Psyllid ID: psy14147


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100
MVVRSREVMEIQKDVVQSFPIILYCVKPYACEECGKAFRKKFSLTMHQRHVHLNDRRYQCDLCLARFVTNSSLIVHKQRHDNTPRFKCKLCPKMFTNTVS
cccccccccccHHHHHHHcccccccccccccccccHHccccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccc
cccccccccHccHHHHHHHccEccccccccccccccccccccHHHHHHHHHHcccccccccHccccEccccHHHHHHHHcccccccccccccccEEcccc
MVVRSREVMEIQKDVvqsfpiilycvkpyaceecGKAFRKKFSLTMHQrhvhlndrrYQCDLCLARFVTNSSLIVhkqrhdntprfkcklcpkmftntvs
mvvrsrevmeiqkdvvqsfpiILYCVKPYACEECGKAFRKKFSLTMHQRHVHLNDRRYQCDLCLARFVTNSSLivhkqrhdntprfkcklcpkmftntvs
MVVRSREVMEIQKDVVQSFPIILYCVKPYACEECGKAFRKKFSLTMHQRHVHLNDRRYQCDLCLARFVTNSSLIVHKQRHDNTPRFKCKLCPKMFTNTVS
*********EIQKDVVQSFPIILYCVKPYACEECGKAFRKKFSLTMHQRHVHLNDRRYQCDLCLARFVTNSSLIVHKQRHDNTPRFKCKLCPKMF*****
MVVRSREVMEIQKDVVQSFPIILYCVKPYACEECGKAFRKKFSLTMHQRHVHLNDRRYQCDLCLARFVTNSSLIVHKQRHDNTPRFKCKLCPKMFT****
********MEIQKDVVQSFPIILYCVKPYACEECGKAFRKKFSLTMHQRHVHLNDRRYQCDLCLARFVTNSSLIVHKQRHDNTPRFKCKLCPKMFTNTVS
***RSREVMEIQKDVVQSFPIILYCVKPYACEECGKAFRKKFSLTMHQRHVHLNDRRYQCDLCLARFVTNSSLIVHKQRHDNTPRFKCKLCPKMF*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVVRSREVMEIQKDVVQSFPIILYCVKPYACEECGKAFRKKFSLTMHQRHVHLNDRRYQCDLCLARFVTNSSLIVHKQRHDNTPRFKCKLCPKMFTNTVS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query100 2.2.26 [Sep-21-2011]
Q9UK10706 Zinc finger protein 225 O yes N/A 0.72 0.101 0.506 1e-13
Q5MYW4608 Zinc finger protein 667 O yes N/A 0.73 0.120 0.472 3e-13
P08042402 Zinc finger protein 1 OS= yes N/A 0.68 0.169 0.463 4e-13
Q8CJ78 1038 Zinc finger protein 628 O no N/A 0.71 0.068 0.458 6e-13
Q5RC79407 Zinc finger protein 1 hom no N/A 0.68 0.167 0.463 7e-13
Q6P2D0407 Zinc finger protein 1 hom no N/A 0.68 0.167 0.463 7e-13
Q5EBL2 1055 Zinc finger protein 628 O no N/A 0.71 0.067 0.458 8e-13
Q2TL60609 Zinc finger protein 667 O no N/A 0.73 0.119 0.459 9e-13
Q6ZN57 461 Zinc finger protein 2 hom no N/A 0.73 0.158 0.459 2e-12
P08043459 Zinc finger protein 2 OS= no N/A 0.79 0.172 0.412 3e-12
>sp|Q9UK10|ZN225_HUMAN Zinc finger protein 225 OS=Homo sapiens GN=ZNF225 PE=2 SV=2 Back     alignment and function desciption
 Score = 75.5 bits (184), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 37/73 (50%), Positives = 44/73 (60%), Gaps = 1/73 (1%)

Query: 26  VKPYACEECGKAFRKKFSLTMHQRHVHLNDRRYQCDLCLARFVTNSSLIVHKQRHDNTPR 85
           VKPY CEECGK F  KF+L MHQR VH  +R Y C  C   F   SS++ HK+ H +   
Sbjct: 537 VKPYKCEECGKGFNSKFNLDMHQR-VHTGERPYNCKECGKSFSRASSILNHKRLHGDEKP 595

Query: 86  FKCKLCPKMFTNT 98
           FKC+ C K FT  
Sbjct: 596 FKCEECGKRFTEN 608




May be involved in transcriptional regulation.
Homo sapiens (taxid: 9606)
>sp|Q5MYW4|ZN667_RAT Zinc finger protein 667 OS=Rattus norvegicus GN=Znf667 PE=2 SV=1 Back     alignment and function description
>sp|P08042|ZFP1_MOUSE Zinc finger protein 1 OS=Mus musculus GN=Zfp1 PE=2 SV=3 Back     alignment and function description
>sp|Q8CJ78|ZN628_MOUSE Zinc finger protein 628 OS=Mus musculus GN=Znf628 PE=2 SV=2 Back     alignment and function description
>sp|Q5RC79|ZFP1_PONAB Zinc finger protein 1 homolog OS=Pongo abelii GN=ZFP1 PE=2 SV=1 Back     alignment and function description
>sp|Q6P2D0|ZFP1_HUMAN Zinc finger protein 1 homolog OS=Homo sapiens GN=ZFP1 PE=2 SV=2 Back     alignment and function description
>sp|Q5EBL2|ZN628_HUMAN Zinc finger protein 628 OS=Homo sapiens GN=ZNF628 PE=2 SV=2 Back     alignment and function description
>sp|Q2TL60|ZN667_MOUSE Zinc finger protein 667 OS=Mus musculus GN=Znf667 PE=1 SV=1 Back     alignment and function description
>sp|Q6ZN57|ZFP2_HUMAN Zinc finger protein 2 homolog OS=Homo sapiens GN=ZFP2 PE=2 SV=1 Back     alignment and function description
>sp|P08043|ZFP2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Zfp2 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query100
334313271 860 PREDICTED: zinc finger protein 568-like 0.71 0.082 0.472 4e-13
334313247 454 PREDICTED: zinc finger protein 420-like 0.63 0.138 0.471 2e-12
334313277 705 PREDICTED: zinc finger protein 420-like 0.71 0.100 0.444 2e-12
296471091 378 TPA: hCG1794302-like [Bos taurus] 0.76 0.201 0.454 2e-12
403308282 512 PREDICTED: zinc finger protein 225, part 0.72 0.140 0.506 3e-12
334328909 451 PREDICTED: zinc finger protein 420-like 0.73 0.161 0.459 3e-12
395530004 620 PREDICTED: zinc finger protein 160-like, 0.89 0.143 0.411 3e-12
402905826 706 PREDICTED: zinc finger protein 225 isofo 0.71 0.100 0.513 3e-12
297277256 706 PREDICTED: zinc finger protein 225-like 0.71 0.100 0.513 3e-12
380794347189 zinc finger protein 225, partial [Macaca 0.71 0.375 0.513 4e-12
>gi|334313271|ref|XP_003339869.1| PREDICTED: zinc finger protein 568-like [Monodelphis domestica] Back     alignment and taxonomy information
 Score = 78.6 bits (192), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 34/72 (47%), Positives = 46/72 (63%), Gaps = 1/72 (1%)

Query: 27  KPYACEECGKAFRKKFSLTMHQRHVHLNDRRYQCDLCLARFVTNSSLIVHKQRHDNTPRF 86
           KPY C++CGK FR+ F LT+HQR +H  ++ Y+C  C   F  NSSL VH++ H     +
Sbjct: 635 KPYECKQCGKTFRQSFKLTVHQR-IHTGEKPYECKQCGKTFTNNSSLAVHQRVHTGEKPY 693

Query: 87  KCKLCPKMFTNT 98
           +CK C K F NT
Sbjct: 694 ECKQCGKTFRNT 705




Source: Monodelphis domestica

Species: Monodelphis domestica

Genus: Monodelphis

Family: Didelphidae

Order: Didelphimorphia

Class: Mammalia

Phylum: Chordata

Superkingdom: Eukaryota

>gi|334313247|ref|XP_003339857.1| PREDICTED: zinc finger protein 420-like [Monodelphis domestica] Back     alignment and taxonomy information
>gi|334313277|ref|XP_003339872.1| PREDICTED: zinc finger protein 420-like [Monodelphis domestica] Back     alignment and taxonomy information
>gi|296471091|tpg|DAA13206.1| TPA: hCG1794302-like [Bos taurus] Back     alignment and taxonomy information
>gi|403308282|ref|XP_003944597.1| PREDICTED: zinc finger protein 225, partial [Saimiri boliviensis boliviensis] Back     alignment and taxonomy information
>gi|334328909|ref|XP_001376209.2| PREDICTED: zinc finger protein 420-like [Monodelphis domestica] Back     alignment and taxonomy information
>gi|395530004|ref|XP_003767094.1| PREDICTED: zinc finger protein 160-like, partial [Sarcophilus harrisii] Back     alignment and taxonomy information
>gi|402905826|ref|XP_003915709.1| PREDICTED: zinc finger protein 225 isoform 2 [Papio anubis] Back     alignment and taxonomy information
>gi|297277256|ref|XP_002801320.1| PREDICTED: zinc finger protein 225-like [Macaca mulatta] Back     alignment and taxonomy information
>gi|380794347|gb|AFE69049.1| zinc finger protein 225, partial [Macaca mulatta] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query100
RGD|1359114608 Zfp667 "zinc finger protein 66 0.73 0.120 0.472 1.6e-14
UNIPROTKB|Q5MYW4608 Znf667 "Zinc finger protein 66 0.73 0.120 0.472 1.6e-14
UNIPROTKB|F1N130559 F1N130 "Uncharacterized protei 0.68 0.121 0.478 1.8e-14
UNIPROTKB|Q9UK10706 ZNF225 "Zinc finger protein 22 0.7 0.099 0.521 3.5e-14
RGD|1565049402 Zfp1 "zinc finger protein 1" [ 0.68 0.169 0.463 3.9e-14
MGI|MGI:99154402 Zfp1 "zinc finger protein 1" [ 0.68 0.169 0.463 3.9e-14
UNIPROTKB|J3KNQ1374 ZFP1 "Zinc finger protein 1 ho 0.68 0.181 0.463 4.1e-14
UNIPROTKB|Q6P2D0407 ZFP1 "Zinc finger protein 1 ho 0.68 0.167 0.463 5.2e-14
UNIPROTKB|I3LIM1411 ZFP1 "Uncharacterized protein" 0.68 0.165 0.463 5.3e-14
UNIPROTKB|F1MTX5415 ZFP1 "Uncharacterized protein" 0.68 0.163 0.463 5.4e-14
RGD|1359114 Zfp667 "zinc finger protein 667" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
 Score = 195 (73.7 bits), Expect = 1.6e-14, P = 1.6e-14
 Identities = 35/74 (47%), Positives = 46/74 (62%)

Query:    27 KPYACEECGKAFRKKFSLTMHQRHVHLNDRRYQCDLCLARFVTNSSLIVHKQRHDNTPRF 86
             KPY CEECGKAF  + SLT H+R +H  DR Y+CDLC   F  ++ L  H++ H     +
Sbjct:   467 KPYQCEECGKAFSHRISLTRHKR-IHSEDRPYECDLCGKAFSQSAHLAQHERIHTGEKPY 525

Query:    87 KCKLCPKMFTNTVS 100
              CK+C K FT  +S
Sbjct:   526 ACKICKKSFTQRIS 539


GO:0003676 "nucleic acid binding" evidence=IEA
GO:0003677 "DNA binding" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0005634 "nucleus" evidence=IEA
GO:0006351 "transcription, DNA-dependent" evidence=IEA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
UNIPROTKB|Q5MYW4 Znf667 "Zinc finger protein 667" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1N130 F1N130 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UK10 ZNF225 "Zinc finger protein 225" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1565049 Zfp1 "zinc finger protein 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:99154 Zfp1 "zinc finger protein 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|J3KNQ1 ZFP1 "Zinc finger protein 1 homolog" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q6P2D0 ZFP1 "Zinc finger protein 1 homolog" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|I3LIM1 ZFP1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1MTX5 ZFP1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9UK10ZN225_HUMANNo assigned EC number0.50680.720.1019yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query100
COG5189423 COG5189, SFP1, Putative transcriptional repressor 0.002
>gnl|CDD|227516 COG5189, SFP1, Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
 Score = 35.5 bits (81), Expect = 0.002
 Identities = 21/76 (27%), Positives = 30/76 (39%), Gaps = 21/76 (27%)

Query: 27  KPYACE--ECGKAFRKKFSLTMHQRHVHLN------------------DRRYQCDLCLAR 66
           KPY C    C K ++ +  L  H  H H N                  D+ Y+C++C  R
Sbjct: 348 KPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKR 407

Query: 67  FVTNSSLIVH-KQRHD 81
           +   + L  H K  HD
Sbjct: 408 YKNLNGLKYHRKHSHD 423


Length = 423

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 100
KOG2462|consensus279 99.94
KOG2462|consensus279 99.91
KOG3623|consensus1007 99.76
KOG3576|consensus267 99.75
KOG1074|consensus 958 99.72
KOG3623|consensus 1007 99.69
KOG3576|consensus267 99.63
KOG3608|consensus 467 99.35
PHA0276855 hypothetical protein; Provisional 99.33
PHA00733128 hypothetical protein 99.31
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 99.26
KOG3608|consensus 467 99.26
KOG1074|consensus 958 99.22
PLN03086567 PRLI-interacting factor K; Provisional 99.17
PHA00733128 hypothetical protein 99.13
PHA0276855 hypothetical protein; Provisional 99.04
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.95
PHA0061644 hypothetical protein 98.83
PLN03086567 PRLI-interacting factor K; Provisional 98.81
PHA0073279 hypothetical protein 98.61
PHA0073279 hypothetical protein 98.56
PHA0061644 hypothetical protein 98.54
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 98.3
KOG3993|consensus 500 98.17
KOG3993|consensus 500 98.13
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.99
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.98
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.84
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.84
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.81
PRK04860160 hypothetical protein; Provisional 97.81
COG5189423 SFP1 Putative transcriptional repressor regulating 97.78
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.77
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.71
COG5189423 SFP1 Putative transcriptional repressor regulating 97.68
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 97.6
smart0035526 ZnF_C2H2 zinc finger. 97.31
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 97.21
smart0035526 ZnF_C2H2 zinc finger. 97.06
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 97.0
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 96.95
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 96.82
PRK04860160 hypothetical protein; Provisional 96.75
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 96.34
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 96.25
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 96.11
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 95.89
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 95.33
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 95.2
KOG1146|consensus 1406 94.87
COG404965 Uncharacterized protein containing archaeal-type C 94.27
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 93.41
COG288861 Predicted Zn-ribbon RNA-binding protein with a fun 93.25
PF1371937 zinc_ribbon_5: zinc-ribbon domain 93.24
cd0072934 rubredoxin_SM Rubredoxin, Small Modular nonheme ir 93.05
COG5048 467 FOG: Zn-finger [General function prediction only] 92.55
PF1371736 zinc_ribbon_4: zinc-ribbon domain 92.39
KOG2893|consensus 341 92.38
TIGR0209838 MJ0042_CXXC MJ0042 family finger-like domain. This 92.23
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 92.23
COG1592166 Rubrerythrin [Energy production and conversion] 92.13
PRK00464154 nrdR transcriptional regulator NrdR; Validated 91.92
PF0775424 DUF1610: Domain of unknown function (DUF1610); Int 91.3
PF09986 214 DUF2225: Uncharacterized protein conserved in bact 90.48
smart0065944 RPOLCX RNA polymerase subunit CX. present in RNA p 90.08
TIGR00373158 conserved hypothetical protein TIGR00373. This fam 89.95
KOG2186|consensus 276 89.5
PF15135 278 UPF0515: Uncharacterised protein UPF0515 89.39
smart00531147 TFIIE Transcription initiation factor IIE. 89.37
COG5048 467 FOG: Zn-finger [General function prediction only] 89.0
PRK0967872 DNA-binding transcriptional regulator; Provisional 88.91
KOG4173|consensus253 88.44
PRK06266178 transcription initiation factor E subunit alpha; V 88.32
KOG2186|consensus 276 88.26
KOG2893|consensus 341 88.15
TIGR02300129 FYDLN_acid conserved hypothetical protein TIGR0230 87.81
PF14353128 CpXC: CpXC protein 87.28
PRK1489059 putative Zn-ribbon RNA-binding protein; Provisiona 87.08
PF1057126 UPF0547: Uncharacterised protein family UPF0547; I 86.84
KOG1146|consensus 1406 86.8
smart0083441 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_C 86.48
PF1345149 zf-trcl: Probable zinc-binding domain 85.66
PHA0062659 hypothetical protein 85.4
PF0972342 Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR0134 84.97
COG199789 RPL43A Ribosomal protein L37AE/L43A [Translation, 84.93
PLN02294174 cytochrome c oxidase subunit Vb 83.58
smart0073426 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18 83.15
PF1276046 Zn_Tnp_IS1595: Transposase zinc-ribbon domain; Int 83.08
KOG3408|consensus129 82.94
smart0015439 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C 82.76
PF1290740 zf-met2: Zinc-binding 82.6
PRK03824135 hypA hydrogenase nickel incorporation protein; Pro 82.22
cd0092497 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb. 81.52
COG199649 RPC10 DNA-directed RNA polymerase, subunit RPC10 ( 81.52
KOG2785|consensus 390 81.36
TIGR0260552 CxxC_CxxC_SSSS putative regulatory protein, FmdB f 81.07
>KOG2462|consensus Back     alignment and domain information
Probab=99.94  E-value=2.3e-28  Score=139.59  Aligned_cols=93  Identities=25%  Similarity=0.473  Sum_probs=86.2

Q ss_pred             cchHHHHHHHHHHHHhccccccCCCceeCchhhhhccChhHHHHHHhhhcCCCCCccCccccccccChhHHHHHHHhcCC
Q psy14147          3 VRSREVMEIQKDVVQSFPIILYCVKPYACEECGKAFRKKFSLTMHQRHVHLNDRRYQCDLCLARFVTNSSLIVHKQRHDN   82 (100)
Q Consensus         3 ~~~~~~~~~~~~~l~~h~~~~~~~~~~~c~~C~~~f~~~~~l~~h~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~   82 (100)
                      ++.||+.+.+-.+|+.|+++|.  -+.+|.+||+.|.+..-|+.|++ .|+|++||.|+.|+++|..+++|..|+++|.+
T Consensus       164 C~~C~K~YvSmpALkMHirTH~--l~c~C~iCGKaFSRPWLLQGHiR-THTGEKPF~C~hC~kAFADRSNLRAHmQTHS~  240 (279)
T KOG2462|consen  164 CKYCGKVYVSMPALKMHIRTHT--LPCECGICGKAFSRPWLLQGHIR-THTGEKPFSCPHCGKAFADRSNLRAHMQTHSD  240 (279)
T ss_pred             CCCCCceeeehHHHhhHhhccC--CCcccccccccccchHHhhcccc-cccCCCCccCCcccchhcchHHHHHHHHhhcC
Confidence            6778899999999999999986  46899999999999999999995 99999999999999999999999999999999


Q ss_pred             CCCeecCCCccccCCC
Q psy14147         83 TPRFKCKLCPKMFTNT   98 (100)
Q Consensus        83 ~~~~~C~~C~~~f~~~   98 (100)
                      .++|+|+.|+|.|+.+
T Consensus       241 ~K~~qC~~C~KsFsl~  256 (279)
T KOG2462|consen  241 VKKHQCPRCGKSFALK  256 (279)
T ss_pred             CccccCcchhhHHHHH
Confidence            9999999999999754



>KOG2462|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF13719 zinc_ribbon_5: zinc-ribbon domain Back     alignment and domain information
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PF13717 zinc_ribbon_4: zinc-ribbon domain Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>COG1592 Rubrerythrin [Energy production and conversion] Back     alignment and domain information
>PRK00464 nrdR transcriptional regulator NrdR; Validated Back     alignment and domain information
>PF07754 DUF1610: Domain of unknown function (DUF1610); InterPro: IPR011668 This domain is found in archaeal species Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>smart00659 RPOLCX RNA polymerase subunit CX Back     alignment and domain information
>TIGR00373 conserved hypothetical protein TIGR00373 Back     alignment and domain information
>KOG2186|consensus Back     alignment and domain information
>PF15135 UPF0515: Uncharacterised protein UPF0515 Back     alignment and domain information
>smart00531 TFIIE Transcription initiation factor IIE Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PRK09678 DNA-binding transcriptional regulator; Provisional Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>PRK06266 transcription initiation factor E subunit alpha; Validated Back     alignment and domain information
>KOG2186|consensus Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300 Back     alignment and domain information
>PF14353 CpXC: CpXC protein Back     alignment and domain information
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional Back     alignment and domain information
>PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein Back     alignment and domain information
>PF13451 zf-trcl: Probable zinc-binding domain Back     alignment and domain information
>PHA00626 hypothetical protein Back     alignment and domain information
>PF09723 Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR013429 This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria Back     alignment and domain information
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02294 cytochrome c oxidase subunit Vb Back     alignment and domain information
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger Back     alignment and domain information
>PF12760 Zn_Tnp_IS1595: Transposase zinc-ribbon domain; InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc Back     alignment and domain information
>KOG3408|consensus Back     alignment and domain information
>smart00154 ZnF_AN1 AN1-like Zinc finger Back     alignment and domain information
>PF12907 zf-met2: Zinc-binding Back     alignment and domain information
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional Back     alignment and domain information
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb Back     alignment and domain information
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription] Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query100
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 4e-09
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 4e-09
1x6e_A72 Solution Structures Of The C2h2 Type Zinc Finger Do 7e-09
2ee8_A106 Solution Structure Of Three Zf-C2h2 Domains From Mo 1e-06
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 3e-06
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 3e-06
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 5e-06
2cot_A77 Solution Structure Of The First And Second Zf-C2h2 6e-06
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 8e-06
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 8e-06
1p47_A87 Crystal Structure Of Tandem Zif268 Molecules Comple 1e-05
1zaa_C87 Zinc Finger-Dna Recognition: Crystal Structure Of A 1e-05
1aay_A90 Zif268 Zinc Finger-Dna Complex Length = 90 1e-05
1g2d_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 1e-05
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 1e-05
2lce_A74 Chemical Shift Assignment Of Hr4436b From Homo Sapi 4e-05
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 5e-05
2jp9_A119 Structure Of The Wilms Tumor Suppressor Protein Zin 1e-04
2ysp_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 2e-04
2csh_A110 Solution Structure Of Tandem Repeat Of The Zf-C2h2 2e-04
2yt9_A95 Solution Structure Of C2h2 Type Zinc Finger Domain 2e-04
2elz_A46 Solution Structure Of The 17th Zf-C2h2 Domain From 3e-04
2yrj_A46 Solution Structure Of The C2h2-Type Zinc Finger Dom 5e-04
2eog_A44 Solution Structure Of The C2h2 Type Zinc Finger (Re 6e-04
2rpc_A155 Solution Structure Of The Tandem Zf-C2h2 Domains Fr 7e-04
2en4_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 8e-04
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure

Iteration: 1

Score = 56.2 bits (134), Expect = 4e-09, Method: Compositional matrix adjust. Identities = 27/72 (37%), Positives = 39/72 (54%), Gaps = 1/72 (1%) Query: 27 KPYACEECGKAFRKKFSLTMHQRHVHLNDRRYQCDLCLARFVTNSSLIVHKQRHDNTPRF 86 KPY C ECGK+F + +L HQR H ++ Y+C C F +S L H++ H + Sbjct: 3 KPYKCPECGKSFSQSSNLQKHQR-THTGEKPYKCPECGKSFSQSSDLQKHQRTHTGEKPY 61 Query: 87 KCKLCPKMFTNT 98 KC C K F+ + Sbjct: 62 KCPECGKSFSRS 73
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure
>pdb|1X6E|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Zinc Finger Protein 24 Length = 72 Back     alignment and structure
>pdb|2EE8|A Chain A, Solution Structure Of Three Zf-C2h2 Domains From Mouse Protein Odd-Skipped-Related 2 Splicing Isoform 2 Length = 106 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure
>pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 Back     alignment and structure
>pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 Back     alignment and structure
>pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 Back     alignment and structure
>pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|2LCE|A Chain A, Chemical Shift Assignment Of Hr4436b From Homo Sapiens, Northeast Structural Genomics Consortium Length = 74 Back     alignment and structure
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|2JP9|A Chain A, Structure Of The Wilms Tumor Suppressor Protein Zinc Finger Domain Bound To Dna Length = 119 Back     alignment and structure
>pdb|2YSP|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 507- 539) Of Human Zinc Finger Protein 224 Length = 46 Back     alignment and structure
>pdb|2CSH|A Chain A, Solution Structure Of Tandem Repeat Of The Zf-C2h2 Domains Of Human Zinc Finger Protein 297b Length = 110 Back     alignment and structure
>pdb|2YT9|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 345 In Zinc Finger Protein 278 Length = 95 Back     alignment and structure
>pdb|2ELZ|A Chain A, Solution Structure Of The 17th Zf-C2h2 Domain From Human Zinc Finger Protein 224 Length = 46 Back     alignment and structure
>pdb|2YRJ|A Chain A, Solution Structure Of The C2h2-Type Zinc Finger Domain (781- 813) From Zinc Finger Protein 473 Length = 46 Back     alignment and structure
>pdb|2EOG|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 693- 723) Of Human Zinc Finger Protein 268 Length = 44 Back     alignment and structure
>pdb|2RPC|A Chain A, Solution Structure Of The Tandem Zf-C2h2 Domains From The Human Zinc Finger Protein Zic 3 Length = 155 Back     alignment and structure
>pdb|2EN4|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 284- 316) Of Human Zinc Finger Protein 347 Length = 46 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query100
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 6e-16
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 2e-13
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 3e-09
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 1e-15
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 4e-13
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 9e-09
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 4e-15
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 1e-12
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 1e-07
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 7e-15
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 4e-10
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 9e-15
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 1e-14
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 8e-14
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 2e-12
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 2e-07
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 2e-14
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 6e-14
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 8e-14
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 1e-13
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 1e-13
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 1e-13
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 1e-11
2i13_A 190 AART; DNA binding, zinc finger, DNA binding protei 8e-04
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 1e-13
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 2e-13
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 6e-04
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 1e-13
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 2e-06
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 2e-13
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 2e-13
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 2e-13
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 1e-12
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 4e-13
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 2e-12
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 1e-09
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 5e-04
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 2e-12
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 4e-08
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 2e-07
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 4e-12
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 8e-06
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 1e-11
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 4e-11
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 4e-11
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 9e-11
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 4e-11
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 5e-11
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 1e-10
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 5e-11
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 9e-11
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 6e-08
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-10
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-10
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-08
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 1e-04
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-10
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-10
1tf6_A190 Protein (transcription factor IIIA); complex (tran 3e-10
1tf6_A 190 Protein (transcription factor IIIA); complex (tran 2e-09
1tf6_A190 Protein (transcription factor IIIA); complex (tran 4e-09
1tf6_A190 Protein (transcription factor IIIA); complex (tran 3e-08
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-10
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 4e-10
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 2e-09
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-10
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 4e-10
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 5e-10
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-10
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-10
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 6e-10
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 8e-10
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 9e-10
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-09
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 7e-09
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 1e-09
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-09
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-09
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-09
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-09
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-09
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-09
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-09
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-09
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 1e-09
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-09
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-09
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-09
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-09
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-09
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-09
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-09
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-09
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-09
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-09
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-09
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 2e-09
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-09
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-09
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-09
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 2e-09
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-09
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-09
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-09
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-09
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-09
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-09
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-09
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-09
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-09
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-09
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-09
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 3e-09
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-09
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-09
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-09
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 3e-09
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-09
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 4e-09
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-09
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-09
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-09
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-09
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-09
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-09
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 5e-09
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-09
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-09
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-09
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-09
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 6e-09
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-09
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-09
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-09
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-09
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-09
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-09
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-09
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-08
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 1e-08
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 1e-08
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-08
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-08
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-08
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 2e-08
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 6e-08
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 1e-07
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 8e-06
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 8e-04
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 2e-08
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-08
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-08
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 3e-08
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-08
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 7e-08
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 7e-08
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-08
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 1e-07
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 2e-07
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 3e-07
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 5e-07
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 1e-06
2epa_A72 Krueppel-like factor 10; transforming growth facto 4e-06
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 7e-06
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 1e-05
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 4e-05
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 5e-05
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 3e-04
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 6e-04
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-04
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
 Score = 65.9 bits (162), Expect = 6e-16
 Identities = 26/71 (36%), Positives = 35/71 (49%), Gaps = 1/71 (1%)

Query: 27 KPYACEECGKAFRKKFSLTMHQRHVHLNDRRYQCDLCLARFVTNSSLIVHKQRHDNTPRF 86
           P+ CE CGK F +K  L  H R  H   + Y+C  C      +SSL  H + H +   F
Sbjct: 7  GPHKCEVCGKCFSRKDKLKTHMR-CHTGVKPYKCKTCDYAAADSSSLNKHLRIHSDERPF 65

Query: 87 KCKLCPKMFTN 97
          KC++CP    N
Sbjct: 66 KCQICPYASRN 76


>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Length = 48 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query100
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.92
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.92
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.91
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.89
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.89
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.89
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.88
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.86
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.85
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.85
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.85
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.85
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.85
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.84
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.84
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.84
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.83
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.83
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.83
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.83
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.82
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.82
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.81
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.81
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.8
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.8
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.8
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.8
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.79
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.79
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.78
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.77
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.77
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.76
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.76
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.76
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.75
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.74
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.74
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.74
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.74
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.74
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.73
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.73
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.72
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.72
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.72
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.71
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.71
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.69
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.69
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.67
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.65
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.65
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.65
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.63
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.62
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.61
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.61
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.59
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.59
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.58
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.58
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.56
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.56
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.55
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.54
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.52
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.52
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.52
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.52
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.51
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.51
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.5
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.5
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.5
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.5
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.5
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.5
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.5
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.5
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.5
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.5
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.5
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.5
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.5
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.5
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.5
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.5
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.5
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.5
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.5
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.5
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.5
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.5
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.49
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.49
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.49
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.49
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.49
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.49
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.49
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.49
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.49
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.49
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.49
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.49
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.49
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.49
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.49
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.49
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.49
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.49
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.49
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.49
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.49
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.49
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.49
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.49
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.49
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.49
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.49
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.49
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.49
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.49
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.49
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.49
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.49
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.49
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.49
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.49
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.48
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.48
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.48
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.48
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.48
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.48
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.48
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.48
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.48
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.48
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.48
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.48
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.48
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.48
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.48
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.48
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.48
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.48
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.48
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.48
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.48
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.48
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.48
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.47
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.47
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.47
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.47
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.47
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.47
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.47
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.47
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.47
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.46
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.46
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.46
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.46
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.46
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.46
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.45
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.45
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.45
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.45
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.45
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.45
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.45
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.44
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.43
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.43
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.43
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.42
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.41
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.41
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.41
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.4
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.4
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.4
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.4
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.4
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.4
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.4
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.4
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.4
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.4
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.4
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.4
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.4
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.4
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.4
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.4
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.39
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.39
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.39
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.39
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.39
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.39
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.39
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.39
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.39
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.39
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.39
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.38
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.38
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.38
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.38
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.38
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.38
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.38
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.38
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.38
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.38
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.38
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.38
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.38
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.38
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.37
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.37
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.37
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.37
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.37
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.37
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.37
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.37
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.37
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.37
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.37
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.37
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.37
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.37
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.36
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.36
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.36
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.35
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.35
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.35
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.35
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.35
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.35
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.35
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.35
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.35
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.35
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.35
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.35
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.34
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.34
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.34
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.34
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.33
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.33
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.33
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.33
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.33
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.33
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.33
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.33
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.33
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.32
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.32
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 99.32
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.32
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.32
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 99.31
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.3
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 99.3
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.3
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 99.3
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 99.3
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 99.3
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.29
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.29
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 99.28
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 99.28
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.26
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.25
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 99.23
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.23
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 99.22
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 99.21
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.18
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 99.15
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 99.15
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 99.11
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 99.05
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 99.05
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.04
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 99.03
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 99.02
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.01
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 99.01
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.0
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 98.97
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.95
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.93
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.92
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.92
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.92
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.91
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.88
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.87
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.87
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.87
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.85
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.84
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.84
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.81
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.81
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.78
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.78
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.78
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.77
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.76
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.75
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.74
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.74
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.72
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.71
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.71
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.71
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.7
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.7
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.69
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.69
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.65
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.65
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.65
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.63
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.61
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.6
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.59
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.59
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.58
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.58
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.56
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.54
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.52
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.51
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.51
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.9
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.5
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.5
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.48
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.86
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.47
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.46
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.45
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.45
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.44
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.43
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.43
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.41
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.39
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.39
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.37
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.73
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.7
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.34
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.3
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.6
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.55
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 98.19
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 98.11
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.88
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 97.22
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 97.15
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 96.62
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 96.57
2e72_A49 POGO transposable element with ZNF domain; zinc fi 96.39
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 96.13
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 95.52
2e72_A49 POGO transposable element with ZNF domain; zinc fi 95.51
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 95.32
2k5c_A95 Uncharacterized protein PF0385; structural genomic 94.2
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 94.14
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 91.22
2gmg_A105 Hypothetical protein PF0610; winged-helix like pro 91.15
1yuz_A202 Nigerythrin; rubrythrin, rubredoxin, hemerythrin, 91.0
2elu_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 90.67
3pwf_A170 Rubrerythrin; non heme iron peroxidases, oxidative 89.56
2jvx_A28 NF-kappa-B essential modulator; CCHC classical zin 88.72
2kdx_A119 HYPA, hydrogenase/urease nickel incorporation prot 88.16
1lko_A191 Rubrerythrin all-iron(II) form; reduced form, DIIR 86.48
2yrk_A55 Zinc finger homeobox protein 4; structure genomics 85.85
2yuc_A76 TNF receptor-associated factor 4; ZF-TRAF, cystein 84.98
2jsp_A87 Transcriptional regulatory protein ROS; prokaryoti 84.78
1fu9_A36 U-shaped transcriptional cofactor; zinc-finger, be 84.43
4ayb_P48 DNA-directed RNA polymerase; transferase, multi-su 83.16
2odx_A80 Cytochrome C oxidase polypeptide IV; all beta-prot 82.93
1twf_L70 ABC10-alpha, DNA-directed RNA polymerases I, II, a 82.88
2i5o_A39 DNA polymerase ETA; zinc finger, DNA polymerase,PO 82.31
1v54_F98 VI, cytochrome C oxidase polypeptide VB; oxidoredu 81.75
3h0g_L63 DNA-directed RNA polymerases I, II, and III subuni 81.52
1wir_A121 Protein arginine N-methyltransferase 3; C2H2 zinc 80.76
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
Probab=99.92  E-value=2.5e-26  Score=121.94  Aligned_cols=95  Identities=20%  Similarity=0.278  Sum_probs=77.7

Q ss_pred             cchHHHHHHHHHHHHhccccccCCCceeCchhhhhccChhHHHHHHhhhcCCCCCccCccccccccChhHHHHHHHhcCC
Q psy14147          3 VRSREVMEIQKDVVQSFPIILYCVKPYACEECGKAFRKKFSLTMHQRHVHLNDRRYQCDLCLARFVTNSSLIVHKQRHDN   82 (100)
Q Consensus         3 ~~~~~~~~~~~~~l~~h~~~~~~~~~~~c~~C~~~f~~~~~l~~h~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~   82 (100)
                      +..++..|.....|..|+++|.+++||.|++|++.|.....|..|+ ..|++++||.|++|++.|.....|..|++.+++
T Consensus        25 C~~C~k~F~~~~~L~~H~~~H~~~k~~~C~~C~k~F~~~~~L~~H~-~~H~~~k~~~C~~C~k~F~~~~~L~~H~~~hh~  103 (133)
T 2lt7_A           25 CIVCKRSYVCLTSLRRHFNIHSWEKKYPCRYCEKVFPLAEYRTKHE-IHHTGERRYQCLACGKSFINYQFMSSHIKSVHS  103 (133)
T ss_dssp             ETTTCCEESCHHHHHHHHHHHHCCSCEECSSSSCEESSHHHHHHHH-HHHHTCCCEEESSSCCEESSHHHHHHHHHHHTC
T ss_pred             CCCCCCCcCCHHHHHHHHHHcCCCCCeeCCccCeecccccchhhhc-cccCCCccccCCCCCCCcCCHHHHHHHhHHhcC
Confidence            4567788888888888888888888888888888888888888888 478888888888888888888888888888776


Q ss_pred             CC------CeecCCCccccCCC
Q psy14147         83 TP------RFKCKLCPKMFTNT   98 (100)
Q Consensus        83 ~~------~~~C~~C~~~f~~~   98 (100)
                      ++      +|.|..|++.|..+
T Consensus       104 ~~p~~~~k~~~C~~C~k~~~~~  125 (133)
T 2lt7_A          104 QDPSGDSKLYRLHPCRSLQIRQ  125 (133)
T ss_dssp             CCTTSSSCCEEECCCCSSCCCC
T ss_pred             CCCCCCCCCeecCCCCchhhhc
Confidence            53      47788888877653



>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>2k5c_A Uncharacterized protein PF0385; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Pyrococcus furiosus} Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2gmg_A Hypothetical protein PF0610; winged-helix like protein with metal binding site, structura genomics, PSI, protein structure initiative; NMR {Pyrococcus furiosus} SCOP: a.4.5.82 Back     alignment and structure
>1yuz_A Nigerythrin; rubrythrin, rubredoxin, hemerythrin, electron transfer, DIIR center, oxidoreductase; 1.40A {Desulfovibrio vulgaris subsp} SCOP: a.25.1.1 g.41.5.1 PDB: 1yv1_A 1yux_A Back     alignment and structure
>2elu_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2elw_A Back     alignment and structure
>3pwf_A Rubrerythrin; non heme iron peroxidases, oxidative stress, oxidoreductase; 1.64A {Pyrococcus furiosus} PDB: 3mps_A 3pza_A 3qvd_A 1nnq_A 2hr5_A Back     alignment and structure
>2jvx_A NF-kappa-B essential modulator; CCHC classical zinc finger, NEMO zinc finger, beta-BETA- alpha fold, coiled coil, cytoplasm, disease mutation; NMR {Synthetic} PDB: 2jvy_A Back     alignment and structure
>2kdx_A HYPA, hydrogenase/urease nickel incorporation protein HYPA; metallochaperone, metal-binding, metal- binding protein; NMR {Helicobacter pylori} Back     alignment and structure
>1lko_A Rubrerythrin all-iron(II) form; reduced form, DIIRON, four-helix bundle, rubre like, electron transport; 1.63A {Desulfovibrio vulgaris} SCOP: a.25.1.1 g.41.5.1 PDB: 1dvb_A 1jyb_A 1b71_A 1lkm_A 1lkp_A 1qyb_A 1s2z_A 1s30_A 1ryt_A Back     alignment and structure
>2yrk_A Zinc finger homeobox protein 4; structure genomics, ZF-C2H2 domain, ZFH-4, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.37.1.4 Back     alignment and structure
>2yuc_A TNF receptor-associated factor 4; ZF-TRAF, cysteine-rich domain associated with ring and TRAF domains protein 1, malignant 62; NMR {Homo sapiens} Back     alignment and structure
>2jsp_A Transcriptional regulatory protein ROS; prokaryotic Cys2His2 zinc finger, gene regulation; NMR {Agrobacterium tumefaciens} Back     alignment and structure
>1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A Back     alignment and structure
>4ayb_P DNA-directed RNA polymerase; transferase, multi-subunit, transcription; 3.20A {Sulfolobus shibatae} PDB: 2pmz_P 2wb1_P 2y0s_P 3hkz_P 2waq_P 4b1o_P 4b1p_X Back     alignment and structure
>2odx_A Cytochrome C oxidase polypeptide IV; all beta-protein, metallo-protein, oxidoreductase; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1twf_L ABC10-alpha, DNA-directed RNA polymerases I, II, and III 7.7 K polypeptide; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: g.41.9.2 PDB: 1i3q_L 1i6h_L 1k83_L* 1nik_L 1nt9_L 1pqv_L 1r5u_L 1r9s_L* 1r9t_L* 1sfo_L* 1twa_L* 1twc_L* 1i50_L* 1twg_L* 1twh_L* 1wcm_L 1y1v_L 1y1w_L 1y1y_L 1y77_L* ... Back     alignment and structure
>2i5o_A DNA polymerase ETA; zinc finger, DNA polymerase,POL ETA, UBZ, ubiquitin-binding zinc finger, translesion synthesis, ubiquitin-binding domain; HET: DNA; NMR {Homo sapiens} Back     alignment and structure
>1v54_F VI, cytochrome C oxidase polypeptide VB; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: g.41.5.3 PDB: 1oco_F* 1occ_F* 1ocz_F* 1ocr_F* 1v55_F* 2dyr_F* 2dys_F* 2eij_F* 2eik_F* 2eil_F* 2eim_F* 2ein_F* 2occ_F* 2ybb_Q* 2zxw_F* 3abk_F* 3abl_F* 3abm_F* 3ag1_F* 3ag2_F* ... Back     alignment and structure
>3h0g_L DNA-directed RNA polymerases I, II, and III subunit rpabc4; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Back     alignment and structure
>1wir_A Protein arginine N-methyltransferase 3; C2H2 zinc finger domain, PRMT3, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.37.1.5 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 100
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 2e-10
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 9e-08
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 2e-07
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 2e-07
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 3e-07
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 7e-07
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 2e-06
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 0.002
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 5e-06
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 5e-06
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 6e-06
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 2e-05
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 4e-05
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 5e-05
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 5e-05
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 9e-05
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 1e-04
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 4e-04
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 0.004
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 4e-04
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: PATZ1
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 49.2 bits (118), Expect = 2e-10
 Identities = 14/36 (38%), Positives = 22/36 (61%)

Query: 27 KPYACEECGKAFRKKFSLTMHQRHVHLNDRRYQCDL 62
          KPY C+ CGK F +   L  H + VH ++R ++C +
Sbjct: 4  KPYICQSCGKGFSRPDHLNGHIKQVHTSERPHKCQV 39


>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query100
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.76
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.68
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.5
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.5
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.46
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.43
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.42
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.34
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.33
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.31
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.3
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.28
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.28
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.27
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.26
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.24
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 99.24
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.21
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.21
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.19
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.17
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.15
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.13
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 99.12
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 99.1
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.09
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 99.05
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.05
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.98
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.95
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.93
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.84
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.8
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.74
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.73
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.68
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.66
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.6
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.59
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.51
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.49
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.45
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.44
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.41
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.4
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.34
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.32
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.32
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.31
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.26
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 98.16
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 98.04
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.03
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.84
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.78
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.74
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.69
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.68
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.65
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.59
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.57
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.56
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.53
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.53
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.52
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.48
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.47
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.43
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.41
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.37
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.31
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.3
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.3
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.29
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.28
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.25
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.13
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.07
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.07
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.95
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.92
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 96.83
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.72
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.72
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 96.7
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 96.48
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 96.26
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 96.22
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 95.93
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 95.78
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 95.53
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 95.34
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 95.25
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 95.1
d1y0jb136 U-shaped transcription factor, different fingers { 95.02
d1nnqa237 Rubrerythrin, C-terminal domain {Archaeon Pyrococc 94.46
d1yuza236 Nigerythrin, C-terminal domain {Desulfovibrio vulg 94.44
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 93.57
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 93.53
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 92.54
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 91.17
d2ak3a237 Microbial and mitochondrial ADK, insert "zinc fing 91.02
d2dlka130 Zinc finger protein 692, ZNF692 {Human (Homo sapie 90.27
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 88.24
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 88.06
d1d4ua236 DNA repair factor XPA DNA- and RPA-binding domain, 87.84
d1akya238 Microbial and mitochondrial ADK, insert "zinc fing 87.5
d1x3ca161 Zinc finger protein 292, ZNF292 {Human (Homo sapie 86.89
d1tf3a331 Transcription factor IIIA, TFIIIA {Xenopus laevis 86.2
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 86.04
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 83.47
d1zina235 Microbial and mitochondrial ADK, insert "zinc fing 82.76
d1wjpa341 Zinc finger protein 295, ZNF295 {Human (Homo sapie 81.78
d1e4va235 Microbial and mitochondrial ADK, insert "zinc fing 81.39
d2ghfa158 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 80.29
d1s3ga235 Microbial and mitochondrial ADK, insert "zinc fing 80.19
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.76  E-value=3.6e-19  Score=79.30  Aligned_cols=53  Identities=36%  Similarity=0.696  Sum_probs=49.2

Q ss_pred             CCceeCchhhhhccChhHHHHHHhhhcCCCCCccCccccccccChhHHHHHHHhc
Q psy14147         26 VKPYACEECGKAFRKKFSLTMHQRHVHLNDRRYQCDLCLARFVTNSSLIVHKQRH   80 (100)
Q Consensus        26 ~~~~~c~~C~~~f~~~~~l~~h~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~   80 (100)
                      +|||.| .||+.|.....|..|+ ..|++++||.|..|+++|.....|..|+++|
T Consensus         1 EK~y~C-~Cgk~F~~~~~l~~H~-~~Ht~ekpy~C~~C~k~F~~~~~L~~H~r~H   53 (53)
T d2csha1           1 DKLYPC-QCGKSFTHKSQRDRHM-SMHLGLRPYGCGVCGKKFKMKHHLVGHMKIH   53 (53)
T ss_dssp             CCCEEC-TTSCEESSHHHHHHHH-HHHSCCCSEECTTTSCEESSSHHHHHHHTTT
T ss_pred             CcCCCC-CCCCeECCHHHhHHHh-hccccccCCcCCCcCCEecCHHHHHHHHhcC
Confidence            589999 5999999999999999 4999999999999999999999999999876



>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ak3a2 g.41.2.1 (A:125-161) Microbial and mitochondrial ADK, insert "zinc finger" domain {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d2dlka1 g.37.1.1 (A:8-37) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1d4ua2 g.39.1.5 (A:1-36) DNA repair factor XPA DNA- and RPA-binding domain, N-terminal subdomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1akya2 g.41.2.1 (A:131-168) Microbial and mitochondrial ADK, insert "zinc finger" domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x3ca1 g.37.1.1 (A:8-68) Zinc finger protein 292, ZNF292 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a3 g.37.1.1 (A:71-101) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1zina2 g.41.2.1 (A:126-160) Microbial and mitochondrial ADK, insert "zinc finger" domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1wjpa3 g.37.1.1 (A:67-107) Zinc finger protein 295, ZNF295 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e4va2 g.41.2.1 (A:122-156) Microbial and mitochondrial ADK, insert "zinc finger" domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s3ga2 g.41.2.1 (A:126-160) Microbial and mitochondrial ADK, insert "zinc finger" domain {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure