Psyllid ID: psy14202


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350------
MDNTYMFFHPSFREWLIRRDEGESNKFLCDLRAGHAGIAFRLSRLQAPLDADKSLELGHHILKAHVYKNMTLVKYSSRDLQAHWISSVCQSPAQALCSLRNVYSPNVKVSRLLLLSGADANHITEFLGAAPALCLFAHEGNSEMIALLLEFHACIDLANSQGRTPLSLAAGRGHMEAVRTLVAAGASLGRTDTTGRCALVHAARGGHLQNLSPLMLAVKEGHWATAEKLLQHHAPLDQTDGSHKTPLMIAAQEGHVGLLELLLDKGADILREDGEGLTALSWACMRGRIQAVTYLLDRDRGAMIEHVDINGLRPLDRAISCRNVPVVQCFLRKGAKLGPTTWSMAAGKPEVMENFD
cccccccccHHHHHHHHHcccccccHHHHHHHccHHHHHHHHHHccccccHHccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHcccccHHHHHHHHHccccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHccHHHHHHHHHHccccccccccccccHHHHHHHccccccHHHHHHHHHccHHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHcccccccccccccccccHHHHHHHcccHHHHHHHHHccccccHHHHHHHcccHHHHHccc
ccccHccccHHHHHHHHHcccccccHHHHHHHcccHHHHHHHHHccccccHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHccccccHHHHHHHcccHHHHHHHHHccccccccccccccccHHHHHHHHccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHcHHHHHHHHccHHHHHHHHHHcccccccccccccHHHHHHHHccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccccHHHHHHHcccHHHHHHHHHccccccccHHHHHccccHHHHHcc
mdntymffhpsFREWLIrrdegesnkflCDLRAGHAGIAFRLSRlqapldadkslELGHHILKAHVYKNMTLVKYSSRDLQAHWISSVCQSPAQALCSlrnvyspnvkVSRLLLLSGADANHITEFLGAAPALCLFAHEGNSEMIALLLEFHACIDlansqgrtplslaagRGHMEAVRTLVAAGaslgrtdttgRCALVHaargghlqnlsPLMLAVKEGHWATAEKLLQhhapldqtdgshktplMIAAQEGHVGLLELLLDKGADILREDGEGLTALSWACMRGRIQAVTYLLDrdrgamiehvdinglrpldraiscrnvPVVQCFlrkgaklgpttwsmaagkpevmenfd
mdntymffhpsfreWLIRRDEGESNKFLCDLRAGHAGIAFRLSRLQAPLDADKSLELGHHILKAHVYKNMTLVKYSSRDLQAHWISSVCQSPAQALCSLRNVYSPNVKVSRLLLLSGADANHITEFLGAAPALCLFAHEGNSEMIALLLEFHACIDLANSQGRTPLSLAAGRGHMEAVRTLVAAGASLGRTDTTGRCALVHAARGGHLQNLSPLMLAVKEGHWATAEKLLQHHAPLDQTDGSHKTPLMIAAQEGHVGLLELLLDKGADILREDGEGLTALSWACMRGRIQAVTYLLDRDRGAMIEHVDINGLRPLDRAISCRNVPVVQCFLrkgaklgpttwsmaagkpevmenfd
MDNTYMFFHPSFREWLIRRDEGESNKFLCDLRAGHAGIAFRLSRLQAPLDADKSLELGHHILKAHVYKNMTLVKYSSRDLQAHWISSVCQSPAQALCSLRNVYSPNVKVSRLLLLSGADANHITEFLGAAPALCLFAHEGNSEMIALLLEFHACIDLANSQGRTPLSLAAGRGHMEAVRTLVAAGASLGRTDTTGRCALVHAARGGHLQNLSPLMLAVKEGHWATAEKLLQHHAPLDQTDGSHKTPLMIAAQEGHVGLLELLLDKGADILREDGEGLTALSWACMRGRIQAVTYLLDRDRGAMIEHVDINGLRPLDRAISCRNVPVVQCFLRKGAKLGPTTWSMAAGKPEVMENFD
****YMFFHPSFREWLIRRDEGESNKFLCDLRAGHAGIAFRLSRLQAPLDADKSLELGHHILKAHVYKNMTLVKYSSRDLQAHWISSVCQSPAQALCSLRNVYSPNVKVSRLLLLSGADANHITEFLGAAPALCLFAHEGNSEMIALLLEFHACIDLANSQGRTPLSLAAGRGHMEAVRTLVAAGASLGRTDTTGRCALVHAARGGHLQNLSPLMLAVKEGHWATAEKLLQHHA**********TPLMIAAQEGHVGLLELLLDKGADILREDGEGLTALSWACMRGRIQAVTYLLDRDRGAMIEHVDINGLRPLDRAISCRNVPVVQCFLRKGAKLGPTTW**************
MDNTYMFFHPSFREWLIRRDEGESNKFLCDLRAGHAGIAFRLSRLQAPLDADKSLELGHHILKAHVYKNMTLVKYSSRDLQAHWISSVCQSPAQALCSLRNVYSPNVKVSRLLLLSGADANHITEFLGAAPALCLFAHEGNSEMIALLLEFHACIDLANSQGRTPLSLAAGRGHMEAVRTLVAAGASLGRTDTTGRCALVHAARGGHLQNLSPLMLAVKEGHWATAEKLLQHHAPLDQTDGSHKTPLMIAAQEGHVGLLELLLDKGADILREDGEGLTALSWACMRGRIQAVTYLLDRDRGAMIEHVDINGLRPLDRAISCRNVPVVQCFLRKGAKLGPTTWSMAAGKPEVMENFD
MDNTYMFFHPSFREWLIRRDEGESNKFLCDLRAGHAGIAFRLSRLQAPLDADKSLELGHHILKAHVYKNMTLVKYSSRDLQAHWISSVCQSPAQALCSLRNVYSPNVKVSRLLLLSGADANHITEFLGAAPALCLFAHEGNSEMIALLLEFHACIDLANSQGRTPLSLAAGRGHMEAVRTLVAAGASLGRTDTTGRCALVHAARGGHLQNLSPLMLAVKEGHWATAEKLLQHHAPLDQTDGSHKTPLMIAAQEGHVGLLELLLDKGADILREDGEGLTALSWACMRGRIQAVTYLLDRDRGAMIEHVDINGLRPLDRAISCRNVPVVQCFLRKGAKLGPTTWSMAAGKPEVMENFD
MDNTYMFFHPSFREWLIRRDEGESNKFLCDLRAGHAGIAFRLSRLQAPLDADKSLELGHHILKAHVYKNMTLVKYSSRDLQAHWISSVCQSPAQALCSLRNVYSPNVKVSRLLLLSGADANHITEFLGAAPALCLFAHEGNSEMIALLLEFHACIDLANSQGRTPLSLAAGRGHMEAVRTLVAAGASLGRTDTTGRCALVHAARGGHLQNLSPLMLAVKEGHWATAEKLLQHHAPLDQTDGSHKTPLMIAAQEGHVGLLELLLDKGADILREDGEGLTALSWACMRGRIQAVTYLLDRDRGAMIEHVDINGLRPLDRAISCRNVPVVQCFLRKGAKLGPTTWSMAAGKPEVMENFD
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDNTYMFFHPSFREWLIRRDEGESNKFLCDLRAGHAGIAFRLSRLQAPLDADKSLELGHHILKAHVYKNMTLVKYSSRDLQAHWISSVCQSPAQALCSLRNVYSPNVKVSRLLLLSGADANHITEFLGAAPALCLFAHEGNSEMIALLLEFHACIDLANSQGRTPLSLAAGRGHMEAVRTLVAAGASLGRTDTTGRCALVHAARGGHLQNLSPLMLAVKEGHWATAEKLLQHHAPLDQTDGSHKTPLMIAAQEGHVGLLELLLDKGADILREDGEGLTALSWACMRGRIQAVTYLLDRDRGAMIEHVDINGLRPLDRAISCRNVPVVQCFLRKGAKLGPTTWSMAAGKPEVMENFD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query356 2.2.26 [Sep-21-2011]
Q6F6B3 1849 Protein TANC1 OS=Rattus n yes N/A 0.985 0.189 0.367 2e-71
Q9HCD6 1990 Protein TANC2 OS=Homo sap yes N/A 0.985 0.176 0.340 3e-63
A2A690 1994 Protein TANC2 OS=Mus musc yes N/A 0.985 0.176 0.340 6e-63
Q0VGY8 1856 Protein TANC1 OS=Mus musc no N/A 0.938 0.179 0.408 2e-60
Q9C0D5 1861 Protein TANC1 OS=Homo sap no N/A 0.938 0.179 0.411 1e-57
Q9ULJ7 1429 Ankyrin repeat domain-con no N/A 0.926 0.230 0.296 4e-27
Q9EQG6 1762 Kinase D-interacting subs no N/A 0.648 0.131 0.320 3e-21
Q9ULH0 1771 Kinase D-interacting subs no N/A 0.648 0.130 0.320 3e-21
Q12955 4377 Ankyrin-3 OS=Homo sapiens no N/A 0.682 0.055 0.315 2e-20
Q7T163 1672 Kinase D-interacting subs no N/A 0.651 0.138 0.304 5e-20
>sp|Q6F6B3|TANC1_RAT Protein TANC1 OS=Rattus norvegicus GN=Tanc1 PE=1 SV=1 Back     alignment and function desciption
 Score =  269 bits (688), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 176/479 (36%), Positives = 234/479 (48%), Gaps = 128/479 (26%)

Query: 2    DNTYMFFHPSFREWLIRRDEGESNKFLCDLRAGHAGIAFRLSRLQAPLDADKSLELGHHI 61
            D T MF HPSFREWL+ R +GES  FLC+ R GHA +AF  SR ++ L+  +++ELGHHI
Sbjct: 797  DKTRMFCHPSFREWLVWRADGESTAFLCEPRNGHALLAFMFSRQESKLNRQQTVELGHHI 856

Query: 62   LKAHVYKNMTL-VKYSSRDLQAHWISSVCQSPAQALCSLRNVYSPNVKVSRLLLLSGADA 120
            LKAH++K ++     SS   QA WI    +  + AL SLRN+Y+PNVKVSRLL+L GA+ 
Sbjct: 857  LKAHIFKGLSKKTGVSSSHPQALWIGYSTEGLSAALASLRNLYTPNVKVSRLLILGGANV 916

Query: 121  NHITEFLGAAPALCLFAHEGNSEMIALLLEFHACIDLANSQGRTPLSLAAGRGHMEAVRT 180
            N+ TE L  AP LC+ +H G+ E++ LLLEF AC+D  +  G   L  AA  GHM+ V  
Sbjct: 917  NYRTEVLNNAPILCVQSHLGHEEVVTLLLEFGACLDGMSENGMNALCYAAAAGHMKLVCL 976

Query: 181  LVAAGASLGRTDTTGRCALVHAARGGHLQNLSPLM------------------------- 215
            L   GA +   D  G+CALVH+A  GH   L  L+                         
Sbjct: 977  LTKKGARVDHLDKKGQCALVHSALRGHSDILQYLLNCEWSAGPPQPGTLRKSQALQQALT 1036

Query: 216  LAVKEGHWATAEKLL----QHHAPLDQTD------------GSHK--------------- 244
             A   GH A  + LL    +H   ++ TD            G  K               
Sbjct: 1037 AAASMGHSAVVQSLLGMAEEHEIEVNGTDTLWGETALTAAAGRGKLEICELLLERGAAVS 1096

Query: 245  -------TPLMIAAQEGHVGLLELLLDKGADILRE------------------------- 272
                    PL  AA++GH  +++LLLD+G D+                            
Sbjct: 1097 RANRRGVPPLFCAARQGHWQVVQLLLDRGCDVNPNDKQGRTPLMVAACEGHLSTVEFLLS 1156

Query: 273  --------DGEGLTALSWACMRGRIQAVTYLLDR-------------------------- 298
                    D EGL+ALSWAC++G    V YL++                           
Sbjct: 1157 KGAALSSLDKEGLSALSWACLKGHRAVVQYLVEEGAEIDQTDKNGRTPLDLAAFYGDAET 1216

Query: 299  -----DRGAMIEHVDINGLRPLDRAISCRNVPVVQCFLRKGAKLGPTTWSMAAGKPEVM 352
                 ++GA+IEHVD +G+RPLDRAI CRN  VV   LRKGAKLG   W+MA  KP+++
Sbjct: 1217 VLYLVEKGAVIEHVDHSGMRPLDRAIGCRNTAVVVTLLRKGAKLGNAAWAMATFKPDIL 1275




May be a scaffold component in the postsynaptic density.
Rattus norvegicus (taxid: 10116)
>sp|Q9HCD6|TANC2_HUMAN Protein TANC2 OS=Homo sapiens GN=TANC2 PE=1 SV=3 Back     alignment and function description
>sp|A2A690|TANC2_MOUSE Protein TANC2 OS=Mus musculus GN=Tanc2 PE=1 SV=1 Back     alignment and function description
>sp|Q0VGY8|TANC1_MOUSE Protein TANC1 OS=Mus musculus GN=Tanc1 PE=1 SV=2 Back     alignment and function description
>sp|Q9C0D5|TANC1_HUMAN Protein TANC1 OS=Homo sapiens GN=TANC1 PE=1 SV=3 Back     alignment and function description
>sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 Back     alignment and function description
>sp|Q9EQG6|KDIS_RAT Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 Back     alignment and function description
>sp|Q9ULH0|KDIS_HUMAN Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 Back     alignment and function description
>sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 Back     alignment and function description
>sp|Q7T163|KDIS_DANRE Kinase D-interacting substrate of 220 kDa OS=Danio rerio GN=kidins220 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query356
332023065 1495 Protein TANC2 [Acromyrmex echinatior] 0.985 0.234 0.473 1e-110
189235658 1523 PREDICTED: similar to rolling pebbles [T 0.985 0.230 0.471 1e-109
270003434 1709 hypothetical protein TcasGA2_TC002665 [T 0.985 0.205 0.471 1e-109
242022731 1474 rolling pebbles, putative [Pediculus hum 0.988 0.238 0.462 1e-109
307186499 1579 Protein TANC2 [Camponotus floridanus] 0.985 0.222 0.458 1e-101
157111504 1575 rolling pebbles [Aedes aegypti] gi|10887 0.980 0.221 0.452 6e-98
328703576 1369 PREDICTED: protein TANC2-like isoform 1 0.988 0.257 0.439 8e-98
328703574 1398 PREDICTED: protein TANC2-like isoform 2 0.988 0.251 0.439 1e-97
24663091 1900 rolling pebbles, isoform B [Drosophila m 0.988 0.185 0.443 4e-96
17980214 1900 rolling pebbles isoform 7 [Drosophila me 0.988 0.185 0.443 4e-96
>gi|332023065|gb|EGI63330.1| Protein TANC2 [Acromyrmex echinatior] Back     alignment and taxonomy information
 Score =  405 bits (1042), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 234/494 (47%), Positives = 281/494 (56%), Gaps = 143/494 (28%)

Query: 1    MDNTYMFFHPSFREWLIRRDEGESNKFLCDLRAGHAGIAFRLSRLQAPLDADKSLELGHH 60
            +DNTYMFFHPSFREWL+RRDEGES KFLCD R GHA IAFRLSRLQAPLD DK+LELGHH
Sbjct: 829  LDNTYMFFHPSFREWLMRRDEGESTKFLCDYRLGHAAIAFRLSRLQAPLDGDKALELGHH 888

Query: 61   ILKAHVYKNMTLVKYSSRDLQAHWISSVCQSPAQALCSLRNVYSPNVKVSRLLLLSGADA 120
            +LKAHVY+ +    + SRDLQA W++   +  + ALC+LRN+YSPNVKVSRLLLL+GA  
Sbjct: 889  VLKAHVYRGVAPC-WPSRDLQAIWLTLSTECISSALCTLRNIYSPNVKVSRLLLLAGASP 947

Query: 121  NHITEFLGAAPALCLFAHEGNSEMIALLLEFHACIDLANSQGRTPLSLAAGRGHMEAVRT 180
            NHITE+LG APALC++AHEG+ EM++LLLEF A ++L NSQG T LSLAA RGH + VR 
Sbjct: 948  NHITEYLGNAPALCMYAHEGSVEMVSLLLEFGADVELTNSQGCTALSLAAARGHCDVVRR 1007

Query: 181  LVAAGASLGRTDTTGRCALVHAARGGHLQNLSPLM------------------------- 215
            L AAGASLG  D  G+C+LVHAAR G L  +  L+                         
Sbjct: 1008 LAAAGASLGHVDMAGQCSLVHAARHGRLSVVGYLLACDWIPTSESKAESGVLEINREEAA 1067

Query: 216  -----LAVKEGHWATAEKLLQH-HAPLDQTD--------------GSHKT---------- 245
                  A  +GH A  E LL      +D+ D              GS  T          
Sbjct: 1068 QQAVVAAASQGHEAVVEYLLDMAEVIIDRPDTLIGETALTISAANGSTATVSALLARGAN 1127

Query: 246  ----------PLMIAAQEGHVGLLELLL-------------------------------- 263
                      PLM+AA+EGH G  E LL                                
Sbjct: 1128 PLVVNTKGLSPLMLAAKEGHWGTAERLLQGNLSSSMDTVSDETISLLEQRDLAGRTALML 1187

Query: 264  --------------DKGADILREDGEGLTALSWACMRGRIQAVTYLLDR----------- 298
                          DKG+ +  +D EGLTALSWAC+RGRI AV  LLDR           
Sbjct: 1188 AACEGHINLLELFLDKGSILKTKDKEGLTALSWACVRGRITAVQMLLDRGSDINTSDNSG 1247

Query: 299  --------------------DRGAMIEHVDINGLRPLDRAISCRNVPVVQCFLRKGAKLG 338
                                ++GA +EHVD++G+RPLDRAI CRN+PVVQCFLR+GAKLG
Sbjct: 1248 RTPLDLAAFQGNPKLVQLLLEKGAAVEHVDLHGMRPLDRAIGCRNIPVVQCFLRRGAKLG 1307

Query: 339  PTTWSMAAGKPEVM 352
            P TW+MAAGKP+V+
Sbjct: 1308 PATWAMAAGKPDVL 1321




Source: Acromyrmex echinatior

Species: Acromyrmex echinatior

Genus: Acromyrmex

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|189235658|ref|XP_969896.2| PREDICTED: similar to rolling pebbles [Tribolium castaneum] Back     alignment and taxonomy information
>gi|270003434|gb|EEZ99881.1| hypothetical protein TcasGA2_TC002665 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|242022731|ref|XP_002431792.1| rolling pebbles, putative [Pediculus humanus corporis] gi|212517117|gb|EEB19054.1| rolling pebbles, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|307186499|gb|EFN72069.1| Protein TANC2 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|157111504|ref|XP_001651596.1| rolling pebbles [Aedes aegypti] gi|108878365|gb|EAT42590.1| AAEL005908-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|328703576|ref|XP_001948244.2| PREDICTED: protein TANC2-like isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328703574|ref|XP_003242242.1| PREDICTED: protein TANC2-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|24663091|ref|NP_729778.1| rolling pebbles, isoform B [Drosophila melanogaster] gi|23096148|gb|AAF49967.2| rolling pebbles, isoform B [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|17980214|gb|AAL50557.1| rolling pebbles isoform 7 [Drosophila melanogaster] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query356
FB|FBgn0041096 1900 rols "rolling pebbles" [Drosop 0.915 0.171 0.501 8.3e-73
UNIPROTKB|F1NP45 1341 TANC2 "Uncharacterized protein 0.946 0.251 0.409 8.9e-55
UNIPROTKB|Q9HCD6 1990 TANC2 "Protein TANC2" [Homo sa 0.946 0.169 0.403 8.4e-54
UNIPROTKB|E1C607 1823 TANC1 "Uncharacterized protein 0.910 0.177 0.402 9.2e-54
MGI|MGI:1914110 1856 Tanc1 "tetratricopeptide repea 0.907 0.174 0.404 1.2e-53
RGD|1302949 1849 Tanc1 "tetratricopeptide repea 0.921 0.177 0.401 1.5e-53
UNIPROTKB|F1RRV1 1916 TANC2 "Uncharacterized protein 0.946 0.175 0.403 1.6e-53
UNIPROTKB|F1MSK0 1989 TANC2 "Uncharacterized protein 0.946 0.169 0.403 1.7e-53
UNIPROTKB|F1LTE0 1922 Tanc2 "Protein Tanc2" [Rattus 0.946 0.175 0.403 2.1e-53
RGD|1309285 1932 Tanc2 "tetratricopeptide repea 0.946 0.174 0.403 2.1e-53
FB|FBgn0041096 rols "rolling pebbles" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 749 (268.7 bits), Expect = 8.3e-73, P = 8.3e-73
 Identities = 172/343 (50%), Positives = 218/343 (63%)

Query:     1 MDNTYMFFHPSFREWLIRRDEGESNKFLCDLRAGHAGIAFRLSRLQAPLDADKSLELGHH 60
             +DNTYMFFH S REWL+RRDEGESNKFLCD R GHAGIAFRLSRLQAPL    +LELGHH
Sbjct:  1250 LDNTYMFFHSSLREWLMRRDEGESNKFLCDARLGHAGIAFRLSRLQAPLSPQLTLELGHH 1309

Query:    61 ILKAHVYKNMTLVKYSSRDLQAHWISSVCQSPAQALCSLRNVYSPNVKVSRLLLLSGADA 120
             +LKAH+Y   +L   S RDLQ++W++    + + +L +LRNVYSPN+KVSRL+LL+GA  
Sbjct:  1310 MLKAHLYGGTSLTLLSPRDLQSYWLAGAADNISSSLGALRNVYSPNLKVSRLVLLAGASP 1369

Query:   121 NHITEFLGAAPALCLFAHEGNSEMIALLLEFHACIDLANSQGRTPLSLAAGRGHMEAVRT 180
             NH T+++G AP LC+ AHEG   M++LLLEF A + L NSQG TPL LAA RGH + VR 
Sbjct:  1370 NHRTDYMGGAPILCIAAHEGILPMVSLLLEFGADVGLTNSQGCTPLILAAMRGHCDVVRP 1429

Query:   181 LVAAGASLGRTDTTGRCALVHAARGGHLQNLSPLMLAVKEGHWATAEKLLQHHAPLDQTD 240
             LVAAG+SLG+ D T RCALVHAAR GHL  +  L+       W+       H   + ++ 
Sbjct:  1430 LVAAGSSLGQLDITQRCALVHAARMGHLSVVKYLLAC----DWSPRP----HSQDVTRSV 1481

Query:   241 GSHKTPLMIAAQEGHVGLLELLLDKGA-----DIL-REDGEGLTALSWACMRGRIQAVTY 294
                +  L+ AA + H  +LE LLD        D+   E   G  AL+ A   G I  V  
Sbjct:  1482 ALQQA-LIGAAAQAHCKILEDLLDLNETEFDLDVNGMEPSSGELALTAAARHGCIDVVGI 1540

Query:   295 LLDRDRGAMIEHVDINGLRPLDRAISCRNVPVVQCFLRKGAKL 337
             LL R  GA I+  +  G   L  A+   +  VV+  L++GA L
Sbjct:  1541 LLSR--GAQIDARNRQGYSALWLAVKEGHWSVVEHLLQRGALL 1581


GO:0007520 "myoblast fusion" evidence=IMP;NAS;TAS
GO:0005515 "protein binding" evidence=IPI
GO:0005737 "cytoplasm" evidence=IDA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0005912 "adherens junction" evidence=IDA
GO:0009986 "cell surface" evidence=IDA
GO:0007298 "border follicle cell migration" evidence=IMP
GO:0061327 "anterior Malpighian tubule development" evidence=IMP
UNIPROTKB|F1NP45 TANC2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q9HCD6 TANC2 "Protein TANC2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1C607 TANC1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:1914110 Tanc1 "tetratricopeptide repeat, ankyrin repeat and coiled-coil containing 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1302949 Tanc1 "tetratricopeptide repeat, ankyrin repeat and coiled-coil containing 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1RRV1 TANC2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1MSK0 TANC2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1LTE0 Tanc2 "Protein Tanc2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
RGD|1309285 Tanc2 "tetratricopeptide repeat, ankyrin repeat and coiled-coil containing 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query356
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 6e-28
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-26
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 9e-22
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 6e-19
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 7e-19
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 5e-18
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 3e-16
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 3e-15
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 1e-12
PHA02874 434 PHA02874, PHA02874, ankyrin repeat protein; Provis 2e-12
PHA02875 413 PHA02875, PHA02875, ankyrin repeat protein; Provis 8e-12
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 3e-11
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 1e-10
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-09
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 1e-09
PHA03100 422 PHA03100, PHA03100, ankyrin repeat protein; Provis 2e-09
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 4e-09
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 5e-09
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 1e-08
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 6e-08
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 7e-08
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 2e-06
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 2e-06
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 2e-06
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 6e-06
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 6e-06
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 7e-06
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 3e-05
pfam0002333 pfam00023, Ank, Ankyrin repeat 3e-05
PHA02874 434 PHA02874, PHA02874, ankyrin repeat protein; Provis 6e-05
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 7e-05
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 8e-05
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 2e-04
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 3e-04
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 4e-04
pfam0002333 pfam00023, Ank, Ankyrin repeat 5e-04
smart0024830 smart00248, ANK, ankyrin repeats 6e-04
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 0.002
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 0.002
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 0.002
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 0.004
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
 Score =  105 bits (264), Expect = 6e-28
 Identities = 50/141 (35%), Positives = 72/141 (51%), Gaps = 15/141 (10%)

Query: 156 DLANSQGRTPLSLAAGRGHMEAVRTLVAAGASLGRTDTTGRCALVHAARGGHLQNLSPLM 215
           +  +  GRTPL LAA  GH+E V+ L+  GA +   D  GR               +PL 
Sbjct: 1   NARDEDGRTPLHLAASNGHLEVVKLLLENGADVNAKDNDGR---------------TPLH 45

Query: 216 LAVKEGHWATAEKLLQHHAPLDQTDGSHKTPLMIAAQEGHVGLLELLLDKGADILREDGE 275
           LA K GH    + LL+  A ++  D    TPL +AA+ G++ +++LLL  GAD+   D +
Sbjct: 46  LAAKNGHLEIVKLLLEKGADVNARDKDGNTPLHLAARNGNLDVVKLLLKHGADVNARDKD 105

Query: 276 GLTALSWACMRGRIQAVTYLL 296
           G T L  A   G ++ V  LL
Sbjct: 106 GRTPLHLAAKNGHLEVVKLLL 126


The number of ANK repeats in a protein can range from 2 to over 20 (ankyrins, for example). ANK repeats may occur in combinations with other types of domains. The structural repeat unit contains two antiparallel helices and a beta-hairpin, repeats are stacked in a superhelical arrangement; this alignment contains 4 consecutive repeats. Length = 126

>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 356
PHA02876 682 ankyrin repeat protein; Provisional 100.0
PHA03100 480 ankyrin repeat protein; Provisional 100.0
PHA02946446 ankyin-like protein; Provisional 100.0
PHA02876 682 ankyrin repeat protein; Provisional 100.0
PHA03095 471 ankyrin-like protein; Provisional 100.0
PHA02946446 ankyin-like protein; Provisional 100.0
PHA02874434 ankyrin repeat protein; Provisional 100.0
PHA03095 471 ankyrin-like protein; Provisional 100.0
PHA02874434 ankyrin repeat protein; Provisional 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
KOG0510|consensus 929 100.0
PHA03100 480 ankyrin repeat protein; Provisional 100.0
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 100.0
PHA02875 413 ankyrin repeat protein; Provisional 100.0
PHA02730 672 ankyrin-like protein; Provisional 100.0
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
PHA02917 661 ankyrin-like protein; Provisional 100.0
KOG0510|consensus 929 100.0
PHA02730 672 ankyrin-like protein; Provisional 100.0
PHA02878 477 ankyrin repeat protein; Provisional 100.0
PHA02989 494 ankyrin repeat protein; Provisional 100.0
PHA02989 494 ankyrin repeat protein; Provisional 100.0
KOG0508|consensus 615 100.0
PHA02875 413 ankyrin repeat protein; Provisional 100.0
PHA02878 477 ankyrin repeat protein; Provisional 100.0
KOG4412|consensus226 100.0
KOG4412|consensus226 100.0
KOG4177|consensus 1143 100.0
PHA02798 489 ankyrin-like protein; Provisional 100.0
PHA02917 661 ankyrin-like protein; Provisional 100.0
KOG4177|consensus 1143 100.0
PHA02798 489 ankyrin-like protein; Provisional 100.0
KOG0509|consensus 600 100.0
PHA02792 631 ankyrin-like protein; Provisional 100.0
PHA02795 437 ankyrin-like protein; Provisional 100.0
KOG0509|consensus 600 100.0
PHA02859209 ankyrin repeat protein; Provisional 99.98
KOG0508|consensus 615 99.98
PHA02795 437 ankyrin-like protein; Provisional 99.97
PHA02792 631 ankyrin-like protein; Provisional 99.97
PHA02859209 ankyrin repeat protein; Provisional 99.97
PLN03192823 Voltage-dependent potassium channel; Provisional 99.95
KOG0514|consensus452 99.94
KOG4369|consensus 2131 99.94
KOG0502|consensus296 99.94
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.94
PLN03192 823 Voltage-dependent potassium channel; Provisional 99.94
KOG0502|consensus296 99.93
KOG0505|consensus 527 99.92
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.92
PHA02743166 Viral ankyrin protein; Provisional 99.91
PHA02743166 Viral ankyrin protein; Provisional 99.91
KOG0507|consensus 854 99.91
KOG0507|consensus 854 99.91
PHA02884300 ankyrin repeat protein; Provisional 99.9
PHA02741169 hypothetical protein; Provisional 99.88
KOG0505|consensus 527 99.88
PHA02741169 hypothetical protein; Provisional 99.88
PHA02884 300 ankyrin repeat protein; Provisional 99.88
KOG0514|consensus452 99.88
KOG4369|consensus 2131 99.86
PHA02736154 Viral ankyrin protein; Provisional 99.86
PHA02736154 Viral ankyrin protein; Provisional 99.85
KOG0512|consensus228 99.84
KOG0512|consensus228 99.83
KOG3676|consensus 782 99.8
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.79
KOG3676|consensus 782 99.78
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.78
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.77
KOG0195|consensus 448 99.77
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.77
KOG0195|consensus 448 99.72
KOG4214|consensus117 99.65
KOG4214|consensus117 99.59
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.58
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.57
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.51
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.49
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.49
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.46
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.46
KOG0515|consensus752 99.46
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.46
KOG1710|consensus 396 99.42
KOG0515|consensus752 99.41
KOG1710|consensus 396 99.37
PF1360630 Ank_3: Ankyrin repeat 98.94
KOG0506|consensus622 98.92
PF1360630 Ank_3: Ankyrin repeat 98.9
KOG0783|consensus 1267 98.88
KOG0783|consensus 1267 98.85
KOG0818|consensus 669 98.84
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.8
KOG0782|consensus1004 98.79
KOG0506|consensus622 98.77
KOG3609|consensus 822 98.74
KOG0818|consensus 669 98.72
KOG0782|consensus1004 98.72
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.71
KOG0705|consensus749 98.61
KOG0705|consensus749 98.57
KOG3609|consensus 822 98.5
KOG0522|consensus 560 98.39
KOG0511|consensus 516 98.39
KOG0522|consensus 560 98.33
KOG0511|consensus 516 98.27
KOG0521|consensus785 98.14
KOG2384|consensus223 98.13
KOG2384|consensus223 98.13
KOG0521|consensus785 98.12
KOG0520|consensus 975 97.79
KOG0520|consensus 975 97.67
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 97.39
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 97.19
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 97.11
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 97.07
KOG2505|consensus591 96.95
KOG2505|consensus591 96.92
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 96.29
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 95.95
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 93.77
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 93.05
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
Probab=100.00  E-value=1.4e-42  Score=336.04  Aligned_cols=313  Identities=23%  Similarity=0.227  Sum_probs=187.7

Q ss_pred             CCCCcccccccccChHHHHHHHhhcCCCCCHHHHHHhHHHHHHHHHhcCCccccccc----------cc----------c
Q psy14202         21 EGESNKFLCDLRAGHAGIAFRLSRLQAPLDADKSLELGHHILKAHVYKNMTLVKYSS----------RD----------L   80 (356)
Q Consensus        21 ~~~~~~l~~A~~~g~~~iv~~Ll~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~----------~~----------~   80 (356)
                      ..+.||||.|++.||.++|+.|+++.+.+. ......|.++++.+..-+.-......          ..          .
T Consensus        39 ~~~~t~LH~A~~~g~~e~V~~ll~~~~~~~-~~~~~~~~tpLh~a~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~  117 (682)
T PHA02876         39 SIPFTAIHQALQLRQIDIVEEIIQQNPELI-YITDHKCHSTLHTICIIPNVMDIVISLTLDCDIILDIKYASIILNKHKL  117 (682)
T ss_pred             cccchHHHHHHHHHhhhHHHHHHHhCcccc-hhhchhhccccccccCCCCccccccccccchhhcccccHHHHHHHHHHH
Confidence            457899999999999999999999866522 12223344433322211000000000          00          0


Q ss_pred             --------c------hhHhhhhcCChhhhhhhhhhhcCCCHHHHHHHHHCCCCccccccccCCchHHHHHHHcCCHHHHH
Q psy14202         81 --------Q------AHWISSVCQSPAQALCSLRNVYSPNVKVSRLLLLSGADANHITEFLGAAPALCLFAHEGNSEMIA  146 (356)
Q Consensus        81 --------~------~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~~ll~~g~~~~~~~~~~~~~~~l~~A~~~g~~~~v~  146 (356)
                              .      ................+..++..++.+++++|++.|+++|..+.  .|.||||+|+..|+.++|+
T Consensus       118 ~~~~~~il~~~~~~~~~~~~~~~~~~~~~~~l~~~i~~~~~~i~k~Ll~~Gadvn~~d~--~G~TpLh~Aa~~G~~~iv~  195 (682)
T PHA02876        118 DEACIHILKEAISGNDIHYDKINESIEYMKLIKERIQQDELLIAEMLLEGGADVNAKDI--YCITPIHYAAERGNAKMVN  195 (682)
T ss_pred             HHHHHHHHHHHhcCCcccHHhhccchhhhHHHHHHHHCCcHHHHHHHHhCCCCCCCCCC--CCCCHHHHHHHCCCHHHHH
Confidence                    0      00000001112233445566777777777777777777776655  4667777777777777777


Q ss_pred             HHHhCCCCCCccCCC--------------------------------------------------------------CCc
Q psy14202        147 LLLEFHACIDLANSQ--------------------------------------------------------------GRT  164 (356)
Q Consensus       147 ~Ll~~~~~~~~~~~~--------------------------------------------------------------g~t  164 (356)
                      +|+++|++++..+..                                                              |.|
T Consensus       196 ~LL~~Gad~n~~~~~g~t~L~~A~~~~~~~ivk~Ll~~~~~~~~~~~~L~~ai~~~~~~~~~~Ll~~g~~vn~~d~~g~T  275 (682)
T PHA02876        196 LLLSYGADVNIIALDDLSVLECAVDSKNIDTIKAIIDNRSNINKNDLSLLKAIRNEDLETSLLLYDAGFSVNSIDDCKNT  275 (682)
T ss_pred             HHHHCCCCcCccCCCCCCHHHHHHHcCCHHHHHHHHhcCCCCCCCcHHHHHHHHcCCHHHHHHHHHCCCCCCCCCCCCCC
Confidence            777777766655544                                                              445


Q ss_pred             HHHHHHHCCCH-HHHHHHHHcCCCCCCCCCCCCcHHHHHHHcCCC-------------------CCChHHHHHHHc-CCH
Q psy14202        165 PLSLAAGRGHM-EAVRTLVAAGASLGRTDTTGRCALVHAARGGHL-------------------QNLSPLMLAVKE-GHW  223 (356)
Q Consensus       165 ~L~~A~~~g~~-~iv~~Ll~~g~~~~~~~~~~~t~l~~a~~~~~~-------------------~~~~~l~~a~~~-~~~  223 (356)
                      |||+|+..|+. +++++|++.|++++.+|..|.||||.|+..|..                   .|.||||.|+.. ++.
T Consensus       276 pLh~Aa~~~~~~~iv~lLl~~gadin~~d~~g~TpLh~Aa~~g~~~~~v~~Ll~~gadin~~d~~g~TpLh~A~~~~~~~  355 (682)
T PHA02876        276 PLHHASQAPSLSRLVPKLLERGADVNAKNIKGETPLYLMAKNGYDTENIRTLIMLGADVNAADRLYITPLHQASTLDRNK  355 (682)
T ss_pred             HHHHHHhCCCHHHHHHHHHHCCCCCCCcCCCCCCHHHHHHHhCCCHHHHHHHHHcCCCCCCcccCCCcHHHHHHHhCCcH
Confidence            55555555443 355555555555555555555555555554421                   145566666553 345


Q ss_pred             HHHHHHHhcCCCCCCCCCCCCcHHHHHHHcCcHHHHHHHHHCCCCCccCCCCCCcHHHHHHHcCC-HHHHHHhhhcCCCC
Q psy14202        224 ATAEKLLQHHAPLDQTDGSHKTPLMIAAQEGHVGLLELLLDKGADILREDGEGLTALSWACMRGR-IQAVTYLLDRDRGA  302 (356)
Q Consensus       224 ~~~~~Ll~~g~~~~~~~~~g~t~l~~a~~~~~~~~v~~Ll~~g~~~~~~~~~g~t~l~~a~~~~~-~~~v~~Ll~~~~~~  302 (356)
                      ++++.|++.|++++.+|..|.||||+|+..|+.+++++|+++|++++..+..|.||||+|+..++ ..++++|++  .|+
T Consensus       356 ~iv~lLl~~gadin~~d~~G~TpLh~Aa~~~~~~iv~~Ll~~gad~~~~~~~g~T~Lh~A~~~~~~~~~vk~Ll~--~ga  433 (682)
T PHA02876        356 DIVITLLELGANVNARDYCDKTPIHYAAVRNNVVIINTLLDYGADIEALSQKIGTALHFALCGTNPYMSVKTLID--RGA  433 (682)
T ss_pred             HHHHHHHHcCCCCccCCCCCCCHHHHHHHcCCHHHHHHHHHCCCCccccCCCCCchHHHHHHcCCHHHHHHHHHh--CCC
Confidence            66666666666666666666666666666666666666666666666666666666666665443 445666666  677


Q ss_pred             CcccCCCCCCcHHHHHHhCC-CHHHHHHHHHcCCCCC
Q psy14202        303 MIEHVDINGLRPLDRAISCR-NVPVVQCFLRKGAKLG  338 (356)
Q Consensus       303 ~~~~~~~~g~t~l~~A~~~~-~~~i~~~Ll~~ga~~~  338 (356)
                      +++.+|..|.||||+|+..+ +.+++++|+++|+++|
T Consensus       434 din~~d~~G~TpLh~Aa~~~~~~~iv~lLl~~Gad~n  470 (682)
T PHA02876        434 NVNSKNKDLSTPLHYACKKNCKLDVIEMLLDNGADVN  470 (682)
T ss_pred             CCCcCCCCCChHHHHHHHhCCcHHHHHHHHHCCCCCC
Confidence            77777777777777777655 5677777777777776



>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0510|consensus Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0510|consensus Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0508|consensus Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4412|consensus Back     alignment and domain information
>KOG4412|consensus Back     alignment and domain information
>KOG4177|consensus Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4177|consensus Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0509|consensus Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0509|consensus Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0508|consensus Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG0514|consensus Back     alignment and domain information
>KOG4369|consensus Back     alignment and domain information
>KOG0502|consensus Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG0502|consensus Back     alignment and domain information
>KOG0505|consensus Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0507|consensus Back     alignment and domain information
>KOG0507|consensus Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>KOG0505|consensus Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0514|consensus Back     alignment and domain information
>KOG4369|consensus Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0512|consensus Back     alignment and domain information
>KOG0512|consensus Back     alignment and domain information
>KOG3676|consensus Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG3676|consensus Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>KOG4214|consensus Back     alignment and domain information
>KOG4214|consensus Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG1710|consensus Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>KOG1710|consensus Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0506|consensus Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>KOG0818|consensus Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0782|consensus Back     alignment and domain information
>KOG0506|consensus Back     alignment and domain information
>KOG3609|consensus Back     alignment and domain information
>KOG0818|consensus Back     alignment and domain information
>KOG0782|consensus Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>KOG3609|consensus Back     alignment and domain information
>KOG0522|consensus Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>KOG0522|consensus Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>KOG0521|consensus Back     alignment and domain information
>KOG2384|consensus Back     alignment and domain information
>KOG2384|consensus Back     alignment and domain information
>KOG0521|consensus Back     alignment and domain information
>KOG0520|consensus Back     alignment and domain information
>KOG0520|consensus Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>KOG2505|consensus Back     alignment and domain information
>KOG2505|consensus Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query356
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 8e-20
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 1e-16
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 6e-18
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 2e-14
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 1e-17
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 1e-13
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 2e-17
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 3e-13
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 2e-16
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 3e-13
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 3e-16
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 1e-11
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 4e-10
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 6e-16
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 9e-13
2xeh_A157 Structural Determinants For Improved Thermal Stabil 6e-16
2xeh_A157 Structural Determinants For Improved Thermal Stabil 1e-13
2xeh_A157 Structural Determinants For Improved Thermal Stabil 3e-10
2xee_A157 Structural Determinants For Improved Thermal Stabil 8e-16
2xee_A157 Structural Determinants For Improved Thermal Stabil 1e-14
1n11_A437 D34 Region Of Human Ankyrin-R And Linker Length = 4 4e-15
1n11_A 437 D34 Region Of Human Ankyrin-R And Linker Length = 4 2e-14
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 2e-14
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 2e-12
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 9e-08
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 2e-14
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 1e-12
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 8e-10
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 2e-14
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 1e-11
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 2e-14
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 5e-12
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 3e-14
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 2e-11
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 1e-08
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 4e-14
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 1e-11
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 4e-14
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 4e-10
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 1e-13
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 8e-11
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 1e-07
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 1e-13
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 6e-13
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 1e-13
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 2e-11
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 1e-13
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 1e-11
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 3e-13
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 2e-10
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 4e-13
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 8e-13
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 4e-09
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 6e-13
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 2e-11
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 6e-13
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 3e-11
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 7e-13
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 2e-11
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 2e-12
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 1e-09
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 2e-08
4g8k_A337 Intact Sensor Domain Of Human Rnase L In The Inacti 2e-10
1wdy_A285 Crystal Structure Of Ribonuclease Length = 285 3e-10
1awc_B153 Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 1 5e-10
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 5e-10
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 2e-05
4b93_B269 Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyri 1e-09
4b93_B269 Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyri 3e-04
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 1e-09
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 6e-05
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 3e-09
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 6e-05
2rfm_A192 Structure Of A Thermophilic Ankyrin Repeat Protein 6e-09
2rfm_A192 Structure Of A Thermophilic Ankyrin Repeat Protein 8e-08
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 1e-08
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 2e-07
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 2e-08
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 3e-05
1myo_A118 Solution Structure Of Myotrophin, Nmr, 44 Structure 4e-08
2jab_A136 A Designed Ankyrin Repeat Protein Evolved To Picomo 4e-08
2jab_A136 A Designed Ankyrin Repeat Protein Evolved To Picomo 4e-04
3hg0_D136 Crystal Structure Of A Darpin In Complex With Orf49 5e-08
3hg0_D136 Crystal Structure Of A Darpin In Complex With Orf49 6e-04
3aaa_C123 Crystal Structure Of Actin Capping Protein In Compl 1e-07
3utm_A 351 Crystal Structure Of A Mouse Tankyrase-Axin Complex 2e-07
3eu9_A240 The Ankyrin Repeat Domain Of Huntingtin Interacting 2e-07
3f6q_A179 Crystal Structure Of Integrin-Linked Kinase Ankyrin 2e-07
2kbx_A171 Solution Structure Of Ilk-Pinch Complex Length = 17 3e-07
3twr_A165 Crystal Structure Of Arc4 From Human Tankyrase 2 In 4e-07
3twr_A165 Crystal Structure Of Arc4 From Human Tankyrase 2 In 1e-05
3twu_A167 Crystal Structure Of Arc4 From Human Tankyrase 2 In 4e-07
3twu_A167 Crystal Structure Of Arc4 From Human Tankyrase 2 In 1e-05
4grg_A135 Crystal Structure Of Ige Complexed With E2_79, An A 5e-07
3twq_A175 Crystal Structure Of Arc4 From Human Tankyrase 2 (A 5e-07
3twq_A175 Crystal Structure Of Arc4 From Human Tankyrase 2 (A 2e-05
3c5r_A137 Crystal Structure Of The Bard1 Ankyrin Repeat Domai 2e-06
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 4e-06
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 1e-05
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 2e-04
1bi8_B166 Mechanism Of G1 Cyclin Dependent Kinase Inhibition 1e-05
1bd8_A156 Structure Of Cdk Inhibitor P19ink4d Length = 156 1e-05
1ot8_A239 Structure Of The Ankyrin Domain Of The Drosophila N 1e-05
2f8y_A223 Crystal Structure Of Human Notch1 Ankyrin Repeats T 2e-05
1yyh_A253 Crystal Structure Of The Human Notch 1 Ankyrin Doma 2e-05
3t9k_A390 Crystal Structure Of Acap1 C-portion Mutant S554d F 2e-05
4f1p_A368 Crystal Structure Of Mutant S554d For Arfgap And An 2e-05
2f8x_K256 Crystal Structure Of Activated Notch, Csl And Maml 2e-05
3v2o_A183 Crystal Structure Of The Peptide Bound Complex Of T 2e-05
3jue_A368 Crystal Structure Of Arfgap And Ank Repeat Domain O 2e-05
2he0_A253 Crystal Structure Of A Human Notch1 Ankyrin Domain 2e-05
3so8_A162 Crystal Structure Of Ankra Length = 162 4e-05
3so8_A162 Crystal Structure Of Ankra Length = 162 5e-05
3hra_A201 Crystal Structure Of Ef0377 An Ankyrin Repeat Prote 4e-05
3v2x_A167 Crystal Structure Of The Peptide Bound Complex Of T 4e-05
3v2x_A167 Crystal Structure Of The Peptide Bound Complex Of T 5e-05
1uoh_A226 Human Gankyrin Length = 226 6e-05
1uoh_A226 Human Gankyrin Length = 226 2e-04
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 6e-05
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 7e-05
2qc9_A210 Mouse Notch 1 Ankyrin Repeat Intracellular Domain L 8e-05
3v30_A172 Crystal Structure Of The Peptide Bound Complex Of T 9e-05
1k1b_A241 Crystal Structure Of The Ankyrin Repeat Domain Of B 1e-04
4a63_B239 Crystal Structure Of The P73-Aspp2 Complex At 2.6a 1e-04
1ycs_B239 P53-53bp2 Complex Length = 239 1e-04
1nfi_E213 I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 1e-04
3uxg_A172 Crystal Structure Of Rfxank Length = 172 1e-04
1ikn_D236 IkappabalphaNF-Kappab Complex Length = 236 1e-04
1ap7_A168 P19-Ink4d From Mouse, Nmr, 20 Structures Length = 1 2e-04
3d9h_A285 Crystal Structure Of The Splice Variant Of Human As 2e-04
1blx_B166 P19ink4dCDK6 COMPLEX Length = 166 2e-04
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 2e-04
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 2e-04
3aji_A231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 2e-04
2xen_A91 Structural Determinants For Improved Thermal Stabil 3e-04
1ymp_A135 The Crystal Structure Of A Partial Mouse Notch-1 An 4e-04
2zgg_A92 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 6e-04
4hbd_A276 Crystal Structure Of Kank2 Ankyrin Repeats Length = 8e-04
3zkj_A261 Crystal Structure Of Ankyrin Repeat And Socs Box-co 9e-04
1mx4_A168 Structure Of P18ink4c (F82q) Length = 168 9e-04
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure

Iteration: 1

Score = 94.4 bits (233), Expect = 8e-20, Method: Compositional matrix adjust. Identities = 57/163 (34%), Positives = 83/163 (50%), Gaps = 15/163 (9%) Query: 133 LCLFAHEGNSEMIALLLEFHACIDLANSQGRTPLSLAAGRGHMEAVRTLVAAGASLGRTD 192 L A GN + + L+E A ++ ++S GRTPL AA GH E V+ L++ GA + D Sbjct: 8 LIEAAENGNKDRVKDLIENGADVNASDSDGRTPLHYAAKEGHKEIVKLLISKGADVNAKD 67 Query: 193 TTGRCALVHAARGGHLQNLSPLMLAVKEGHWATAEKLLQHHAPLDQTDGSHKTPLMIAAQ 252 + GR +PL A KEGH + L+ A ++ D +TPL AA+ Sbjct: 68 SDGR---------------TPLHYAAKEGHKEIVKLLISKGADVNAKDSDGRTPLHYAAK 112 Query: 253 EGHVGLLELLLDKGADILREDGEGLTALSWACMRGRIQAVTYL 295 EGH +++LL+ KGAD+ D +G T L A G + V L Sbjct: 113 EGHKEIVKLLISKGADVNTSDSDGRTPLDLAREHGNEEIVKLL 155
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|4G8K|A Chain A, Intact Sensor Domain Of Human Rnase L In The Inactive Signaling State Length = 337 Back     alignment and structure
>pdb|1WDY|A Chain A, Crystal Structure Of Ribonuclease Length = 285 Back     alignment and structure
>pdb|1AWC|B Chain B, Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 153 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|4B93|B Chain B, Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyrin Repeat Domain Of Varp Length = 269 Back     alignment and structure
>pdb|4B93|B Chain B, Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyrin Repeat Domain Of Varp Length = 269 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|2RFM|A Chain A, Structure Of A Thermophilic Ankyrin Repeat Protein Length = 192 Back     alignment and structure
>pdb|2RFM|A Chain A, Structure Of A Thermophilic Ankyrin Repeat Protein Length = 192 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|1MYO|A Chain A, Solution Structure Of Myotrophin, Nmr, 44 Structures Length = 118 Back     alignment and structure
>pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 Back     alignment and structure
>pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 Back     alignment and structure
>pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 Back     alignment and structure
>pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 Back     alignment and structure
>pdb|3AAA|C Chain C, Crystal Structure Of Actin Capping Protein In Complex With V-1 Length = 123 Back     alignment and structure
>pdb|3UTM|A Chain A, Crystal Structure Of A Mouse Tankyrase-Axin Complex Length = 351 Back     alignment and structure
>pdb|3EU9|A Chain A, The Ankyrin Repeat Domain Of Huntingtin Interacting Protein 14 Length = 240 Back     alignment and structure
>pdb|3F6Q|A Chain A, Crystal Structure Of Integrin-Linked Kinase Ankyrin Repeat Domain In Complex With Pinch1 Lim1 Domain Length = 179 Back     alignment and structure
>pdb|2KBX|A Chain A, Solution Structure Of Ilk-Pinch Complex Length = 171 Back     alignment and structure
>pdb|3TWR|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human 3bp2 Length = 165 Back     alignment and structure
>pdb|3TWR|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human 3bp2 Length = 165 Back     alignment and structure
>pdb|3TWU|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human Mcl1 Length = 167 Back     alignment and structure
>pdb|3TWU|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human Mcl1 Length = 167 Back     alignment and structure
>pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 Back     alignment and structure
>pdb|3TWQ|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 (Apo Form) Length = 175 Back     alignment and structure
>pdb|3TWQ|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 (Apo Form) Length = 175 Back     alignment and structure
>pdb|3C5R|A Chain A, Crystal Structure Of The Bard1 Ankyrin Repeat Domain And Its Functional Consequences Length = 137 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|1BI8|B Chain B, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structures Cdk6-P19ink4d Inhibitor Complex Length = 166 Back     alignment and structure
>pdb|1BD8|A Chain A, Structure Of Cdk Inhibitor P19ink4d Length = 156 Back     alignment and structure
>pdb|1OT8|A Chain A, Structure Of The Ankyrin Domain Of The Drosophila Notch Receptor Length = 239 Back     alignment and structure
>pdb|2F8Y|A Chain A, Crystal Structure Of Human Notch1 Ankyrin Repeats To 1.55a Resolution. Length = 223 Back     alignment and structure
>pdb|1YYH|A Chain A, Crystal Structure Of The Human Notch 1 Ankyrin Domain Length = 253 Back     alignment and structure
>pdb|3T9K|A Chain A, Crystal Structure Of Acap1 C-portion Mutant S554d Fused With Integrin Beta1 Peptide Length = 390 Back     alignment and structure
>pdb|4F1P|A Chain A, Crystal Structure Of Mutant S554d For Arfgap And Ank Repeat Domain Of Acap1 Length = 368 Back     alignment and structure
>pdb|2F8X|K Chain K, Crystal Structure Of Activated Notch, Csl And Maml On Hes-1 Promoter Dna Sequence Length = 256 Back     alignment and structure
>pdb|3V2O|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 183 Back     alignment and structure
>pdb|3JUE|A Chain A, Crystal Structure Of Arfgap And Ank Repeat Domain Of Acap1 Length = 368 Back     alignment and structure
>pdb|2HE0|A Chain A, Crystal Structure Of A Human Notch1 Ankyrin Domain Mutant Length = 253 Back     alignment and structure
>pdb|3SO8|A Chain A, Crystal Structure Of Ankra Length = 162 Back     alignment and structure
>pdb|3SO8|A Chain A, Crystal Structure Of Ankra Length = 162 Back     alignment and structure
>pdb|3HRA|A Chain A, Crystal Structure Of Ef0377 An Ankyrin Repeat Protein Length = 201 Back     alignment and structure
>pdb|3V2X|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 167 Back     alignment and structure
>pdb|3V2X|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 167 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|2QC9|A Chain A, Mouse Notch 1 Ankyrin Repeat Intracellular Domain Length = 210 Back     alignment and structure
>pdb|3V30|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Rfxank Length = 172 Back     alignment and structure
>pdb|1K1B|A Chain A, Crystal Structure Of The Ankyrin Repeat Domain Of Bcl-3: A Unique Member Of The Ikappab Protein Family Length = 241 Back     alignment and structure
>pdb|4A63|B Chain B, Crystal Structure Of The P73-Aspp2 Complex At 2.6a Resolution Length = 239 Back     alignment and structure
>pdb|1YCS|B Chain B, P53-53bp2 Complex Length = 239 Back     alignment and structure
>pdb|1NFI|E Chain E, I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 Back     alignment and structure
>pdb|3UXG|A Chain A, Crystal Structure Of Rfxank Length = 172 Back     alignment and structure
>pdb|1IKN|D Chain D, IkappabalphaNF-Kappab Complex Length = 236 Back     alignment and structure
>pdb|1AP7|A Chain A, P19-Ink4d From Mouse, Nmr, 20 Structures Length = 168 Back     alignment and structure
>pdb|3D9H|A Chain A, Crystal Structure Of The Splice Variant Of Human Asb9 (Hasb9-2), An Ankyrin Repeat Protein Length = 285 Back     alignment and structure
>pdb|1BLX|B Chain B, P19ink4dCDK6 COMPLEX Length = 166 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|2XEN|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module Length = 91 Back     alignment and structure
>pdb|1YMP|A Chain A, The Crystal Structure Of A Partial Mouse Notch-1 Ankyrin Domain: Repeats 4 Through 7 Preserve An Ankyrin Fold Length = 135 Back     alignment and structure
>pdb|2ZGG|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 92 Back     alignment and structure
>pdb|4HBD|A Chain A, Crystal Structure Of Kank2 Ankyrin Repeats Length = 276 Back     alignment and structure
>pdb|3ZKJ|A Chain A, Crystal Structure Of Ankyrin Repeat And Socs Box-containing Protein 9 (asb9) In Complex With Elonginb And Elonginc Length = 261 Back     alignment and structure
>pdb|1MX4|A Chain A, Structure Of P18ink4c (F82q) Length = 168 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query356
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 8e-46
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-45
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 5e-44
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-42
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 4e-42
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 4e-19
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-44
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 9e-41
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 5e-36
2xai_A 261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-18
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-43
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 7e-32
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-43
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-35
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 7e-33
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-16
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 7e-41
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-33
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-33
3b7b_A 237 Euchromatic histone-lysine N-methyltransferase 1; 4e-18
3v31_A167 Ankyrin repeat family A protein 2; structural geno 1e-39
3v31_A167 Ankyrin repeat family A protein 2; structural geno 5e-36
3v31_A167 Ankyrin repeat family A protein 2; structural geno 6e-30
3v31_A167 Ankyrin repeat family A protein 2; structural geno 3e-20
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-39
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 4e-31
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-28
1k1a_A 241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 3e-15
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 7e-10
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-39
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 8e-37
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-11
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 3e-39
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 2e-29
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 5e-28
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-25
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 3e-20
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 6e-14
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 9e-39
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 4e-34
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-30
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 3e-30
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-38
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 3e-36
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 1e-34
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-34
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 1e-26
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 2e-18
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 6e-38
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 9e-26
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-24
1yyh_A 253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-13
3v30_A172 DNA-binding protein rfxank; structural genomics co 1e-36
3v30_A172 DNA-binding protein rfxank; structural genomics co 4e-31
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 6e-36
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 3e-35
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 6e-35
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 6e-25
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-19
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 6e-36
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 4e-33
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-28
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 5e-26
1oy3_D 282 Transcription factor inhibitor I-kappa-B-beta; pro 8e-15
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 6e-36
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 8e-28
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 3e-25
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 8e-14
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 9e-35
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-31
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-21
2f8y_A 223 Notch homolog 1, translocation-associated (drosoph 5e-11
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 7e-34
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 6e-32
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 5e-27
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-18
3ehr_A 222 Osteoclast-stimulating factor 1; beta barrel, heli 3e-13
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 5e-10
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 8e-34
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 7e-30
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-28
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 5e-23
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-21
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-11
3deo_A183 Signal recognition particle 43 kDa protein; chloro 1e-33
3deo_A183 Signal recognition particle 43 kDa protein; chloro 5e-31
3deo_A183 Signal recognition particle 43 kDa protein; chloro 4e-15
3deo_A183 Signal recognition particle 43 kDa protein; chloro 4e-14
3deo_A183 Signal recognition particle 43 kDa protein; chloro 3e-11
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-33
3hra_A201 Ankyrin repeat family protein; structural protein; 5e-31
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 9e-33
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 5e-31
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 7e-27
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-26
2dzn_A 228 Probable 26S proteasome regulatory subunit P28; an 2e-13
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-32
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-32
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 3e-24
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 9e-32
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-29
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 1e-23
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-12
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 4e-31
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 4e-27
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-22
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 5e-31
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 3e-25
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 4e-12
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 9e-05
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-30
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 6e-30
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-23
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-16
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 1e-30
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 1e-27
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-18
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-08
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 4e-04
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-30
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-26
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 4e-17
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-13
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 9e-09
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-30
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 4e-28
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 3e-10
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 3e-30
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 3e-27
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-25
3ui2_A 244 Signal recognition particle 43 kDa protein, chlor; 2e-09
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 3e-30
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 5e-29
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 6e-21
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-20
3aji_A 231 26S proteasome non-ATPase regulatory subunit 10; g 2e-14
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 7e-30
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 1e-25
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 9e-25
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 7e-29
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 1e-25
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 7e-24
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 3e-17
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-27
1awc_B153 Protein (GA binding protein beta 1); complex (tran 4e-21
1awc_B153 Protein (GA binding protein beta 1); complex (tran 3e-19
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 3e-27
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 6e-22
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 5e-27
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 4e-24
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 3e-19
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 6e-18
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-26
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 1e-21
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 4e-18
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-13
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-26
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 3e-26
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 1e-17
2rfa_A232 Transient receptor potential cation channel subfa 4e-25
2rfa_A232 Transient receptor potential cation channel subfa 1e-19
2rfa_A232 Transient receptor potential cation channel subfa 4e-19
2rfa_A 232 Transient receptor potential cation channel subfa 4e-13
2pnn_A273 Transient receptor potential cation channel subfa 6e-25
2pnn_A273 Transient receptor potential cation channel subfa 9e-23
2pnn_A273 Transient receptor potential cation channel subfa 1e-22
2pnn_A273 Transient receptor potential cation channel subfa 8e-17
2pnn_A273 Transient receptor potential cation channel subfa 1e-11
2etb_A256 Transient receptor potential cation channel subfam 5e-24
2etb_A256 Transient receptor potential cation channel subfam 4e-23
2etb_A256 Transient receptor potential cation channel subfam 2e-22
2etb_A256 Transient receptor potential cation channel subfam 6e-13
2etb_A 256 Transient receptor potential cation channel subfam 1e-07
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 1e-23
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 5e-19
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 3e-13
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 5e-13
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 2e-04
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 2e-23
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 2e-21
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 2e-17
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 7e-06
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 2e-22
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 2e-20
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-16
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 8e-15
3jxi_A260 Vanilloid receptor-related osmotically activated p 1e-20
3jxi_A260 Vanilloid receptor-related osmotically activated p 1e-18
3jxi_A260 Vanilloid receptor-related osmotically activated p 1e-15
3jxi_A260 Vanilloid receptor-related osmotically activated p 9e-14
1sw6_A327 Regulatory protein SWI6; transcription regulation, 5e-20
1sw6_A327 Regulatory protein SWI6; transcription regulation, 9e-20
1sw6_A327 Regulatory protein SWI6; transcription regulation, 6e-18
1sw6_A327 Regulatory protein SWI6; transcription regulation, 1e-04
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 5e-20
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-19
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-18
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 6e-13
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 1e-09
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 6e-20
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-19
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 7e-16
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-07
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 5e-14
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 6e-12
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 4e-09
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 7e-14
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 1e-10
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 5e-09
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-06
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 8e-12
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 1e-11
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 2e-11
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 8e-05
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 8e-09
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 5e-08
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 6e-07
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
 Score =  160 bits (408), Expect = 8e-46
 Identities = 64/230 (27%), Positives = 99/230 (43%), Gaps = 19/230 (8%)

Query: 106 NVKVSRLLLLSGADANHITEFLGAAPALCLFAHEGNSEMIALLLEFHACIDLANSQGRTP 165
           + +V++ LL + A  N   +     P L   A  G++ M+ LLLE +A  +LA + G TP
Sbjct: 59  HTEVAKYLLQNKAKVNAKAKD-DQTP-LHCAARIGHTNMVKLLLENNANPNLATTAGHTP 116

Query: 166 LSLAAGRGHMEAVRTLVAAGASLGRTDTTGRCALVHAARGGHLQNLSPLMLAVKEGHWAT 225
           L +AA  GH+E V  L+   AS       G                +PL +A K G    
Sbjct: 117 LHIAAREGHVETVLALLEKEASQACMTKKGF---------------TPLHVAAKYGKVRV 161

Query: 226 AEKLLQHHAPLDQTDGSHKTPLMIAAQEGHVGLLELLLDKGADILREDGEGLTALSWACM 285
           AE LL+  A  +    +  TPL +A    ++ +++LLL +G         G T L  A  
Sbjct: 162 AELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAK 221

Query: 286 RGRIQAVTYLLDRDRGAMIEHVDINGLRPLDRAISCRNVPVVQCFLRKGA 335
           + +++    LL    G       + G+ PL  A    +  +V   L K A
Sbjct: 222 QNQVEVARSLL--QYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQA 269


>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query356
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
2rfa_A232 Transient receptor potential cation channel subfa 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
3hra_A201 Ankyrin repeat family protein; structural protein; 100.0
4gpm_A169 Engineered protein OR264; de novo protein, structu 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 100.0
2etb_A256 Transient receptor potential cation channel subfam 100.0
4gpm_A169 Engineered protein OR264; de novo protein, structu 100.0
2pnn_A273 Transient receptor potential cation channel subfa 100.0
1sw6_A327 Regulatory protein SWI6; transcription regulation, 100.0
2rfa_A232 Transient receptor potential cation channel subfa 100.0
3hra_A201 Ankyrin repeat family protein; structural protein; 100.0
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 100.0
3jxi_A260 Vanilloid receptor-related osmotically activated p 100.0
1sw6_A327 Regulatory protein SWI6; transcription regulation, 100.0
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 100.0
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 100.0
3v30_A172 DNA-binding protein rfxank; structural genomics co 100.0
2etb_A256 Transient receptor potential cation channel subfam 100.0
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 100.0
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 100.0
2pnn_A273 Transient receptor potential cation channel subfa 100.0
3v31_A167 Ankyrin repeat family A protein 2; structural geno 100.0
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 100.0
3v31_A167 Ankyrin repeat family A protein 2; structural geno 100.0
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 100.0
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 100.0
3jxi_A260 Vanilloid receptor-related osmotically activated p 100.0
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.98
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.98
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.97
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.97
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.97
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.97
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.97
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.97
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.97
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.97
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.97
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.96
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.96
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.96
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.96
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.96
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.95
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.95
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.95
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.95
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.95
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.95
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.94
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.94
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.94
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.94
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.93
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.93
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.93
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.92
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.91
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.91
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.91
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.91
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.91
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.91
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.91
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.91
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.9
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.89
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.89
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.89
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.88
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.87
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.87
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.86
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.85
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.84
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.78
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.76
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
Probab=100.00  E-value=1.1e-51  Score=380.41  Aligned_cols=332  Identities=24%  Similarity=0.274  Sum_probs=263.6

Q ss_pred             cCCCCcccccccccChHHHHHHHhhcCCCCC---------HHHHHHhHHH-HHHHHHhcCCccccccccccchhHhhhh-
Q psy14202         20 DEGESNKFLCDLRAGHAGIAFRLSRLQAPLD---------ADKSLELGHH-ILKAHVYKNMTLVKYSSRDLQAHWISSV-   88 (356)
Q Consensus        20 ~~~~~~~l~~A~~~g~~~iv~~Ll~~~~~~~---------~~~~~~~g~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~-   88 (356)
                      ++.|.||||+|++.|+.++|++|++.+.+++         ...+...|+. +++.++..+.++.........++..... 
T Consensus        11 ~~~g~t~L~~Aa~~g~~~~v~~Ll~~g~~~~~~~~~~~t~L~~A~~~g~~~~v~~Ll~~g~~~~~~~~~g~t~L~~A~~~   90 (437)
T 1n11_A           11 GESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARI   90 (437)
T ss_dssp             ----CCHHHHHHHHTCHHHHHHHHHTTCCSCCSSSCCCCHHHHHHHHTCHHHHHHHHHHTCCSSCCCTTSCCHHHHHHHH
T ss_pred             CCCCCCHHHHHHHCCCHHHHHHHHHcCCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHhCCCCCCCCCCCCCCHHHHHHHC
Confidence            4456666666666666666666666654433         1235555555 5666665555443222222222222111 


Q ss_pred             -----------------cCChhhhhhhhhhhcCCCHHHHHHHHHCCCCccccccccCCchHHHHHHHcCCHHHHHHHHhC
Q psy14202         89 -----------------CQSPAQALCSLRNVYSPNVKVSRLLLLSGADANHITEFLGAAPALCLFAHEGNSEMIALLLEF  151 (356)
Q Consensus        89 -----------------~~~~~~~~~~~~a~~~~~~~~~~~ll~~g~~~~~~~~~~~~~~~l~~A~~~g~~~~v~~Ll~~  151 (356)
                                       ..+....++++.|+..|+.+++++|++.+.+++..+.  .+.||||+|+..|+.+++++|+++
T Consensus        91 g~~~~v~~Ll~~ga~~~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~~~~~~~~~~--~g~t~L~~A~~~g~~~~v~~Ll~~  168 (437)
T 1n11_A           91 GHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTK--KGFTPLHVAAKYGKVRVAELLLER  168 (437)
T ss_dssp             TCHHHHHHHHHHTCCTTCCCTTCCCHHHHHHHHTCHHHHHHHHHTTCCSCCCCT--TSCCHHHHHHHTTCHHHHHHHHHT
T ss_pred             CCHHHHHHHHhCCCCCCCCCCCCCcHHHHHHHcCCHHHHHHHHhCCCCCcCCCC--CCCCHHHHHHHcCCHHHHHHHHhC
Confidence                             1123345667778888888888888888887776554  567888999999999999999998


Q ss_pred             CCCCCccCCCCCcHHHHHHHCCCHHHHHHHHHcCCCCCCCCCCCCcHHHHHHHcCCCC------------------CChH
Q psy14202        152 HACIDLANSQGRTPLSLAAGRGHMEAVRTLVAAGASLGRTDTTGRCALVHAARGGHLQ------------------NLSP  213 (356)
Q Consensus       152 ~~~~~~~~~~g~t~L~~A~~~g~~~iv~~Ll~~g~~~~~~~~~~~t~l~~a~~~~~~~------------------~~~~  213 (356)
                      |++++..+..|.||||+|+..|+.+++++|+++|++++..+..|.||||+|+..++.+                  |.||
T Consensus       169 g~~~~~~~~~g~t~L~~A~~~~~~~~v~~Ll~~g~~~~~~~~~g~t~L~~A~~~~~~~~~~~Ll~~g~~~~~~~~~g~t~  248 (437)
T 1n11_A          169 DAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTP  248 (437)
T ss_dssp             TCCTTCCCSSCCCHHHHHHHTTCHHHHHHHGGGTCCSCCCCTTCCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTCCCH
T ss_pred             CCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHhCCCCCCCcCCCCCCHHHHHHHcCCHHHHHHHHHcCCCCCCCCCCCCCH
Confidence            8888888888899999999999999999999988888888888899999998876543                  7799


Q ss_pred             HHHHHHcCCHHHHHHHHhcCCCCCCCCCCCCcHHHHHHHcCcHHHHHHHHHCCCCCccCCCCCCcHHHHHHHcCCHHHHH
Q psy14202        214 LMLAVKEGHWATAEKLLQHHAPLDQTDGSHKTPLMIAAQEGHVGLLELLLDKGADILREDGEGLTALSWACMRGRIQAVT  293 (356)
Q Consensus       214 l~~a~~~~~~~~~~~Ll~~g~~~~~~~~~g~t~l~~a~~~~~~~~v~~Ll~~g~~~~~~~~~g~t~l~~a~~~~~~~~v~  293 (356)
                      |+.|+..|+.+++++|+++|++++..+..|.||||+|+..|+.+++++|+++|++++.++..|.||||+|+..|+.++++
T Consensus       249 L~~A~~~g~~~~v~~Ll~~~~~~~~~~~~g~t~L~~A~~~~~~~~~~~Ll~~g~~~~~~~~~g~t~L~~A~~~g~~~~v~  328 (437)
T 1n11_A          249 LHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVK  328 (437)
T ss_dssp             HHHHHHTTCHHHHHHHHTTTCCTTCCCTTCCCHHHHHHHHTCHHHHHHHHHHTCCTTCCCSSCCCHHHHHHHSSCSHHHH
T ss_pred             HHHHHHCCCHHHHHHHHhcCCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHhCCccCCCCCCCCCCHHHHHHHcCcHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HhhhcCCCCCcccCCCCCCcHHHHHHhCCCHHHHHHHHHcCCCCC--------hhHHHHhhCCcceeccC
Q psy14202        294 YLLDRDRGAMIEHVDINGLRPLDRAISCRNVPVVQCFLRKGAKLG--------PTTWSMAAGKPEVMENF  355 (356)
Q Consensus       294 ~Ll~~~~~~~~~~~~~~g~t~l~~A~~~~~~~i~~~Ll~~ga~~~--------~~~~a~~~~~~~~~~~l  355 (356)
                      +|++  .+++++.+|..|.|||++|+..|+.+++++|+++|++++        +..+|...|+.+++++|
T Consensus       329 ~Ll~--~gad~n~~~~~g~t~L~~A~~~g~~~iv~~Ll~~ga~~~~~~~~g~t~l~~A~~~g~~~~~~~l  396 (437)
T 1n11_A          329 FLLQ--HQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVL  396 (437)
T ss_dssp             HHHH--TTCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCSCCCCSSSCCHHHHHHHTTCHHHHHHH
T ss_pred             HHHh--cCCCCCCCCCCCCCHHHHHHHCChHHHHHHHHHCcCCCCCCCCCCCCHHHHHHHcCcHHHHHHH
Confidence            9998  899999999999999999999999999999999999986        67789999999888876



>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 356
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-28
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 3e-26
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 6e-25
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 5e-24
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-23
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-22
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 9e-21
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 9e-23
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-20
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 2e-11
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 5e-19
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 9e-18
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-12
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 7e-17
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 1e-14
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 2e-14
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 1e-08
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 3e-07
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 2e-05
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 9e-17
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 8e-16
d2ajaa1 346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 3e-13
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 6e-05
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 3e-14
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 5e-11
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 5e-10
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 1e-05
d1oy3d_ 255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 0.001
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 7e-14
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 9e-12
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 1e-09
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 3e-09
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 3e-09
d1s70b_ 291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 6e-06
d1s70b_ 291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 4e-04
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 8e-13
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 3e-09
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 9e-12
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-09
d2fo1e1 277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 1e-08
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 5e-08
d2fo1e1 277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 9e-08
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 5e-11
d1ixva_ 229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 8e-07
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 8e-06
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 6e-11
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 4e-07
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9e-07
d1k1aa_ 228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 4e-04
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 3e-09
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 6e-07
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 7e-07
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 6e-06
d1iknd_ 221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 3e-05
d1iknd_ 221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 0.004
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 1e-07
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 1e-07
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 2e-06
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 5e-04
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 1e-06
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 0.001
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 1e-05
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 2e-05
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 4e-05
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 4e-05
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 2e-04
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 0.001
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 0.001
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  111 bits (279), Expect = 2e-28
 Identities = 61/219 (27%), Positives = 88/219 (40%), Gaps = 20/219 (9%)

Query: 132 ALCLFAHEGNSEMIALLLEFHACIDLANSQGRTPLSLAAGRGHMEAVRTLVAAGASLGRT 191
            L + +  G+  ++  LL+  A  +++N +  TPL +AA  GH E  + L+   A +   
Sbjct: 3   PLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAK 62

Query: 192 DTTGRCALVHAARGGHLQ------------------NLSPLMLAVKEGHWATAEKLLQHH 233
               +  L  AAR GH                      +PL +A +EGH  T   LL+  
Sbjct: 63  AKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKE 122

Query: 234 APLDQTDGSHKTPLMIAAQEGHVGLLELLLDKGADILREDGEGLTALSWACMRGRIQAVT 293
           A          TPL +AA+ G V + ELLL++ A        GLT L  A     +  V 
Sbjct: 123 ASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVK 182

Query: 294 YLLDRDRGAMIEHVDINGLRPLDRAISCRNVPVVQCFLR 332
            L    RG        NG  PL  A     V V +  L+
Sbjct: 183 LL--LPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQ 219


>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query356
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 100.0
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 100.0
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 100.0
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 100.0
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 100.0
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 100.0
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 100.0
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.98
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.97
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.97
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.97
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.97
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.96
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.96
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.96
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.96
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.95
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.94
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.94
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.93
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.93
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.92
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.92
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.92
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.92
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.91
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.91
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.91
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.88
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=1.2e-43  Score=321.40  Aligned_cols=226  Identities=29%  Similarity=0.376  Sum_probs=169.4

Q ss_pred             CCchHHHHHHHcCCHHHHHHHHhCCCCCCccCCCCCcHHHHHHHCCCHHHHHHHHHcCCCCCCCCCCCCcHHHHHHHcCC
Q psy14202        128 GAAPALCLFAHEGNSEMIALLLEFHACIDLANSQGRTPLSLAAGRGHMEAVRTLVAAGASLGRTDTTGRCALVHAARGGH  207 (356)
Q Consensus       128 ~~~~~l~~A~~~g~~~~v~~Ll~~~~~~~~~~~~g~t~L~~A~~~g~~~iv~~Ll~~g~~~~~~~~~~~t~l~~a~~~~~  207 (356)
                      .+.++++.|+..++.+++++|+++|.+++..+.+|.+||++|+..|+.+++++|+++|++++..+..|.||++.+.....
T Consensus       131 ~~~~~l~~a~~~~~~~~v~~ll~~~~~~~~~~~~~~~~L~~A~~~~~~~~~~~Ll~~g~~~~~~~~~~~t~l~~~~~~~~  210 (408)
T d1n11a_         131 KGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQ  210 (408)
T ss_dssp             TSCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCSSCCCHHHHHHHTTCHHHHHHHGGGTCCSCCCCTTCCCHHHHHHHTTC
T ss_pred             ccchHHHHHHHcCCHHHHHHHHHcCCCCCcCCCcCchHHHHHHHcCCHHHHHHHHhcCCcccccCCCCCCcchhhhccch
Confidence            34566777777777777777777777777777777777777777777777777777777777777777777777776544


Q ss_pred             CC------------------CChHHHHHHHcCCHHHHHHHHhcCCCCCCCCCCCCcHHHHHHHcCcHHHHHHHHHCCCCC
Q psy14202        208 LQ------------------NLSPLMLAVKEGHWATAEKLLQHHAPLDQTDGSHKTPLMIAAQEGHVGLLELLLDKGADI  269 (356)
Q Consensus       208 ~~------------------~~~~l~~a~~~~~~~~~~~Ll~~g~~~~~~~~~g~t~l~~a~~~~~~~~v~~Ll~~g~~~  269 (356)
                      .+                  +.||++.|+..+..++++++.+.+...+..+..|.||++.|++.++.+++++|+++|+++
T Consensus       211 ~~~~~~l~~~~~~~~~~~~~~~t~l~~a~~~~~~~~~~~~~~~~~~~~~~~~~g~~~l~~a~~~~~~~i~~~Ll~~g~~~  290 (408)
T d1n11a_         211 VEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMV  290 (408)
T ss_dssp             HHHHHHHHHTTCCTTCCCTTCCCHHHHHHHTTCHHHHHHHHTTTCCTTCCCTTCCCHHHHHHHHTCHHHHHHHHHHTCCT
T ss_pred             hhhhhhhhhccccccccCCCCCCHHHHHHHhCcHhHhhhhhccccccccccCCCCChhhhhhhcCcHHHHHHHHHCCCcc
Confidence            22                  567777777777777777777777777777777777777777777777777777777777


Q ss_pred             ccCCCCCCcHHHHHHHcCCHHHHHHhhhcCCCCCcccCCCCCCcHHHHHHhCCCHHHHHHHHHcCCCCC--------hhH
Q psy14202        270 LREDGEGLTALSWACMRGRIQAVTYLLDRDRGAMIEHVDINGLRPLDRAISCRNVPVVQCFLRKGAKLG--------PTT  341 (356)
Q Consensus       270 ~~~~~~g~t~l~~a~~~~~~~~v~~Ll~~~~~~~~~~~~~~g~t~l~~A~~~~~~~i~~~Ll~~ga~~~--------~~~  341 (356)
                      +..+..+.|||+.++..++.++++++++  .|++++.+|.+|.||||+|++.|+.+++++|+++||++|        +..
T Consensus       291 ~~~~~~~~t~L~~~~~~~~~~~~~~ll~--~g~~in~~d~~G~T~Lh~A~~~g~~~iv~~Ll~~GAd~n~~d~~G~t~L~  368 (408)
T d1n11a_         291 DATTRMGYTPLHVASHYGNIKLVKFLLQ--HQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLA  368 (408)
T ss_dssp             TCCCSSCCCHHHHHHHSSCSHHHHHHHH--TTCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCSCCCCSSSCCHHH
T ss_pred             ccccccccccchhhcccCcceeeeeecc--ccccccccCCCCCCHHHHHHHcCCHHHHHHHHHCCCCCCCCCCCCCCHHH
Confidence            7777777777777777777777777777  677777777777777777777777777777777777775        456


Q ss_pred             HHHhhCCcceeccC
Q psy14202        342 WSMAAGKPEVMENF  355 (356)
Q Consensus       342 ~a~~~~~~~~~~~l  355 (356)
                      +|+..|+.++|++|
T Consensus       369 ~A~~~~~~~iv~~L  382 (408)
T d1n11a_         369 IAKRLGYISVTDVL  382 (408)
T ss_dssp             HHHHTTCHHHHHHH
T ss_pred             HHHHcCCHHHHHHH
Confidence            77777777777765



>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure