 
Sbjct: 61  DKLKAERERGITIDIALWKFETPKYQVTVIDAPGHRDFIKNMITGTSQADCAILIIAGGV 120

Query: 121 GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEARFEEIKKEVSGYIKK 180
           GEFEAGISK+GQTREHALLAFTLGV+QLIV VNKMDS +  + E+RF+EI KE S +IKK
Sbjct: 121 GEFEAGISKDGQTREHALLAFTLGVRQLIVAVNKMDSVK--WDESRFQEIVKETSNFIKK 178

Query: 181 IGYNPATVAFVPISGWHGDNMLEVSDKMPWFKGWAIERKEGKADGKCLIEALDAILPPSR 240
           +GYNP TV FVPISGW+GDNM+E +   PW+KGW  E K G   GK L+EA+DAI  PSR
Sbjct: 179 VGYNPKTVPFVPISGWNGDNMIEATTNAPWYKGWEKETKAGVVKGKTLLEAIDAIEQPSR 238

Query: 241 PTEKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMLVTFAPANLTTEVKSVEMHHEALQ 300
           PT+KPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGM+VTFAPA +TTEVKSVEMHHE L+
Sbjct: 239 PTDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFAPAGVTTEVKSVEMHHEQLE 298

Query: 301 EAVPGDNVGFNVKNVSVKELRRGFVAGDSKASPPKATQDFTAQVIVLNHPGQISNGYTPV 360
           + VPGDNVGFNVKNVSVKE+RRG V GD+K  PPK    F A VIVLNHPGQIS GY+PV
Sbjct: 299 QGVPGDNVGFNVKNVSVKEIRRGNVCGDAKNDPPKGCASFNATVIVLNHPGQISAGYSPV 358

Query: 361 LDCHTAHIACKFAEIKEKCDRRTGKTTEENPKALKSGDAAIIVLVPSKPMCVESFSEFPP 420
           LDCHTAHIAC+F E+ EK DRR+GK  E++PK LKSGDAA++  VPSKPMCVE+FSE+PP
Sbjct: 359 LDCHTAHIACRFDELLEKNDRRSGKKLEDHPKFLKSGDAALVKFVPSKPMCVEAFSEYPP 418

Query: 421 LGRFAVRDMRQTVAVGVIK 439
           LGRFAVRDMRQTVAVGVIK
Sbjct: 419 LGRFAVRDMRQTVAVGVIK 437


>1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* Length = 435 Back     alignment and structure
>3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* Length = 483 Back     alignment and structure
>3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} Length = 611 Back     alignment and structure
>1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A Length = 467 Back     alignment and structure
>3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Length = 592 Back     alignment and structure
>3e1y_E Eukaryotic peptide chain release factor GTP-bindi ERF3A; translation termination, peptide release, PTC, P biosynthesis, GTP-binding; HET: ATP; 3.80A {Homo sapiens} Length = 204 Back     alignment and structure
>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Length = 434 Back     alignment and structure
>2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} Length = 370 Back     alignment and structure
>1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* Length = 482 Back     alignment and structure
>1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* Length = 397 Back     alignment and structure
>2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... Length = 405 Back     alignment and structure
>3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B Length = 1289 Back     alignment and structure
>1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Length = 408 Back     alignment and structure
>3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* Length = 403 Back     alignment and structure
>1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* Length = 410 Back     alignment and structure
>1xe1_A Hypothetical protein PF0907; structural genomics, unknown function, protein structure INI secsg, conserved hypothetical protein; HET: MSE; 2.00A {Pyrococcus furiosus} SCOP: b.43.3.1 Length = 116 Back     alignment and structure
>2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* Length = 600 Back     alignment and structure
>3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* Length = 599 Back     alignment and structure
>1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* Length = 842 Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Length = 665 Back     alignment and structure
>3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} Length = 528 Back     alignment and structure
>2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* Length = 529 Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Length = 178 Back     alignment and structure
>2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H Length = 704 Back     alignment and structure
>1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... Length = 691 Back     alignment and structure
>2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} Length = 693 Back     alignment and structure
>1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* Length = 594 Back     alignment and structure
>2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* Length = 695 Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Length = 196 Back     alignment and structure
>1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} Length = 501 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query459
3j2k_7439 ERF3, eukaryotic polypeptide chain release factor 100.0
1f60_A458 Elongation factor EEF1A; protein-protein complex, 100.0
1jny_A435 EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- 100.0
3p26_A483 Elongation factor 1 alpha-like protein; GTP/GDP bi 100.0
1r5b_A467 Eukaryotic peptide chain release factor GTP-bindi 100.0
3izq_1611 HBS1P, elongation factor 1 alpha-like protein; NO- 100.0
3mca_A592 HBS1, elongation factor 1 alpha-like protein; prot 100.0
1zun_B434 Sulfate adenylate transferase, subunit 1/adenylyls 100.0
1d2e_A397 Elongation factor TU (EF-TU); G-protein, beta-barr 100.0
2c78_A405 Elongation factor TU-A; hydrolase, GTPase, transla 100.0
3avx_A 1289 Elongation factor TS, elongation factor TU, linke 100.0
1wb1_A482 Translation elongation factor SELB; selenocysteine 100.0
2elf_A370 Protein translation elongation factor 1A; tRNA, py 100.0
1kk1_A410 EIF2gamma; initiation of translation; HET: GNP; 1. 100.0
1s0u_A408 EIF-2-gamma, translation initiation factor 2 gamma 100.0
3sjy_A403 Translation initiation factor 2 subunit gamma; zin 100.0
3e1y_E204 Eukaryotic peptide chain release factor GTP-bindi 100.0
3vqt_A548 RF-3, peptide chain release factor 3; translation, 100.0
2ywe_A 600 GTP-binding protein LEPA; G domain, beta-barrel, f 100.0
3cb4_D 599 GTP-binding protein LEPA; GTPase, OB-fold, membran 100.0
3tr5_A528 RF-3, peptide chain release factor 3; protein synt 100.0
4fn5_A 709 EF-G 1, elongation factor G 1; translation, transl 100.0
2h5e_A529 Peptide chain release factor RF-3; beta barrel, tr 100.0
3j25_A 638 Tetracycline resistance protein TETM; antibiotic r 100.0
2rdo_7 704 EF-G, elongation factor G; elongation factor G, EF 100.0
1dar_A 691 EF-G, elongation factor G; ribosomal translocase, 100.0
2xex_A 693 Elongation factor G; GTPase, translation, biosynth 100.0
2dy1_A 665 Elongation factor G; translocation, GTP complex, s 100.0
1zo1_I 501 IF2, translation initiation factor 2; E. coli, rib 100.0
3izy_P 537 Translation initiation factor IF-2, mitochondrial; 100.0
1g7s_A 594 Translation initiation factor IF2/EIF5B; translati 100.0
1n0u_A 842 EF-2, elongation factor 2; G-protein, CIS-proline, 99.97
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 99.84
1wf3_A301 GTP-binding protein; GTPase, riken structural geno 99.82
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 99.81
3iev_A308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 99.81
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 99.8
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 99.8
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 99.8
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 99.8
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 99.8
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 99.8
2hjg_A436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 99.8
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 99.8
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 99.8
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 99.8
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 99.79
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 99.79
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 99.79
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 99.79
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 99.79
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 99.79
4dcu_A456 GTP-binding protein ENGA; GTPase, GDP, protein bin 99.79
3i8s_A274 Ferrous iron transport protein B; GTPase, GPCR, ir 99.78
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 99.78
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 99.78
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 99.78
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 99.78
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 99.78
2fh5_B214 SR-beta, signal recognition particle receptor beta 99.78
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 99.78
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 99.77
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 99.77
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 99.77
3t1o_A198 Gliding protein MGLA; G domain containing protein, 99.77
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 99.77
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 99.77
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 99.77
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 99.77
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 99.77
3iby_A256 Ferrous iron transport protein B; G protein, G dom 99.77
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 99.77
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 99.77
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 99.77
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 99.76
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 99.76
3llu_A196 RAS-related GTP-binding protein C; structural geno 99.76
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 99.76
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 99.76
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 99.76
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 99.76
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 99.76
3a1s_A258 Iron(II) transport protein B; FEOB, iron transport 99.76
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 99.76
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 99.76
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 99.76
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 99.76
3qq5_A423 Small GTP-binding protein; hydrogenase, H-cluster, 99.76
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 99.76
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 99.76
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 99.76
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 99.76
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 99.75
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 99.75
2wji_A165 Ferrous iron transport protein B homolog; membrane 99.75
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 99.75
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 99.75
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 99.75
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 99.75
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 99.75
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 99.75
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 99.75
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 99.75
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 99.75
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 99.75
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 99.75
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 99.75
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 99.75
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 99.74
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 99.74
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 99.74
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 99.74
3o47_A329 ADP-ribosylation factor GTPase-activating protein 99.74
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 99.74
4dkx_A216 RAS-related protein RAB-6A; GTP binding fold, memb 99.74
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 99.73
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 99.73
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 99.73
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 99.73
2hjg_A436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 99.73
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 99.73
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 99.73
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 99.73
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 99.73
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 99.73
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 99.72
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 99.72
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 99.72
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 99.72
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 99.72
3r7w_A307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 99.72
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 99.72
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 99.72
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 99.72
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 99.72
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 99.72
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 99.71
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 99.71
2xtp_A260 GTPase IMAP family member 2; immune system, G prot 99.71
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 99.71
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 99.7
3b1v_A272 Ferrous iron uptake transporter protein B; G prote 99.7
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 99.7
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.69
3lxw_A247 GTPase IMAP family member 1; immunity, structural 99.69
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 99.69
4dcu_A456 GTP-binding protein ENGA; GTPase, GDP, protein bin 99.68
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 99.68
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 99.68
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 99.68
3t5d_A274 Septin-7; GTP-binding protein, cytoskeleton, signa 99.68
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 99.68
3gee_A476 MNME, tRNA modification GTPase MNME; G protein, cy 99.67
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 99.67
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 99.67
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 99.67
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 99.66
1xzp_A482 Probable tRNA modification GTPase TRME; GTP-bindin 99.65
3th5_A204 RAS-related C3 botulinum toxin substrate 1; rossma 99.46
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 99.64
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 99.64
1nrj_B218 SR-beta, signal recognition particle receptor beta 99.63
3geh_A462 MNME, tRNA modification GTPase MNME; G protein, U3 99.62
3lxx_A239 GTPase IMAP family member 4; structural genomics c 99.62
1lnz_A342 SPO0B-associated GTP-binding protein; GTPase, OBG, 99.62
2wkq_A332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 99.61
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 99.61
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 99.61
1h65_A270 Chloroplast outer envelope protein OEP34; GTPase, 99.61
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 99.59
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 99.58
3r7w_B331 Gtpase2, GTP-binding protein GTR2; RAG gtpases, GT 99.57
3dpu_A535 RAB family protein; roccor, G-domain, COR, GTP-bin 99.56
2aka_B299 Dynamin-1; fusion protein, GTPase domain, myosin, 99.56
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 99.55
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 99.53
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 99.53
1jwy_B315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 99.51
2ged_A193 SR-beta, signal recognition particle receptor beta 99.51
2qag_A361 Septin-2, protein NEDD5; cell cycle, cell division 99.48
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 99.47
3c5h_A255 Glucocorticoid receptor DNA-binding factor 1; RAS, 99.46
2j69_A 695 Bacterial dynamin-like protein; FZO, FZL, GTPase, 99.46
1wxq_A397 GTP-binding protein; structural genomics, riken st 99.45
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 99.44
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 99.41
2www_A349 Methylmalonic aciduria type A protein, mitochondri 99.38
2qpt_A550 EH domain-containing protein-2; protein-nucleotide 99.36
1udx_A416 The GTP-binding protein OBG; TGS domain, riken str 99.36
2x2e_A353 Dynamin-1; nitration, hydrolase, membrane fission, 99.33
3zvr_A 772 Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito 99.31
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 99.3
3t34_A360 Dynamin-related protein 1A, linker, dynamin-relat 99.28
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 99.25
1xe1_A116 Hypothetical protein PF0907; structural genomics, 99.21
2qag_C418 Septin-7; cell cycle, cell division, GTP-binding, 99.12
4a9a_A376 Ribosome-interacting GTPase 1; DRG-DFRP complex, r 99.1
1jal_A363 YCHF protein; nucleotide-binding fold, structural 99.07
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 99.06
4fid_A340 G protein alpha subunit; RAS-like domain, all-heli 99.06
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 99.03
2j37_W504 Signal recognition particle 54 kDa protein (SRP54) 99.0
3ohm_A327 Guanine nucleotide-binding protein G(Q) subunit A; 98.97
2dby_A368 GTP-binding protein; GDP, structural genomics, NPP 98.91
2xtz_A354 Guanine nucleotide-binding protein alpha-1 subuni; 98.9
1cip_A353 Protein (guanine nucleotide-binding protein alpha- 98.87
2hf9_A226 Probable hydrogenase nickel incorporation protein 98.79
2ohf_A396 Protein OLA1, GTP-binding protein 9; ATPase, GTPas 98.73
1zcb_A362 G alpha I/13; GTP-binding, lipoprotein, membrane, 98.71
2qag_B427 Septin-6, protein NEDD5; cell cycle, cell division 98.7
3ec1_A369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 98.61
3h2y_A368 GTPase family protein; GTP-binding protein YQEH, p 98.6
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 98.57
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 98.57
1tq4_A413 IIGP1, interferon-inducible GTPase; interferon gam 98.56
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 98.53
1azs_C402 GS-alpha; complex (lyase/hydrolase), hydrolase, si 98.53
1ni3_A392 YCHF GTPase, YCHF GTP-binding protein; structural 98.43
1puj_A282 YLQF, conserved hypothetical protein YLQF; structu 98.37
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 98.34
3l82_B227 F-box only protein 4; TRFH domain, helix, GTPase d 98.32
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 98.19
2xxa_A433 Signal recognition particle protein; protein trans 98.19
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 98.19
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 98.08
1d1n_A99 Initiation factor 2; beta-barrel, gene regulation; 98.07
1f5n_A 592 Interferon-induced guanylate-binding protein 1; GB 98.04
2crv_A120 IF-2MT, translation initiation factor IF-2; riboso 98.02
3cnl_A262 YLQF, putative uncharacterized protein; circular p 98.01
1puj_A282 YLQF, conserved hypothetical protein YLQF; structu 97.94
3ec1_A369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 97.93
3h2y_A368 GTPase family protein; GTP-binding protein YQEH, p 97.91
3l2o_B312 F-box only protein 4; small G protein fold, UBL co 97.83
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 97.75
1zo1_I501 IF2, translation initiation factor 2; E. coli, rib 97.63
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 97.6
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 97.6
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, 97.55
3cnl_A262 YLQF, putative uncharacterized protein; circular p 97.54
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 97.49
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 97.47
3szr_A 608 Interferon-induced GTP-binding protein MX1; interf 97.44
4dzz_A206 Plasmid partitioning protein PARF; deviant walker 97.39
1vma_A306 Cell division protein FTSY; TM0570, structural gen 97.34
3izy_P537 Translation initiation factor IF-2, mitochondrial; 97.28
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 97.13
3q5d_A447 Atlastin-1; G protein, GTPase, GDP/GTP binding, hy 96.97
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 96.97
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 96.91
1g7s_A594 Translation initiation factor IF2/EIF5B; translati 96.75
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 96.72
2og2_A359 Putative signal recognition particle receptor; nuc 96.67
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 96.02
3end_A307 Light-independent protochlorophyllide reductase ir 95.82
3k9g_A267 PF-32 protein; ssgcid, SBRI, decode biostructures, 95.79
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 95.64
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 95.57
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 95.53
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 95.32
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 95.18
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 95.06
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 95.02
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 94.98
1kag_A173 SKI, shikimate kinase I; transferase, structural g 94.97
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 94.95
1bif_A469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 94.94
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 94.87
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 94.87
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 94.86
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 94.78
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 94.71
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 94.62
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 94.59
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 94.56
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 94.56
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 94.53
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 94.48
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 94.47
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 94.46
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 94.45
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 94.45
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 94.44
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 94.41
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 94.38
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 94.34
4ido_A457 Atlastin-1; GTPase, GTP/GDP binding, hydrolase; HE 94.32
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 94.28
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 94.27
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 94.24
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 94.23
3tlx_A243 Adenylate kinase 2; structural genomics, structura 94.17
3vaa_A199 Shikimate kinase, SK; structural genomics, center 94.16
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 94.13
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 94.1
1hyq_A263 MIND, cell division inhibitor (MIND-1); MINC, FTSZ 94.09
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 94.08
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 94.0
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 93.99
2ph1_A262 Nucleotide-binding protein; alpha-beta protein, st 93.98
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 93.98
3ug7_A349 Arsenical pump-driving ATPase; tail-anchored, memb 93.97
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 93.97
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 93.95
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 93.91
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 93.9
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 93.89
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 93.89
3kjh_A254 CO dehydrogenase/acetyl-COA synthase complex, acce 93.88
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 93.88
1g3q_A237 MIND ATPase, cell division inhibitor; alpha-beta-a 93.88
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 93.85
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 93.82
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 93.8
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 93.76
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 93.72
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 93.72
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 93.7
2vli_A183 Antibiotic resistance protein; transferase, tunica 93.68
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 93.67
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 93.67
1via_A175 Shikimate kinase; structural genomics, transferase 93.66
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 93.63
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 93.63
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 93.59
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 93.59
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 93.56
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 93.54
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 93.45
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 93.44
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 93.43
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 93.42
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 93.41
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 93.4
2eyu_A261 Twitching motility protein PILT; pilus retraction 93.39
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 93.38
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 93.37
1xjc_A169 MOBB protein homolog; structural genomics, midwest 93.32
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 93.28
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 93.27
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 93.27
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 93.22
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 93.21
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 93.2
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 93.19
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 93.16
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 93.14
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 93.13
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 93.11
1sgw_A214 Putative ABC transporter; structural genomics, P p 93.1
1g6h_A257 High-affinity branched-chain amino acid transport 93.1
1b0u_A262 Histidine permease; ABC transporter, transport pro 93.05
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 93.05
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 93.04
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 93.01
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 93.0
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 92.99
1ji0_A240 ABC transporter; ATP binding protein, structural g 92.98
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 92.98
2ghi_A260 Transport protein; multidrug resistance protein, M 92.98
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 92.92
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 92.91
3r20_A233 Cytidylate kinase; structural genomics, seattle st 92.86
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 92.85
1wcv_1257 SOJ, segregation protein; ATPase, bacterial, chrom 92.81
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 92.81
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 92.8
4a74_A231 DNA repair and recombination protein RADA; hydrola 92.78
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 92.78
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 92.75
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 92.73
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 92.71
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 92.68
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 92.67
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 92.65
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 92.6
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 92.58
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 92.58
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 92.57
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 92.53
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 92.49
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 92.47
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 92.39
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 92.34
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 92.29
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 92.28
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 92.22
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 92.21
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 92.19
3la6_A286 Tyrosine-protein kinase WZC; P-loop protein, nucle 92.18
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 92.18
1nij_A318 Hypothetical protein YJIA; structural genomics, P- 92.1
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 92.1
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 92.1
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 92.1
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 92.08
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 92.06
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 92.03
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 91.99
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 91.97
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 91.91
3kta_A182 Chromosome segregation protein SMC; structural mai 91.91
3cwq_A209 Para family chromosome partitioning protein; alpha 91.89
3d3q_A340 TRNA delta(2)-isopentenylpyrophosphate transferase 91.88
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 91.88
2kjq_A149 DNAA-related protein; solution structure, NESG, st 91.84
2ewv_A372 Twitching motility protein PILT; pilus retraction 91.82
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 91.8
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 91.79
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 91.73
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 91.67
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 91.67
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 91.57
3bfv_A271 CAPA1, CAPB2, membrane protein CAPA1, protein tyro 91.55
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 91.53
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 91.45
2oap_1511 GSPE-2, type II secretion system protein; hexameri 91.31
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 91.22
2oze_A298 ORF delta'; para, walker type atpases, DNA segrega 91.16
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 91.13
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 91.04
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 90.98
3rlf_A381 Maltose/maltodextrin import ATP-binding protein M; 90.97
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 90.95
1p9r_A418 General secretion pathway protein E; bacterial typ 90.86
1g29_1372 MALK, maltose transport protein MALK; ATPase, acti 90.83
3gmt_A230 Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle 90.83
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 90.77
3ea0_A245 ATPase, para family; alpha-beta-alpha sandwich, st 90.76
3cio_A299 ETK, tyrosine-protein kinase ETK; WZC, escherichia 90.53
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 90.37
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 90.3
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 90.27
3gd7_A390 Fusion complex of cystic fibrosis transmembrane co 90.25
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 90.21
2npi_A460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 90.15
2h92_A219 Cytidylate kinase; rossmann fold, transferase; HET 90.06
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 90.0
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 89.87
1a7j_A290 Phosphoribulokinase; transferase, calvin cycle; 2. 89.84
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 89.72
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 89.56
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 89.54
1ihu_A589 Arsenical pump-driving ATPase; aluminum fluoride, 89.41
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 89.4
1zcb_A362 G alpha I/13; GTP-binding, lipoprotein, membrane, 89.32
2obl_A347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 89.29
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 89.25
2cvh_A220 DNA repair and recombination protein RADB; filamen 89.18
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 89.04
3q9l_A260 Septum site-determining protein MIND; ATPase, bact 89.03
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 88.99
1p5z_B263 DCK, deoxycytidine kinase; nucleoside kinase, P-lo 88.92
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 88.84
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 88.74
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 88.71
3qf7_A365 RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. 88.7
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 88.54
2xj4_A286 MIPZ; replication, cell division, ATPase, WACA; 1. 88.54
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 88.48
3euj_A483 Chromosome partition protein MUKB, linker; MUKB, M 88.4
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 88.2
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 88.18
3fgn_A251 Dethiobiotin synthetase; biotin biosynthesis, BIOD 87.95
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 87.95
2dpy_A438 FLII, flagellum-specific ATP synthase; beta barrel 87.92
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 87.84
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 87.71
3io5_A333 Recombination and repair protein; storage dimer, i 87.55
3tqf_A181 HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co 87.45
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 87.45
3lv8_A236 DTMP kinase, thymidylate kinase; structural genomi 87.43
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 87.43
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 87.42
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 87.38
2ocp_A241 DGK, deoxyguanosine kinase; protein-nucleotide com 87.37
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 87.34
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 87.21
3bos_A242 Putative DNA replication factor; P-loop containing 87.15
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 87.06
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 86.96
1byi_A224 Dethiobiotin synthase; biotin synthesis, cyclo-lig 86.75
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 86.63
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 86.6
1xp8_A366 RECA protein, recombinase A; recombination, radior 86.59
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 86.58
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 86.43
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 86.27
1tue_A212 Replication protein E1; helicase, replication, E1E 86.26
3qks_A203 DNA double-strand break repair RAD50 ATPase; RECA- 86.12
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 86.12
2ga8_A359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 86.06
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 86.01
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 85.7
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 85.69
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 85.67
3eph_A409 TRNA isopentenyltransferase; transferase, alternat 85.6
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 85.46
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 85.46
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 85.22
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 85.01
>3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus} Back     alignment and structure
Probab=100.00  E-value=5.3e-84  Score=657.10  Aligned_cols=424  Identities=39%  Similarity=0.688  Sum_probs=404.6

Q ss_pred             CCceeEEEEEecCCCChHHHHhHHHHhcCCCChHHHHHHHHHHHHhCCCcceeeeeccCchhHHhcCceEEeeeeEEeeC
Q psy13961          4 EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETS   83 (459)
Q Consensus         4 ~k~~~~v~v~G~~~~GKSTLi~~Ll~~~~~i~~~~~~~~~~~~~~~g~~~~~~~~~~d~~~~e~~~g~Ti~~~~~~~~~~   83 (459)
                      .++++||+++||+|+|||||+++|++.++.+..+.++++.+++.+.|++++.++|++|..++|+++|+|++..+..+++.
T Consensus        14 ~k~~~~i~iiG~~d~GKSTL~~~Ll~~~~~i~~~~~~~~~~~~~~~g~~~~~~a~~~d~~~~er~~GiTid~~~~~~~~~   93 (439)
T 3j2k_7           14 KKEHVNVVFIGHVDAGKSTIGGQIMYLTGMVDKRTLEKYEREAKEKNRETWYLSWALDTNQEERDKGKTVEVGRAYFETE   93 (439)
T ss_pred             CCceeEEEEEeCCCCCHHHHHHHHHHHcCCCchHHHHHHHHHHHhccccchhhhhhhccchhHhhcCceEEEeEEEEecC
Confidence            56789999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CEEEEEEeCCCccchHhHHHHhhcccCEEEEEEECCCCceeccccCCCchHHHHHHHHHcCCceEEEEEEccCCCCCCCc
Q psy13961         84 KFYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYS  163 (459)
Q Consensus        84 ~~~~~liDtpG~~~~~~~~~~~~~~aD~~ilVvda~~g~~~~~~~~~~qt~e~~~~~~~~~ip~iivviNK~D~~~~~~~  163 (459)
                      ++.++|||||||++|.++|..+++.+|++||||||++|.++.+++..+|+++|+.++..+++|++|+|+||||++..+|+
T Consensus        94 ~~~~~iiDTPGh~~f~~~~~~~~~~aD~~ilVVDa~~g~~e~~~~~~~qt~e~l~~~~~~~v~~iIvviNK~Dl~~~~~~  173 (439)
T 3j2k_7           94 KKHFTILDAPGHKSFVPNMIGGASQADLAVLVISARKGEFETGFEKGGQTREHAMLAKTAGVKHLIVLINKMDDPTVNWS  173 (439)
T ss_pred             CeEEEEEECCChHHHHHHHHhhHhhCCEEEEEEECCCCccccccCCCchHHHHHHHHHHcCCCeEEEEeecCCCcccchH
Confidence            99999999999999999999999999999999999999988888877899999999999999989999999999877799


Q ss_pred             HHHHHHHHHHHHhhhhhcCcCCc-eeeEeecCCCCCCccccccCCCCCccccccccccCCCChhhHHHhccccCCCCCCC
Q psy13961        164 EARFEEIKKEVSGYIKKIGYNPA-TVAFVPISGWHGDNMLEVSDKMPWFKGWAIERKEGKADGKCLIEALDAILPPSRPT  242 (459)
Q Consensus       164 ~~~~~~i~~~l~~~l~~~g~~~~-~~~~i~iSa~~g~~i~~~~~~~~w~~~~~~~~~~~~~~g~~Ll~~l~~~~~~~~~~  242 (459)
                      +.+++++.+++..+++.+|+.+. +++++|+||++|+|+.+....++||.|            ..|++.|+.+.++.+..
T Consensus       174 ~~~~~~i~~~~~~~l~~~g~~~~~~~~~i~iSA~~G~ni~~l~~~~~w~~g------------~~L~~~l~~i~~~~~~~  241 (439)
T 3j2k_7          174 NERYEECKEKLVPFLKKVGFNPKKDIHFMPCSGLTGANLKEQSDFCPWYIG------------LPFIPYLDNLPNFNRSV  241 (439)
T ss_pred             HHHHHHHHHHHHHHHHHhcccccCCeeEEEeeccCCcccccccccccccCc------------hHHHHHHHhCCCCccCC
Confidence            99999999999999999998653 588999999999999999999999975            88999999988887888


Q ss_pred             CCCeeEEeEEEEEeCCceeEEEEEEEeeeEecCCeEEEecCCeEEEEEEEEeccccceeEcCCCeEEEEEccCcccCcce
Q psy13961        243 EKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMLVTFAPANLTTEVKSVEMHHEALQEAVPGDNVGFNVKNVSVKELRR  322 (459)
Q Consensus       243 ~~p~~~~i~~v~~~~~~G~v~~G~v~sG~l~~gd~v~~~p~~~~~~V~~I~~~~~~v~~a~aGd~v~l~l~~~~~~~i~~  322 (459)
                      ++|++|+|+++|+  +.|++++|+|.+|+|++||.|.++|++.+++|++|++++.++++|.|||+|+++|+|++..++++
T Consensus       242 ~~p~r~~v~~~~~--~~G~v~~G~v~~G~l~~Gd~v~~~p~~~~~~V~~i~~~~~~~~~a~aG~~v~~~l~gi~~~~i~r  319 (439)
T 3j2k_7          242 DGPIRLPIVDKYK--DMGTVVLGKLESGSIFKGQQLVMMPNKHNVEVLGILSDDTETDFVAPGENLKIRLKGIEEEEILP  319 (439)
T ss_pred             CCCeEEEEEEEEc--CCCeEEEEEEEeeEEecCCEEEEccCCceEEEEEEEECCeEcCEecCCCcceEEEeccchhhcCC
Confidence            9999999999987  78999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eEEEccCCCCCCcccceEEEEEEEecCCCCCCCCCeeEEeeeeeeEEEEEEEEeeeecCCCCcccccCccccCCCCEEEE
Q psy13961        323 GFVAGDSKASPPKATQDFTAQVIVLNHPGQISNGYTPVLDCHTAHIACKFAEIKEKCDRRTGKTTEENPKALKSGDAAII  402 (459)
Q Consensus       323 G~vl~~~~~~~~~~~~~f~a~i~~l~~~~~i~~g~~~~~~~~~~~~~~~i~~i~~~~~~~~~~~~~~~~~~l~~g~~~~v  402 (459)
                      |||||+++. ++..+++|+|+|.||+++.+|.+||+|++|||+.+++|+|..|.+++|.+||+..+.+|++|+.||.+.|
T Consensus       320 G~vl~~~~~-~~~~~~~f~a~v~~l~~~~~i~~g~~~~~~~~t~~~~~~i~~i~~~~d~~t~~~~~~~~~~l~~~~~~~v  398 (439)
T 3j2k_7          320 GFILCDPSN-LCHSGRTFDVQIVIIEHKSIICPGYNAVLHIHTCIEEVEITALISLVDKKSGEKSKTRPRFVKQDQVCIA  398 (439)
T ss_pred             cEEecCCCC-CCceeeEEEEEEEEeCCCCcCCCCCEEEEEEeceEEEEEEEEEEEeecCCchhhhccCcceecCCcEEEE
Confidence            999999875 6677899999999999988899999999999999999999999999999999988889999999999999


Q ss_pred             EEEeCCeEEeeecCCCCCcceEEEEECCceEEEEEEEeec
Q psy13961        403 VLVPSKPMCVESFSEFPPLGRFAVRDMRQTVAVGVIKVNN  442 (459)
Q Consensus       403 ~l~l~~~i~~~~~~~~~~~grfilrd~~~tva~G~V~~v~  442 (459)
                      +|++.+|+|+|+|++|+.+|||+|||+++|+|+|+|++|.
T Consensus       399 ~~~~~~p~~~e~~~~~~~~g~f~l~d~~~tv~~G~i~~v~  438 (439)
T 3j2k_7          399 RLRTAGTICLETFKDFPQMGRFTLRDEGKTIAIGKVLKLV  438 (439)
T ss_pred             EEEeCCeEEEeeccccccCCCEEEEECCceEEEEEEEEec
Confidence            9999999999999999999999999999999999999875



>1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A Back     alignment and structure
>1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* Back     alignment and structure
>3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* Back     alignment and structure
>1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A Back     alignment and structure
>3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Back     alignment and structure
>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* Back     alignment and structure
>2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... Back     alignment and structure
>3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B Back     alignment and structure
>1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* Back     alignment and structure
>2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} Back     alignment and structure
>1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* Back     alignment and structure
>1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* Back     alignment and structure
>3e1y_E Eukaryotic peptide chain release factor GTP-bindi ERF3A; translation termination, peptide release, PTC, P biosynthesis, GTP-binding; HET: ATP; 3.80A {Homo sapiens} Back     alignment and structure
>3vqt_A RF-3, peptide chain release factor 3; translation, GTPase; HET: GDP; 1.80A {Desulfovibrio vulgaris} PDB: 3vr1_A* Back     alignment and structure
>2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* Back     alignment and structure
>3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* Back     alignment and structure
>3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} Back     alignment and structure
>4fn5_A EF-G 1, elongation factor G 1; translation, translation-antibiotic compl; HET: 0UO; 2.90A {Pseudomonas aeruginosa} Back     alignment and structure
>2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* Back     alignment and structure
>3j25_A Tetracycline resistance protein TETM; antibiotic resistance, translation; HET: GCP; 7.20A {Enterococcus faecalis} Back     alignment and structure
>2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H Back     alignment and structure
>1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... Back     alignment and structure
>2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Back     alignment and structure
>1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} Back     alignment and structure
>3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} Back     alignment and structure
>1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* Back     alignment and structure
>1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3r7w_B Gtpase2, GTP-binding protein GTR2; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_B* Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} Back     alignment and structure
>2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* Back     alignment and structure
>1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A Back     alignment and structure
>3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>1xe1_A Hypothetical protein PF0907; structural genomics, unknown function, protein structure INI secsg, conserved hypothetical protein; HET: MSE; 2.00A {Pyrococcus furiosus} SCOP: b.43.3.1 Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>4a9a_A Ribosome-interacting GTPase 1; DRG-DFRP complex, ribosome binding GTPase; 2.67A {Saccharomyces cerevisiae} Back     alignment and structure
>1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>4fid_A G protein alpha subunit; RAS-like domain, all-helical domain, GTP binding, nucleotide signaling protein, transducer, lipoprotein; HET: MLY MSE GDP; 2.62A {Entamoeba histolytica} Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>3ohm_A Guanine nucleotide-binding protein G(Q) subunit A; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Mus musculus} PDB: 2bcj_Q* 2rgn_A* 3ah8_A* Back     alignment and structure
>2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A Back     alignment and structure
>2xtz_A Guanine nucleotide-binding protein alpha-1 subuni; hydrolase, G-protein signaling, SELF-activation, RAS-like DO; HET: GSP; 2.34A {Arabidopsis thaliana} Back     alignment and structure
>1cip_A Protein (guanine nucleotide-binding protein alpha-1 subunit); GTPase, hydrolase; HET: GNP; 1.50A {Rattus norvegicus} SCOP: a.66.1.1 c.37.1.8 PDB: 1agr_A* 1bof_A* 1gdd_A* 1gfi_A* 1gia_A* 1gp2_A* 3ffa_A* 3ffb_A* 1gg2_A* 1git_A* 1svs_A* 1svk_A* 2zjz_A* 2zjy_A* 3ums_A* 2pz2_A* 2pz3_A* 1as0_A* 1as2_A* 1as3_A* ... Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} Back     alignment and structure
>1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>1azs_C GS-alpha; complex (lyase/hydrolase), hydrolase, signal transducing protein, cyclase, effector enzyme; HET: GSP FKP; 2.30A {Bos taurus} SCOP: a.66.1.1 c.37.1.8 PDB: 1azt_A* 3c14_C* 3c15_C* 3c16_C* 1cjt_C* 1cjk_C* 1cju_C* 1cjv_C* 1tl7_C* 1cs4_C* 1u0h_C* 2gvd_C* 2gvz_C* 3e8a_C* 3g82_C* 3maa_C* 1cul_C* 3sn6_A* Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>3l82_B F-box only protein 4; TRFH domain, helix, GTPase domain, acetylation, ADP- ribosylation, alternative splicing, cell cycle, cell division; 2.40A {Homo sapiens} Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>1d1n_A Initiation factor 2; beta-barrel, gene regulation; NMR {Geobacillus stearothermophilus} SCOP: b.43.3.1 Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Back     alignment and structure
>2crv_A IF-2MT, translation initiation factor IF-2; ribosome, beta barrel, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Back     alignment and structure
>4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>3q5d_A Atlastin-1; G protein, GTPase, GDP/GTP binding, hydrolase; HET: GDP; 2.70A {Homo sapiens} PDB: 3q5e_A* 3qnu_A* 3qof_A* Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>3k9g_A PF-32 protein; ssgcid, SBRI, decode biostructures, UW, NIH, niaid, borellia burgdorferi, plasmid partition protein, iodide; 2.25A {Borrelia burgdorferi} PDB: 3k9h_A Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>4ido_A Atlastin-1; GTPase, GTP/GDP binding, hydrolase; HET: GDP; 2.09A {Homo sapiens} PDB: 4idn_A* 3q5d_A* 3q5e_A* 4idq_A* 4idp_A* 3qnu_A* 3qof_A* Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>1hyq_A MIND, cell division inhibitor (MIND-1); MINC, FTSZ, bacterial cell division, cell cycle; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.10 Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>2ph1_A Nucleotide-binding protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Archaeoglobus fulgidus dsm 4304} PDB: 3kb1_A* Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>3ug7_A Arsenical pump-driving ATPase; tail-anchored, membrane protein, targeting factor, ATP-bindi TRC40, ARSA, nucleotide-binding; HET: ADP; 2.90A {Methanocaldococcus jannaschii} PDB: 3ug6_A* Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>3kjh_A CO dehydrogenase/acetyl-COA synthase complex, accessory protein COOC; Zn-bound dimer, nickel binding protein, ATPase; 1.90A {Carboxydothermus hydrogenoformans} PDB: 3kjg_A* 3kje_A 3kji_A* Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>1g3q_A MIND ATPase, cell division inhibitor; alpha-beta-alpha layered, protein-ADP complex, cell cycle, hydrolase; HET: ADP; 2.00A {Pyrococcus furiosus} SCOP: c.37.1.10 PDB: 1g3r_A* 1ion_A* Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>1wcv_1 SOJ, segregation protein; ATPase, bacterial, chromosome segregation; 1.6A {Thermus thermophilus} PDB: 2bej_A* 2bek_A* Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>3la6_A Tyrosine-protein kinase WZC; P-loop protein, nucleotide binding domain, walker A motif, B protein kinase, oligomerization; HET: ADP; 3.20A {Escherichia coli} Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>3cwq_A Para family chromosome partitioning protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: ADP; 2.47A {Synechocystis SP} Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>3bfv_A CAPA1, CAPB2, membrane protein CAPA1, protein tyrosine kinase; chimerical protein, P-loop protein, capsule biogenesis/degradation; HET: ADP; 1.80A {Staphylococcus aureus} PDB: 2ved_A* Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>2oze_A ORF delta'; para, walker type atpases, DNA segregation, PSM19035, plasmid, DNA binding protein; HET: AGS EPE; 1.83A {Streptococcus pyogenes} Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>3ea0_A ATPase, para family; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: ATP; 2.20A {Chlorobium tepidum} Back     alignment and structure
>3cio_A ETK, tyrosine-protein kinase ETK; WZC, escherichia coli tyrosine kinase domain, signaling protein, transferase, inner membrane, membrane; 2.50A {Escherichia coli} Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>3q9l_A Septum site-determining protein MIND; ATPase, bacterial cell division inhibitor, MINC, MINE, cell hydrolase; HET: ATP; 2.34A {Escherichia coli} PDB: 3r9i_A* 3r9j_A* Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>2xj4_A MIPZ; replication, cell division, ATPase, WACA; 1.60A {Caulobacter vibrioides} PDB: 2xj9_A* 2xit_A Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>3fgn_A Dethiobiotin synthetase; biotin biosynthesis, BIOD, ATP-BIND ligase, magnesium, nucleotide-binding; 1.85A {Mycobacterium tuberculosis} PDB: 3fmf_A* 3fmi_A* 3fpa_A* Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>1byi_A Dethiobiotin synthase; biotin synthesis, cyclo-ligase, ligase; 0.97A {Escherichia coli} SCOP: c.37.1.10 PDB: 1bs1_A* 1a82_A 1dad_A* 1dae_A* 1daf_A* 1dag_A* 1dah_A* 1dai_A* 1dak_A* 1dam_A* 1dbs_A 1dts_A Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 459
d1f60a3239 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N 1e-120
d1jnya3224 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N 5e-85
d2c78a3204 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N 2e-68
d1r5ba3245 c.37.1.8 (A:215-459) Eukaryotic peptide chain rele 9e-67
d1zunb3222 c.37.1.8 (B:16-237) Sulfate adenylate transferase 6e-64
d1d2ea3196 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), 3e-58
d1f60a2107 b.44.1.1 (A:335-441) Elongation factor eEF-1alpha, 4e-58
d1jnya2107 b.44.1.1 (A:323-429) Elongation factor eEF-1alpha, 4e-46
d1f60a194 b.43.3.1 (A:241-334) Elongation factor eEF-1alpha, 1e-38
d2qn6a3205 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma su 8e-38
d1d2ea198 b.43.3.1 (A:251-348) Elongation factor Tu (EF-Tu), 1e-36
d2c78a1100 b.43.3.1 (A:213-312) Elongation factor Tu (EF-Tu), 5e-35
d1jnya195 b.43.3.1 (A:228-322) Elongation factor eEF-1alpha, 5e-34
d1efca192 b.43.3.1 (A:205-296) Elongation factor Tu (EF-Tu), 4e-32
d1wb1a192 b.43.3.1 (A:180-271) Elongation factor SelB, domai 2e-30
d1kk1a3195 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma su 6e-28
d2bv3a2276 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-t 5e-27
d1r5ba268 b.44.1.1 (A:555-622) Eukaryotic peptide chain rele 6e-27
d1r5ba195 b.43.3.1 (A:460-554) Eukaryotic peptide chain rele 7e-27
d1xe1a_91 b.43.3.1 (A:) Hypothetical protein PF0907 {Pyrococ 7e-24
d1n0ua2341 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N- 1e-21
d1zunb192 b.43.3.1 (B:238-329) Sulfate adenylate transferase 3e-20
d1zunb2105 b.44.1.1 (B:330-434) Sulfate adenylate transferase 4e-20
d1kk1a1121 b.43.3.1 (A:201-321) Initiation factor eIF2 gamma 5e-19
d1s0ua1118 b.43.3.1 (A:230-347) Initiation factor eIF2 gamma 2e-17
d1yrba1244 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB09 4e-17
d1g7sa2128 b.43.3.1 (A:460-587) Initiation factor IF2/eIF5b, 5e-15
d1wb1a4179 c.37.1.8 (A:1-179) Elongation factor SelB, N-termi 9e-15
d2dy1a2267 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-t 1e-14
d2c78a293 b.44.1.1 (A:313-405) Elongation factor Tu (EF-Tu) 2e-12
d2qn6a1114 b.43.3.1 (A:207-320) Initiation factor eIF2 gamma 6e-12
d1d2ea2103 b.44.1.1 (A:349-451) Elongation factor Tu (EF-Tu) 2e-10
d1g7sa4227 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N- 5e-10
d1mkya2186 c.37.1.8 (A:173-358) Probable GTPase Der, N-termin 0.001
d1tq4a_400 c.37.1.8 (A:) Interferon-inducible GTPase {Mouse ( 0.002
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 239 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Elongation factor eEF-1alpha, N-terminal (G) domain
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
 Score =  349 bits (897), Expect = e-120
 Identities = 191/241 (79%), Positives = 212/241 (87%), Gaps = 2/241 (0%)

Query: 2   GKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLD 61
           GKEK+HIN+VVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA E+GKGSFKYAWVLD
Sbjct: 1   GKEKSHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVLD 60

Query: 62  KLKAERERGITIDIALWKFETSKFYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 121
           KLKAERERGITIDIALWKFET K+ VT+IDAPGHRDFIKNMITGTSQADCA+LI+A G G
Sbjct: 61  KLKAERERGITIDIALWKFETPKYQVTVIDAPGHRDFIKNMITGTSQADCAILIIAGGVG 120

Query: 122 EFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEARFEEIKKEVSGYIKKI 181
           EFEAGISK+GQTREHALLAFTLGV+QLIV VNKMDS +  + E+RF+EI KE S +IKK+
Sbjct: 121 EFEAGISKDGQTREHALLAFTLGVRQLIVAVNKMDSVK--WDESRFQEIVKETSNFIKKV 178

Query: 182 GYNPATVAFVPISGWHGDNMLEVSDKMPWFKGWAIERKEGKADGKCLIEALDAILPPSRP 241
           GYNP TV FVPISGW+GDNM+E +   PW+KGW  E K G   GK L+EA+DAI  PSRP
Sbjct: 179 GYNPKTVPFVPISGWNGDNMIEATTNAPWYKGWEKETKAGVVKGKTLLEAIDAIEQPSRP 238

Query: 242 T 242
           T
Sbjct: 239 T 239


>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 224 Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Length = 204 Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 245 Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Length = 222 Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Length = 196 Back     information, alignment and structure
>d1f60a2 b.44.1.1 (A:335-441) Elongation factor eEF-1alpha, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 107 Back     information, alignment and structure
>d1jnya2 b.44.1.1 (A:323-429) Elongation factor eEF-1alpha, C-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 107 Back     information, alignment and structure
>d1f60a1 b.43.3.1 (A:241-334) Elongation factor eEF-1alpha, domain 2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 94 Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Length = 205 Back     information, alignment and structure
>d1d2ea1 b.43.3.1 (A:251-348) Elongation factor Tu (EF-Tu), domain 2 {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Length = 98 Back     information, alignment and structure
>d2c78a1 b.43.3.1 (A:213-312) Elongation factor Tu (EF-Tu), domain 2 {Thermus thermophilus [TaxId: 274]} Length = 100 Back     information, alignment and structure
>d1jnya1 b.43.3.1 (A:228-322) Elongation factor eEF-1alpha, domain 2 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 95 Back     information, alignment and structure
>d1efca1 b.43.3.1 (A:205-296) Elongation factor Tu (EF-Tu), domain 2 {Escherichia coli [TaxId: 562]} Length = 92 Back     information, alignment and structure
>d1wb1a1 b.43.3.1 (A:180-271) Elongation factor SelB, domains 2 and 4 {Methanococcus maripaludis [TaxId: 39152]} Length = 92 Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Length = 195 Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Length = 276 Back     information, alignment and structure
>d1r5ba2 b.44.1.1 (A:555-622) Eukaryotic peptide chain release factor ERF2, C-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 68 Back     information, alignment and structure
>d1r5ba1 b.43.3.1 (A:460-554) Eukaryotic peptide chain release factor ERF2, post-G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 95 Back     information, alignment and structure
>d1xe1a_ b.43.3.1 (A:) Hypothetical protein PF0907 {Pyrococcus furiosus [TaxId: 2261]} Length = 91 Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 341 Back     information, alignment and structure
>d1zunb1 b.43.3.1 (B:238-329) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain 2-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Length = 92 Back     information, alignment and structure
>d1zunb2 b.44.1.1 (B:330-434) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain 3-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Length = 105 Back     information, alignment and structure
>d1kk1a1 b.43.3.1 (A:201-321) Initiation factor eIF2 gamma subunit, domain II {Archaeon Pyrococcus abyssi [TaxId: 29292]} Length = 121 Back     information, alignment and structure
>d1s0ua1 b.43.3.1 (A:230-347) Initiation factor eIF2 gamma subunit, domain II {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 118 Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Length = 244 Back     information, alignment and structure
>d1g7sa2 b.43.3.1 (A:460-587) Initiation factor IF2/eIF5b, domains 2 and 4 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 128 Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Length = 179 Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Length = 267 Back     information, alignment and structure
>d2c78a2 b.44.1.1 (A:313-405) Elongation factor Tu (EF-Tu) {Thermus thermophilus [TaxId: 274]} Length = 93 Back     information, alignment and structure
>d2qn6a1 b.43.3.1 (A:207-320) Initiation factor eIF2 gamma subunit, domain II {Sulfolobus solfataricus [TaxId: 2287]} Length = 114 Back     information, alignment and structure
>d1d2ea2 b.44.1.1 (A:349-451) Elongation factor Tu (EF-Tu) {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Length = 103 Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 227 Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Length = 186 Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Length = 400 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query459
d1f60a3239 Elongation factor eEF-1alpha, N-terminal (G) domai 100.0
d1zunb3222 Sulfate adenylate transferase subunit cysN/C, EF-T 100.0
d1jnya3224 Elongation factor eEF-1alpha, N-terminal (G) domai 100.0
d1r5ba3245 Eukaryotic peptide chain release factor ERF2, G do 100.0
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 100.0
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 100.0
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 99.98
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 99.97
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 99.97
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 99.96
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 99.96
d1f60a2107 Elongation factor eEF-1alpha, C-terminal domain {B 99.96
d1jnya2107 Elongation factor eEF-1alpha, C-terminal domain {A 99.95
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 99.94
d1n0ua2341 Elongation factor 2 (eEF-2), N-terminal (G) domain 99.93
d1f60a194 Elongation factor eEF-1alpha, domain 2 {Baker's ye 99.89
d2c78a1100 Elongation factor Tu (EF-Tu), domain 2 {Thermus th 99.86
d1zunb2105 Sulfate adenylate transferase subunit cysN/C, EF-T 99.86
d1jnya195 Elongation factor eEF-1alpha, domain 2 {Archaeon S 99.86
d1efca192 Elongation factor Tu (EF-Tu), domain 2 {Escherichi 99.85
d1d2ea198 Elongation factor Tu (EF-Tu), domain 2 {Cow (Bos t 99.84
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 99.84
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 99.84
d1wb1a192 Elongation factor SelB, domains 2 and 4 {Methanoco 99.82
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 99.81
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 99.79
d1kk1a1121 Initiation factor eIF2 gamma subunit, domain II {A 99.79
d1xe1a_91 Hypothetical protein PF0907 {Pyrococcus furiosus [ 99.77
d1r5ba195 Eukaryotic peptide chain release factor ERF2, post 99.77
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 99.76
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.76
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 99.76
d1zunb192 Sulfate adenylate transferase subunit cysN/C, EF-T 99.76
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 99.76
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 99.75
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 99.75
d1s0ua1118 Initiation factor eIF2 gamma subunit, domain II {A 99.74
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 99.74
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 99.74
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 99.73
d1d2ea2103 Elongation factor Tu (EF-Tu) {Cow (Bos taurus), mi 99.73
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 99.72
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 99.72
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 99.72
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 99.71
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 99.7
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 99.7
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 99.7
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 99.69
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 99.69
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 99.69
d2c78a293 Elongation factor Tu (EF-Tu) {Thermus thermophilus 99.69
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 99.68
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 99.68
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 99.68
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 99.68
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 99.67
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 99.67
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 99.67
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 99.67
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 99.66
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 99.66
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 99.66
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 99.66
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 99.65
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 99.65
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 99.65
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 99.64
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 99.64
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 99.64
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 99.64
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 99.64
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 99.64
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 99.63
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 99.63
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 99.63
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 99.63
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 99.62
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.61
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 99.61
d2qn6a1114 Initiation factor eIF2 gamma subunit, domain II {S 99.61
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 99.6
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 99.58
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 99.58
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 99.57
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.57
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 99.57
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 99.57
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 99.56
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.56
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 99.55
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 99.54
d1r5ba268 Eukaryotic peptide chain release factor ERF2, C-te 99.51
d1nrjb_209 Signal recognition particle receptor beta-subunit 99.51
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 99.49
d2fh5b1207 Signal recognition particle receptor beta-subunit 99.47
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 99.37
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 99.37
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 99.37
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 99.28
d2bv3a1121 Elongation factor G (EF-G), domain II {Thermus the 99.28
d1g7sa2128 Initiation factor IF2/eIF5b, domains 2 and 4 {Arch 99.22
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 99.22
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 99.21
d2dy1a1103 Elongation factor G (EF-G), domain II {Thermus the 99.19
d1n0ua1138 Elongation factor 2 (eEF-2), domain II {Baker's ye 99.05
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 98.97
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 98.84
d1jwyb_306 Dynamin G domain {Dictyostelium discoideum [TaxId: 98.51
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 98.48
d1wxqa1319 GTP-binding protein PH0525 {Pyrococcus horikoshii 98.43
d1ni3a1296 YchF GTP-binding protein N-terminal domain {Fissio 98.31
d1jala1278 YchF GTP-binding protein N-terminal domain {Haemop 98.31
d1vmaa2213 GTPase domain of the signal recognition particle r 98.14
d1okkd2207 GTPase domain of the signal recognition particle r 98.12
d2qy9a2211 GTPase domain of the signal recognition particle r 98.11
d1j8yf2211 GTPase domain of the signal sequence recognition p 98.11
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 98.1
d1ls1a2207 GTPase domain of the signal sequence recognition p 98.04
d1d1na_99 Initiation factor IF2/eIF5b, domains 2 and 4 {Baci 97.96
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 97.89
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 97.89
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 97.75
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 97.63
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 97.63
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 97.59
d1g7sa1101 Initiation factor IF2/eIF5b, domains 2 and 4 {Arch 97.04
d1kk1a289 Initiation factor eIF2 gamma subunit {Archaeon Pyr 96.83
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 96.63
d1wb1a3116 Elongation factor SelB, domain 3 {Methanococcus ma 96.35
d1s0ua290 Initiation factor eIF2 gamma subunit {Archaeon Met 96.31
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 96.29
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 96.19
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 96.19
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 96.17
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 96.15
d2qn6a295 Initiation factor eIF2 gamma subunit {Sulfolobus s 96.1
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 96.06
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 96.05
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 95.84
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 95.7
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 95.6
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 95.59
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 95.54
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 95.4
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 95.34
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 95.27
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 95.25
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 95.25
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 95.23
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 95.17
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 95.1
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 95.07
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 95.01
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 95.0
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 94.97
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 94.94
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 94.82
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 94.75
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 94.73
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 94.67
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 94.62
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 94.49
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 94.46
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 94.37
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 94.33
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 94.3
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 94.28
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 94.25
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 94.23
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 94.18
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 94.03
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 93.99
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 93.98
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 93.97
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 93.94
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 93.91
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 93.87
d2awna2232 Maltose transport protein MalK, N-terminal domain 93.87
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 93.81
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 93.52
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 93.52
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 93.49
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 93.47
d2hyda1255 Putative multidrug export ATP-binding/permease pro 93.47
d1g2912240 Maltose transport protein MalK, N-terminal domain 93.35
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 93.26
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 93.16
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 93.1
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 92.98
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 92.95
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 92.92
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 92.86
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 92.75
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 92.67
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 92.6
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 92.48
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 92.46
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 92.44
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 92.37
d1g3qa_237 Cell division regulator MinD {Archaeon Pyrococcus 92.25
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 92.0
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 91.67
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 91.56
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 91.09
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 91.05
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 90.94
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 90.93
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 90.49
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 90.25
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 90.18
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 89.86
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 89.69
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 89.68
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 89.42
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 89.41
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 89.1
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 89.08
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 89.01
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 88.73
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 88.69
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 88.48
d1osna_331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 88.42
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 88.41
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 88.39
d1hyqa_232 Cell division regulator MinD {Archaeon Archaeoglob 88.39
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 87.9
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 87.83
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 87.44
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 87.35
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 86.96
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 86.21
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 86.1
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 85.42
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 85.39
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 84.87
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 84.26
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 84.1
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 83.97
d1tuea_205 Replication protein E1 helicase domain {Human papi 83.65
d1svma_362 Papillomavirus large T antigen helicase domain {Si 83.53
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 83.51
d1e2ka_329 Thymidine kinase {Herpes simplex virus type 1, dif 83.48
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 83.47
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 83.31
d1p6xa_333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 83.28
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 83.28
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 82.99
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 82.56
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 82.02
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 81.89
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 81.86
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 81.47
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 80.62
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 80.33
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 80.19
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Elongation factor eEF-1alpha, N-terminal (G) domain
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=100.00  E-value=3.4e-52  Score=385.55  Aligned_cols=238  Identities=80%  Similarity=1.292  Sum_probs=226.0

Q ss_pred             CCCCceeEEEEEecCCCChHHHHhHHHHhcCCCChHHHHHHHHHHHHhCCCcceeeeeccCchhHHhcCceEEeeeeEEe
Q psy13961          2 GKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFE   81 (459)
Q Consensus         2 ~~~k~~~~v~v~G~~~~GKSTLi~~Ll~~~~~i~~~~~~~~~~~~~~~g~~~~~~~~~~d~~~~e~~~g~Ti~~~~~~~~   81 (459)
                      |.+|+++||+++||+|||||||+++|++.+|.++.+.+++..+++.+.+++.+.++|++|..++||+||+|++.++..|+
T Consensus         1 ~~~k~~iNi~iiGHvD~GKsTl~~~ll~~~g~i~~~~~~~~~~~~~~~~~~~~~~~~~~D~~~~Er~rGiTi~~~~~~~~   80 (239)
T d1f60a3           1 GKEKSHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFE   80 (239)
T ss_dssp             CCCCEEEEEEEEECTTSCHHHHHHHHHHHHSCSSHHHHHHHHHHGGGGSSSCCCHHHHHHHHHHHHHTTCCCSCSCEEEE
T ss_pred             CCCCCccEEEEEeCCCCCHHHHHHHHHHHcCCccHHHHHHHHHHHHHhcCCccceeeecccchhhhcceeccccceeEec
Confidence            56899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eCCEEEEEEeCCCccchHhHHHHhhcccCEEEEEEECCCCceeccccCCCchHHHHHHHHHcCCceEEEEEEccCCCCCC
Q psy13961         82 TSKFYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPP  161 (459)
Q Consensus        82 ~~~~~~~liDtpG~~~~~~~~~~~~~~aD~~ilVvda~~g~~~~~~~~~~qt~e~~~~~~~~~ip~iivviNK~D~~~~~  161 (459)
                      +.+++++|+|||||.+|.++|+++++.+|+|||||||.+|+++.++..++||++|+.+++.+|+|++||++||||+++  
T Consensus        81 ~~~~~i~iiDtPGH~df~~~~~~g~~~~D~ailvvda~~G~~e~g~~~~~QT~eh~~~~~~~gv~~iiv~iNKmD~~~--  158 (239)
T d1f60a3          81 TPKYQVTVIDAPGHRDFIKNMITGTSQADCAILIIAGGVGEFEAGISKDGQTREHALLAFTLGVRQLIVAVNKMDSVK--  158 (239)
T ss_dssp             CSSEEEEEEECCCCTTHHHHHHHSSSCCSEEEEEEECSHHHHHHHTCTTSHHHHHHHHHHHTTCCEEEEEEECGGGGT--
T ss_pred             cCCEEEEEEECCCcHHHHHHHHHHHHHhCEEEEEEECCCCccccccCchHhHHHHHHHHHHcCCCeEEEEEECCCCCC--
Confidence            999999999999999999999999999999999999999999999988899999999999999999999999999987  


Q ss_pred             CcHHHHHHHHHHHHhhhhhcCcCCceeeEeecCCCCCCccccccCCCCCccccccccccCCCChhhHHHhccccCCCCCC
Q psy13961        162 YSEARFEEIKKEVSGYIKKIGYNPATVAFVPISGWHGDNMLEVSDKMPWFKGWAIERKEGKADGKCLIEALDAILPPSRP  241 (459)
Q Consensus       162 ~~~~~~~~i~~~l~~~l~~~g~~~~~~~~i~iSa~~g~~i~~~~~~~~w~~~~~~~~~~~~~~g~~Ll~~l~~~~~~~~~  241 (459)
                      |++++|+++.+++..++...++++..++|+|+||..|+|+.+.+.+++||+|+......+...+++|+++|+.+.+|.|+
T Consensus       159 ~d~~~~~~~~~el~~~l~~~~~~~~~i~~ipiSa~~G~ni~~~s~~~~wykg~~~~~~~~~~~~~TLlEaLD~I~~P~R~  238 (239)
T d1f60a3         159 WDESRFQEIVKETSNFIKKVGYNPKTVPFVPISGWNGDNMIEATTNAPWYKGWEKETKAGVVKGKTLLEAIDAIEQPSRP  238 (239)
T ss_dssp             TCHHHHHHHHHHHHHHHHHHTCCGGGCCEEECCTTTCBTTTBCCSSCTTCCCEEEECSSSEEEESSHHHHHHTSCCCCCC
T ss_pred             CCHHHHHHHHHHHHHHHHhcCCCCCcEEEEEEEccCCCcceeccccCccccCcccccccCccccccHHHHhhCCCCCCCC
Confidence            88999999999999999999998888999999999999999999999999998877766666778999999998777664



>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1f60a2 b.44.1.1 (A:335-441) Elongation factor eEF-1alpha, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jnya2 b.44.1.1 (A:323-429) Elongation factor eEF-1alpha, C-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1f60a1 b.43.3.1 (A:241-334) Elongation factor eEF-1alpha, domain 2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c78a1 b.43.3.1 (A:213-312) Elongation factor Tu (EF-Tu), domain 2 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1zunb2 b.44.1.1 (B:330-434) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain 3-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1jnya1 b.43.3.1 (A:228-322) Elongation factor eEF-1alpha, domain 2 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1efca1 b.43.3.1 (A:205-296) Elongation factor Tu (EF-Tu), domain 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d2ea1 b.43.3.1 (A:251-348) Elongation factor Tu (EF-Tu), domain 2 {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wb1a1 b.43.3.1 (A:180-271) Elongation factor SelB, domains 2 and 4 {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1kk1a1 b.43.3.1 (A:201-321) Initiation factor eIF2 gamma subunit, domain II {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1xe1a_ b.43.3.1 (A:) Hypothetical protein PF0907 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1r5ba1 b.43.3.1 (A:460-554) Eukaryotic peptide chain release factor ERF2, post-G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1zunb1 b.43.3.1 (B:238-329) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain 2-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1s0ua1 b.43.3.1 (A:230-347) Initiation factor eIF2 gamma subunit, domain II {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d2ea2 b.44.1.1 (A:349-451) Elongation factor Tu (EF-Tu) {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c78a2 b.44.1.1 (A:313-405) Elongation factor Tu (EF-Tu) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qn6a1 b.43.3.1 (A:207-320) Initiation factor eIF2 gamma subunit, domain II {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r5ba2 b.44.1.1 (A:555-622) Eukaryotic peptide chain release factor ERF2, C-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bv3a1 b.43.3.1 (A:283-403) Elongation factor G (EF-G), domain II {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g7sa2 b.43.3.1 (A:460-587) Initiation factor IF2/eIF5b, domains 2 and 4 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2dy1a1 b.43.3.1 (A:275-377) Elongation factor G (EF-G), domain II {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1n0ua1 b.43.3.1 (A:344-481) Elongation factor 2 (eEF-2), domain II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1d1na_ b.43.3.1 (A:) Initiation factor IF2/eIF5b, domains 2 and 4 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g7sa1 b.43.3.1 (A:228-328) Initiation factor IF2/eIF5b, domains 2 and 4 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1kk1a2 b.44.1.1 (A:322-410) Initiation factor eIF2 gamma subunit {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wb1a3 b.44.1.1 (A:272-387) Elongation factor SelB, domain 3 {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1s0ua2 b.44.1.1 (A:348-437) Initiation factor eIF2 gamma subunit {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2qn6a2 b.44.1.1 (A:321-415) Initiation factor eIF2 gamma subunit {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure