Psyllid ID: psy14234


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------78
MSAAETETATDPVVNQNGTGDPDPVKAEQDVKVNNNNTSDSTSSSSPPPSSTEVTPVKKSPAPPSSSSSAPAPSHHNESNSGNSTKAASVEPPPRDEPRLEPVDGIVQPPVVPPKHRPGRNTNQLQYIVKNVMKAVWKHPHAWPFHEPVDAINLNLPDYHKVITQPMDLGTIKKRLENNYYWSGKEAIQDFTTMFTNCYVYNKPGEDVVLMAQNLEQLFLTKITGMPSEEVVLDAPQPRSSKKKPPVSASPSLNPVIKTPVIPLNKLPSATSTPKPRPPNPVLGSTATTTTAPKVNHLNSMNAPDTPDMKKAIKRKADGSIDHTPSSLHPTPVKSAKQLNTRRESGSITKKPQRISEEGGGGSGLGGSKTPLWYKYCSEIIAELFHKKHQNYAWPFYTPVDVEKLGLTDYFDIIKKPMDLGTVRKKMRNRTYKTAKEFADDVRLIFSNCYKYNPPDHNVVTMARQLSAVFEDRFAKMPDESNLASRAAASVSSDDDSEDERQNQLKYLQEQLKSLTDQIRLLVEDSTKPKKKKKKNRDQPKSKMPMGQNSAMMNDHVNKMNKAPAPLNNGQKPKSLNNVRKPQASNPQQAKKPKPNNANTVAAKKQVRTFDSEDEDVAKPMSYDEKRQLSLDINKLPGDKLGKVVHIIQSREPSLREPNPDEIEIDFETLKPSTLRELEQYVSSCLRKRTYKKTPKPKDEKFAEKKHELEKRLQDVTSQIDSTNKKLKKPKPTTSAAGPTGASRLSASSSSSSDSDSSGQSTSSSSSESSDSEGEKGPH
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHcccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccccccccHHcccccccHHHHcccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccHHccccccccccccccccccccHHHHHHHHHHHcccccccHHHHHHHHHHccccccccccccEEEEcccccHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccccHHHcccccHHHHccccccHHHHHHHHHccccccHHHHHHHHHHHHHccEEEcccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccHHHcccccccccccHHHHccccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccHHHHHHcccccccccccccccHccccHHHHHHHHcccHHHHHHHHcccHHHHHHHHHHHHHHHHHccHHHHHHHHccHHHccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccHcccccccHHHHHHccccccccccHHHccEEEEEEcccccccccccccEEEEHHcccHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
msaaetetatdpvvnqngtgdpdpvkaeqdvkvnnnntsdstsssspppsstevtpvkkspappsssssapapshhnesnsgnstkaasveppprdeprlepvdgivqppvvppkhrpgrntnQLQYIVKNVMKAVwkhphawpfhepvdainlnlpdyhkvitqpmdlgTIKKRlennyywsgkEAIQDFTTMFTNcyvynkpgEDVVLMAQNLEQLFLTKitgmpseevvldapqprsskkkppvsaspslnpviktpviplnklpsatstpkprppnpvlgstattttapkvnhlnsmnapdtpdMKKAIKRkadgsidhtpsslhptpvksakqlntrresgsitkkpqriseeggggsglggsktplWYKYCSEIIAELFHKkhqnyawpfytpvdveklgltdyFDIIKKPMDLGTVRKKMRNRTYKTAKEFADDVRLIFSncykynppdhnvVTMARQLSAVFEDrfakmpdesnlasraaasvssdddseDERQNQLKYLQEQLKSLTDQIRLLVedstkpkkkkkknrdqpkskmpmgqnsammndhvnkmnkapaplnngqkpkslnnvrkpqasnpqqakkpkpnnantvAAKKQVrtfdsededvakpmsydekrQLSLDinklpgdklgkVVHIIQsrepslrepnpdeieidfetlkpstLRELEQYVSSCLrkrtykktpkpkdekFAEKKHELEKRLQDVTSQIDstnkklkkpkpttsaagptgasrlsassssssdsdssgqstsssssessdsegekgph
msaaetetatdpvvnqngtgdpdPVKAEQDVKVNNnntsdstsssspppsstEVTPVKKSPAPPSSSSSAPAPShhnesnsgnstkAASVEPPPRDEPRLEPVDGIVQppvvppkhrpgrntNQLQYIVKNVMKAVWKHPHAWPFHEPVDAINLNLPDYHKVITQPMDLGTIKKRLENNYYWSGKEAIQDFTTMFTNCYVYNKPGEDVVLMAQNLEQLFLTKITGMPSEEVVLDapqprsskkkppvsaspslnpviktpviPLNKLpsatstpkprppnpvlgstattttapkvnhlnsmnapdtpDMKKAIKRKADGSidhtpsslhptpvksakqlntrresgsitkkpqriseeggggsglggskTPLWYKYCSEIIAELFHKKHQNYAWPFYTPVDVEKLGLTDYFDiikkpmdlgtvrkkmrnrtyktakefaddvrLIFSNCYKYNPPDHNVVTMARQLSAVFEDRFAKMPDESNLASRAaasvssdddseDERQNQLKYLQEQLKSLTDQIRllvedstkpkkkkkknrdqpkskmpmgqnsAMMNDHVNKMNKAPAPLNNGQKPKSLNNVRKPQAsnpqqakkpkpnnantvaakkqvrtfdsededvakpmsydekrqlsldinklpgdklgKVVHIIqsrepslrepnpdeIEIDfetlkpstlreLEQYVssclrkrtykktpkpkdekfaekkhelekrlqdvtsqidstnkklkkpkpttsaagptgasrlsassssssdsdssgqstsssssessdsegekgph
MSAAETETATDPVVNQNGTGDPDPVKAEQDvkvnnnntsdstsssspppsstevtpvKKspappsssssapapsHHNESNSGNSTKAASveppprdeprlepvdGIVQPPVVPPKHRPGRNTNQLQYIVKNVMKAVWKHPHAWPFHEPVDAINLNLPDYHKVITQPMDLGTIKKRLENNYYWSGKEAIQDFTTMFTNCYVYNKPGEDVVLMAQNLEQLFLTKITGMPSEEVVLDApqprsskkkppvsaspsLNPVIKTPVIPLNKLPSATSTPKPRPPNPVLGSTATTTTAPKVNHLNSMNAPDTPDMKKAIKRKADGSIDHTPSSLHPTPVKSAKQLNTRRESGSITKKPQRIseeggggsglggsKTPLWYKYCSEIIAELFHKKHQNYAWPFYTPVDVEKLGLTDYFDIIKKPMDLGTVRKKMRNRTYKTAKEFADDVRLIFSNCYKYNPPDHNVVTMARQLSAVFEDRFAKMPDESNLasraaasvssdddsederQNQLKYLQEQLKSLTDQIRLLVEDSTkpkkkkkkNRDQPKSKMPMGQNSAMMNDHVNKMNKAPAPLNNGQKPKSLNNVRKPQASNPQQAKKPKPNNANTVAAKKQVRTFDSEDEDVAKPMSYDEKRQLSLDINKLPGDKLGKVVHIIQSREPSLREPNPDEIEIDFETLKPSTLRELEQYVSSCLrkrtykktpkpkDEKFAEKKHELEKRLQDVTSQIDSTNkklkkpkpttSAAGPTGAsrlsassssssdsdssgqstsssssessdsEGEKGPH
***************************************************************************************************************************QLQYIVKNVMKAVWKHPHAWPFHEPVDAINLNLPDYHKVITQPMDLGTIKKRLENNYYWSGKEAIQDFTTMFTNCYVYNKPGEDVVLMAQNLEQLFLTKITGM*************************************************************************************************************************************************LWYKYCSEIIAELFHKKHQNYAWPFYTPVDVEKLGLTDYFDIIKKPMDLGTVRKKMRNRTYKTAKEFADDVRLIFSNCYKYNPPDHNVVTMARQLSAVFE*************************************************************************************************************************************************************************LGKVVHII***********************************************************************************************************************************
******************************************************************************************************************************YIVKNVMKAVWKHPHAWPFHEPVDAINLNLPDYHKVITQPMDLGTIKKRLENNYYWSGKEAIQDFTTMFTNCYVYNKPGEDVVLMAQNLEQLFLTKITGMPSEEVVLDAPQPRSSKKKPPVSASPSLNPVIKTPVIPLNKLPSATSTPKPRPPNP***********************DTPDMKKAIKRK*********************************************************YKYCSEIIAELFHKKHQNYAWPFYTPVDVEKLGLTDYFDIIKKPMDLGTVRKKMRNRTYKTAKEFADDVRLIFSNCYKYNPPDHNVVTMARQLSAVFEDRFAK**************************************************************************************APA*********************************************************************KLPGDKLGKVVH*****************EIDFETLKPSTLRELEQYV*************************************************************************************************
***********PVVNQNGTGDPDPVKAEQDVKVNN**************************************************************PRLEPVDGIVQPPVVPPKHRPGRNTNQLQYIVKNVMKAVWKHPHAWPFHEPVDAINLNLPDYHKVITQPMDLGTIKKRLENNYYWSGKEAIQDFTTMFTNCYVYNKPGEDVVLMAQNLEQLFLTKITGMPSEEVV*******************SLNPVIKTPVIPLNKLPS***********PVLGSTATTTTAPKVNHLNSMNAPDTPDMKKAIKRKADGSIDHTPSS************************************GLGGSKTPLWYKYCSEIIAELFHKKHQNYAWPFYTPVDVEKLGLTDYFDIIKKPMDLGTVRKKMRNRTYKTAKEFADDVRLIFSNCYKYNPPDHNVVTMARQLSAVFEDRFAKMPDE**********************NQLKYLQEQLKSLTDQIRLLVEDS********************GQNSAMMNDHVNKMNKAPAPLNNGQKPKSLNNV*********************VAAKKQVR**********KPMSYDEKRQLSLDINKLPGDKLGKVVHIIQSREPSLREPNPDEIEIDFETLKPSTLRELEQYVSSCLRKRTYKKTPKPKDEKFAEKKHELEKRLQDVTS*************************************************************
**********************************************************************************************************************GRNTNQLQYIVKNVMKAVWKHPHAWPFHEPVDAINLNLPDYHKVITQPMDLGTIKKRLENNYYWSGKEAIQDFTTMFTNCYVYNKPGEDVVLMAQNLEQLFLTKITGMP********************************************************************************************************************************************SKTPLWYKYCSEIIAELFHKKHQNYAWPFYTPVDVEKLGLTDYFDIIKKPMDLGTVRKKMRNRTYKTAKEFADDVRLIFSNCYKYNPPDHNVVTMARQLSAVFEDRFAKMPDES****************************************************************************************************************************************AKPMSYDEKRQLSLDINKLPGDKLGKVVHIIQSREPSLREPNPDEIEIDFETLKPSTLRELEQYVSSCLRKR******************************************************************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSAAETETATDPVVNQNGTGDPDPVKAEQDVKVNNNNTSDSTSSSSPPPSSTEVTPVKKSPAPPSSSSSAPAPSHHNESNSGNSTKAASVEPPPRDEPRLEPVDGIVQPPVVPPKHRPGRNTNQLQYIVKNVMKAVWKHPHAWPFHEPVDAINLNLPDYHKVITQPMDLGTIKKRLENNYYWSGKEAIQDFTTMFTNCYVYNKPGEDVVLMAQNLEQLFLTKITGMPSEEVVLDAPQPRSSKKKPPVSASPSLNPVIKTPVIPLNKLPSATSTPKPRPPNPVLGSTATTTTAPKVNHLNSMNAPDTPDMKKAIKRKADGSIDHTPSSLHPTPVKSAKQLNTRRESGSITKKPQRISEEGGGGSGLGGSKTPLWYKYCSEIIAELFHKKHQNYAWPFYTPVDVEKLGLTDYFDIIKKPMDLGTVRKKMRNRTYKTAKEFADDVRLIFSNCYKYNPPDHNVVTMARQLSAVFEDRFAKMPDESNLASRAAASVSSDDDSxxxxxxxxxxxxxxxxxxxxxxxxxxxxSTKPKKKKKKNRDQPKSKMPMGQNSAMMNDHVNKMNKAPAPLNNGQKPKSLNNVRKPQASNPQQAKKPKPNNANTVAAKKQVRTFDSEDEDVAKPMSYDEKRQLSLDINKLPGDKLGKVVHIIQSREPSLREPNPDEIEIDFETLKPSTLRELEQYVSSCLRKRTYKKTPKPKDEKFAEKxxxxxxxxxxxxxxxxxxxxxLKKPKPTTSAAGPTGASRLSASSSSSSDSDSSGQSTSSSSSESSDSEGEKGPH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query779 2.2.26 [Sep-21-2011]
Q6MGA9798 Bromodomain-containing pr yes N/A 0.803 0.784 0.446 1e-143
Q15059726 Bromodomain-containing pr yes N/A 0.792 0.849 0.457 1e-140
Q58F21 947 Bromodomain testis-specif no N/A 0.744 0.612 0.436 1e-136
Q4R8Y1 947 Bromodomain testis-specif N/A N/A 0.747 0.614 0.432 1e-134
Q91Y44 956 Bromodomain testis-specif yes N/A 0.725 0.591 0.424 1e-134
F1QW93 918 Bromodomain testis-specif no N/A 0.645 0.547 0.426 1e-122
F7DRV9 933 Bromodomain testis-specif no N/A 0.740 0.618 0.417 1e-115
P25440801 Bromodomain-containing pr no N/A 0.463 0.450 0.493 1e-99
Q7JJ13798 Bromodomain-containing pr no N/A 0.463 0.452 0.491 2e-99
Q32S26803 Bromodomain-containing pr no N/A 0.463 0.449 0.488 4e-99
>sp|Q6MGA9|BRD2_RAT Bromodomain-containing protein 2 OS=Rattus norvegicus GN=Brd2 PE=2 SV=1 Back     alignment and function desciption
 Score =  508 bits (1308), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 322/721 (44%), Positives = 412/721 (57%), Gaps = 95/721 (13%)

Query: 109 PPVVPPKHRPGRNTNQLQYIVKNVMKAVWKHPHAWPFHEPVDAINLNLPDYHKVITQPMD 168
           PP V    +PGR TNQLQY+ K VMKA+WKH  AWPF +PVDA+ L LPDYHK+I QPMD
Sbjct: 62  PPEVSNPKKPGRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMD 121

Query: 169 LGTIKKRLENNYYWSGKEAIQDFTTMFTNCYVYNKPGEDVVLMAQNLEQLFLTKITGMPS 228
           +GTIK+RLENNYYW+  E +QDF TMFTNCY+YNKP +D+VLMAQ LE++FL K+  MP 
Sbjct: 122 MGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKIFLQKVASMPQ 181

Query: 229 EEVVLDAPQPRSSKKKPPVSASPSLNPVIKTPVIPLNKLPSATS-------TPKPRPPNP 281
           EE  L    P++S KK    A+      ++  +   +++P+ +S       TP P  P  
Sbjct: 182 EEQELVVTIPKNSHKKGAKLAA------LQGSITSAHQVPAVSSVSHTALYTPPPEIPTT 235

Query: 282 VLGS-TATTTTAPKVNHLNSMNAPDTP----------DMKKAIKRKAD------------ 318
           VL     +  ++P +  L+S   P               KK +KRKAD            
Sbjct: 236 VLNIPHPSVISSPLLKSLHSAGPPLLAVSAAPPAQPLAKKKGVKRKADTTTPTPTAILAP 295

Query: 319 GSIDHTPSSLHPTPVKSAKQLNTRRESGSITKKPQR---ISEEGGGGSGLGGSKTPLWYK 375
           GS    P SL P   K+A+    RRESG   K P++    S++    S  G     L  K
Sbjct: 296 GSPASPPGSLEP---KAARLPPMRRESGRPIKPPRKDLPDSQQQHQSSKKGKLSEQL--K 350

Query: 376 YCSEIIAELFHKKHQNYAWPFYTPVDVEKLGLTDYFDIIKKPMDLGTVRKKMRNRTYKTA 435
           +C+ I+ EL  KKH  YAWPFY PVD   LGL DY DIIK PMDL TV++KM NR Y+ A
Sbjct: 351 HCNGILKELLSKKHAAYAWPFYKPVDASALGLHDYHDIIKHPMDLSTVKRKMENRDYRDA 410

Query: 436 KEFADDVRLIFSNCYKYNPPDHNVVTMARQLSAVFEDRFAKMPDE--------------S 481
           +EFA DVRL+FSNCYKYNPPDH+VV MAR+L  VFE R+AKMPDE               
Sbjct: 411 QEFAADVRLMFSNCYKYNPPDHDVVAMARKLQDVFEFRYAKMPDEPLEPGPLPVSTALPP 470

Query: 482 NLA------------------------SRAAASVSSDDDSEDERQNQLKYLQEQLKSLTD 517
            LA                               S   DSE+ER ++L  LQEQL+++ +
Sbjct: 471 GLAKSSSESSSEESSSESSSEEEEEEDEEDEEEESESSDSEEERAHRLAELQEQLRAVHE 530

Query: 518 QIRLLVEDSTKPKKKKKKNRDQPKSKMPMGQNSAMMNDHVNKMNKAPAPLN------NGQ 571
           Q+  L +      K+K++ +++ K +        +  D  +K  +AP PL        G 
Sbjct: 531 QLAALSQGPISKPKRKREKKEKKKKRKAEKHRGRIGIDEDDKGPRAPRPLQPKKSKKAGG 590

Query: 572 KPKSLNNVRKPQASNPQQAKKPKPNNANTVAAKKQVRTFDSEDEDVAKPMSYDEKRQLSL 631
              +   +  P       +    P  A   A       +DSE+E+ ++PMSYDEKRQLSL
Sbjct: 591 GGSNATTLSHPGFGTSAGSSNKLPKKAQKTAPPVLPTGYDSEEEEESRPMSYDEKRQLSL 650

Query: 632 DINKLPGDKLGKVVHIIQSREPSLREPNPDEIEIDFETLKPSTLRELEQYVSSCLRKR-- 689
           DINKLPG+KLG+VVHIIQ+REPSLR+ NP+EIEIDFETLKPSTLRELE+YV SCLRK+  
Sbjct: 651 DINKLPGEKLGRVVHIIQAREPSLRDSNPEEIEIDFETLKPSTLRELERYVLSCLRKKPR 710

Query: 690 ----TYKKTPKPKDEKFAEKKHELEKRLQDVTSQIDSTNKKLKKP-KPTTSAAGPTGASR 744
                 K   K K+E   EKK ELEKRLQDV+ Q++ST K  KK  + T S+A     SR
Sbjct: 711 KPYTIRKPVGKTKEELALEKKRELEKRLQDVSGQLNSTKKPPKKASEKTESSAQQVAVSR 770

Query: 745 L 745
           L
Sbjct: 771 L 771




May play a role in spermatogenesis or folliculogenesis.
Rattus norvegicus (taxid: 10116)
>sp|Q15059|BRD3_HUMAN Bromodomain-containing protein 3 OS=Homo sapiens GN=BRD3 PE=1 SV=1 Back     alignment and function description
>sp|Q58F21|BRDT_HUMAN Bromodomain testis-specific protein OS=Homo sapiens GN=BRDT PE=1 SV=4 Back     alignment and function description
>sp|Q4R8Y1|BRDT_MACFA Bromodomain testis-specific protein OS=Macaca fascicularis GN=BRDT PE=2 SV=3 Back     alignment and function description
>sp|Q91Y44|BRDT_MOUSE Bromodomain testis-specific protein OS=Mus musculus GN=Brdt PE=1 SV=3 Back     alignment and function description
>sp|F1QW93|BRDT_DANRE Bromodomain testis-specific protein OS=Danio rerio GN=brdt PE=2 SV=2 Back     alignment and function description
>sp|F7DRV9|BRDT_XENTR Bromodomain testis-specific protein OS=Xenopus tropicalis GN=brdt PE=3 SV=1 Back     alignment and function description
>sp|P25440|BRD2_HUMAN Bromodomain-containing protein 2 OS=Homo sapiens GN=BRD2 PE=1 SV=2 Back     alignment and function description
>sp|Q7JJ13|BRD2_MOUSE Bromodomain-containing protein 2 OS=Mus musculus GN=Brd2 PE=1 SV=1 Back     alignment and function description
>sp|Q32S26|BRD2_BOVIN Bromodomain-containing protein 2 OS=Bos taurus GN=BRD2 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query779
307182453 1541 Homeotic protein female sterile [Campono 0.838 0.423 0.472 1e-172
322801602877 hypothetical protein SINV_03245 [Solenop 0.835 0.742 0.472 1e-165
242009661803 Bromodomain-containing protein, putative 0.848 0.823 0.496 1e-161
328703281 1162 PREDICTED: hypothetical protein LOC10016 0.807 0.541 0.483 1e-160
270001347815 hypothetical protein TcasGA2_TC030708 [T 0.830 0.793 0.475 1e-150
321456065754 hypothetical protein DAPPUDRAFT_302185 [ 0.736 0.761 0.484 1e-149
432094627 881 Bromodomain-containing protein 2 [Myotis 0.808 0.715 0.454 1e-141
47059183798 bromodomain-containing protein 2 [Rattus 0.803 0.784 0.446 1e-141
327288352734 PREDICTED: bromodomain-containing protei 0.790 0.839 0.461 1e-141
417404197725 Putative transcription initiation factor 0.771 0.828 0.456 1e-140
>gi|307182453|gb|EFN69688.1| Homeotic protein female sterile [Camponotus floridanus] Back     alignment and taxonomy information
 Score =  612 bits (1578), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 395/836 (47%), Positives = 477/836 (57%), Gaps = 183/836 (21%)

Query: 91  EPPPRDEPRLEPVDGIVQPPVVPPKHRPGRNTNQLQYIVKNVMKAVWKHPHAWPFHEPVD 150
           EPPPRDEP LEPV+GIVQPPVVPP +RPGR TNQLQ++ K V+K VWKH  AWPF +PVD
Sbjct: 60  EPPPRDEPPLEPVNGIVQPPVVPPPNRPGRITNQLQFLQKGVLKPVWKHQFAWPFQQPVD 119

Query: 151 AINLNLPDYHKVITQPMDLGTIKKRLENNYYWSGKEAIQDFTTMFTNCYVYNKPGEDVVL 210
           A  LNLPDYHK+I +PMDLGTIKKRLEN+YYWSGKE IQDF TMFTNCYVYNKPGEDVV+
Sbjct: 120 AKKLNLPDYHKIIKKPMDLGTIKKRLENSYYWSGKECIQDFNTMFTNCYVYNKPGEDVVV 179

Query: 211 MAQNLEQLFLTKITGMPSEEVVLDAPQPRSSKKK-----------------PPVSASPSL 253
           MAQ LE+LFLTK+  MP EEV LD P P+  K K                       P+ 
Sbjct: 180 MAQALEKLFLTKVAQMPKEEVELDPPVPKGPKGKKAGRVGGPGVGGLAGGTGAGRGRPAS 239

Query: 254 NPVIKTPVIPLNKLPSATST------PKP----RPPNPVLGSTATTTTAP----KVNHLN 299
                T  +P N  PSATS       P P    + P  V GST TTT AP     V  + 
Sbjct: 240 GAAAVTSSVPNNLTPSATSAGTTGVIPMPPLGTQAPVSVPGSTNTTTIAPPSSMGVAPMA 299

Query: 300 SMNA----------------------------------------PDTP-DMKKAIKRKAD 318
           + N+                                        P  P  +KK +KRKAD
Sbjct: 300 THNSLPQQVVPPTTGYHAQPAMDPQAASAVPPPPQVPTTPTVMPPSQPAKLKKGVKRKAD 359

Query: 319 GSIDHTPSSLHP--TPVKSAK-QLNTRRESGSITKKPQRISEEG------------GG-- 361
            +   T ++  P  TP+ S   ++  RRESG   KKP R +E+G            G   
Sbjct: 360 TTTP-TANAYDPMYTPLDSKNAKIPMRRESGRQIKKPTRQAEDGLVPYHQANMPLMGAMA 418

Query: 362 ----GSGL-GGSKTPLWYKYCSEIIAELFHKKHQNYAWPFYTPVDVEKLGLTDYFDIIKK 416
                +G+ G  K     K C++I+ ELF KKH +YAWPFY PVD E LGL DY +IIKK
Sbjct: 419 QQPSHTGVKGKEKLSEALKSCNDILKELFAKKHSSYAWPFYKPVDAELLGLHDYHEIIKK 478

Query: 417 PMDLGTVRKKMRNRTYKTAKEFADDVRLIFSNCYKYNPPDHNVVTMARQLSAVFEDRFAK 476
           PMDLGTV+ KM NR YKTA EFA DVRLIF+NCYKYNPPDH+VV+MAR+L  +FE R+AK
Sbjct: 479 PMDLGTVKAKMDNRQYKTAHEFASDVRLIFTNCYKYNPPDHDVVSMARKLQDIFEMRYAK 538

Query: 477 MPDESNLASRAA---------------ASVSSDDDSEDERQNQLKYLQEQLKSLTDQIRL 521
           +PDE   +S  A               +S  +DD  E++R  +L  LQ++LK++ +Q+R 
Sbjct: 539 VPDEPMGSSIVAMKGSSSGSATSSGGESSSETDDSVEEQRTQKLLALQQELKAMQEQMRK 598

Query: 522 LVEDSTKPKKKKKKNRDQPKSKMPMGQNSAMMNDHVNKM--------------------- 560
           LVE+S K K KKKK        M   +NS+++  H   M                     
Sbjct: 599 LVEESGKKKNKKKKPDKPKSKPMS-NKNSSLVASHTGAMKELMKPSGGIPSVTDSVGASI 657

Query: 561 -----------------------------NKAPAPLNNGQK-PKSLNNVRKPQASNPQQA 590
                                        NKA A  N G   P + N  +K ++  P +A
Sbjct: 658 ASVAMGAGDLKMPGGMGSDLHHQSTAVGPNKAHAAGNLGHHLPPAANAKQKGKSRGPGKA 717

Query: 591 --------KKPKPNNANTVAAKKQVR------TFDSEDEDVAKPMSYDEKRQLSLDINKL 636
                   K+PK N+ +    KK         TFDSEDED AKPMSYDEKRQLSLDINKL
Sbjct: 718 ATTANPATKRPKANSRSAGNKKKNTGSQPPPITFDSEDEDNAKPMSYDEKRQLSLDINKL 777

Query: 637 PGDKLGKVVHIIQSREPSLREPNPDEIEIDFETLKPSTLRELEQYVSSCLRKRTYKK-TP 695
           PGDKLG+VVHIIQSREPSLR+ NPDEIEIDFETLKPSTLRELE YV+SCLRK+ +KK + 
Sbjct: 778 PGDKLGRVVHIIQSREPSLRDSNPDEIEIDFETLKPSTLRELESYVASCLRKKPHKKVSG 837

Query: 696 KPKDEKFAEKKHELEKRLQDVTSQIDSTNKKLKKPKPTT------SAAGPTGASRL 745
           K KDE+ AEKK ELEKRLQDVT Q+ + NKK  K + ++         G +G SRL
Sbjct: 838 KSKDEQMAEKKQELEKRLQDVTGQLGNVNKKTAKKEDSSKSVDVVGTGGASGPSRL 893




Source: Camponotus floridanus

Species: Camponotus floridanus

Genus: Camponotus

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|322801602|gb|EFZ22243.1| hypothetical protein SINV_03245 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|242009661|ref|XP_002425601.1| Bromodomain-containing protein, putative [Pediculus humanus corporis] gi|212509494|gb|EEB12863.1| Bromodomain-containing protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|328703281|ref|XP_001944541.2| PREDICTED: hypothetical protein LOC100164694 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|270001347|gb|EEZ97794.1| hypothetical protein TcasGA2_TC030708 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|321456065|gb|EFX67182.1| hypothetical protein DAPPUDRAFT_302185 [Daphnia pulex] Back     alignment and taxonomy information
>gi|432094627|gb|ELK26133.1| Bromodomain-containing protein 2 [Myotis davidii] Back     alignment and taxonomy information
>gi|47059183|ref|NP_997660.1| bromodomain-containing protein 2 [Rattus norvegicus] gi|392355205|ref|XP_003751971.1| PREDICTED: bromodomain-containing protein 2-like [Rattus norvegicus] gi|81872356|sp|Q6MGA9.1|BRD2_RAT RecName: Full=Bromodomain-containing protein 2; AltName: Full=Protein RING3 gi|46237556|emb|CAE83937.1| bromodomain-containing 2 [Rattus norvegicus] gi|149043366|gb|EDL96817.1| bromodomain containing 2, isoform CRA_b [Rattus norvegicus] Back     alignment and taxonomy information
>gi|327288352|ref|XP_003228892.1| PREDICTED: bromodomain-containing protein 3-like [Anolis carolinensis] Back     alignment and taxonomy information
>gi|417404197|gb|JAA48868.1| Putative transcription initiation factor tfiid subunit bdf1 [Desmodus rotundus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query779
FB|FBgn0004656 2038 fs(1)h "female sterile (1) hom 0.166 0.063 0.746 3.6e-145
UNIPROTKB|H9L2H3859 LOC100859056 "Uncharacterized 0.540 0.490 0.446 5.5e-128
UNIPROTKB|O60885 1362 BRD4 "Bromodomain-containing p 0.541 0.309 0.438 7.4e-128
UNIPROTKB|I3L6E5 1372 BRD4 "Uncharacterized protein" 0.541 0.307 0.435 4.3e-126
UNIPROTKB|E1BNS3 1367 BRD4 "Uncharacterized protein" 0.540 0.307 0.437 8.8e-126
MGI|MGI:1888520 1400 Brd4 "bromodomain containing 4 0.541 0.301 0.438 1.1e-125
ZFIN|ZDB-GENE-990415-248838 brd2a "bromodomain-containing 0.273 0.254 0.459 1.6e-121
UNIPROTKB|Q58F21 947 BRDT "Bromodomain testis-speci 0.462 0.380 0.437 1.4e-118
ZFIN|ZDB-GENE-030131-267 1444 brd4 "bromodomain containing 4 0.157 0.085 0.650 6.3e-117
UNIPROTKB|Q4R8Y1 947 BRDT "Bromodomain testis-speci 0.455 0.374 0.434 6.8e-117
FB|FBgn0004656 fs(1)h "female sterile (1) homeotic" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 558 (201.5 bits), Expect = 3.6e-145, Sum P(6) = 3.6e-145
 Identities = 97/130 (74%), Positives = 110/130 (84%)

Query:   105 GIVQPPVVPPKHRPGRNTNQLQYIVKNVMKAVWKHPHAWPFHEPVDAINLNLPDYHKVIT 164
             GIVQPPV+PP  RPGRNTNQLQY++K VMK +WKH  +WPF +PVDA  LNLPDYHK+I 
Sbjct:    19 GIVQPPVIPPAERPGRNTNQLQYLIKTVMKVIWKHHFSWPFQQPVDAKKLNLPDYHKIIK 78

Query:   165 QPMDLGTIKKRLENNYYWSGKEAIQDFTTMFTNCYVYNKPGEDVVLMAQNLEQLFLTKIT 224
             QPMD+GTIKKRLENNYYWS KE IQDF TMF NCYVYNKPGEDVV+MAQ LE++FL KI 
Sbjct:    79 QPMDMGTIKKRLENNYYWSAKETIQDFNTMFNNCYVYNKPGEDVVVMAQTLEKVFLQKIE 138

Query:   225 GMPSEEVVLD 234
              MP EE+ L+
Sbjct:   139 SMPKEELELE 148


GO:0006357 "regulation of transcription from RNA polymerase II promoter" evidence=NAS
GO:0003677 "DNA binding" evidence=NAS
GO:0004672 "protein kinase activity" evidence=NAS
GO:0007362 "terminal region determination" evidence=IMP
GO:0045892 "negative regulation of transcription, DNA-dependent" evidence=IMP
GO:0007476 "imaginal disc-derived wing morphogenesis" evidence=IMP
UNIPROTKB|H9L2H3 LOC100859056 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|O60885 BRD4 "Bromodomain-containing protein 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|I3L6E5 BRD4 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E1BNS3 BRD4 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1888520 Brd4 "bromodomain containing 4" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-990415-248 brd2a "bromodomain-containing 2a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q58F21 BRDT "Bromodomain testis-specific protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-267 brd4 "bromodomain containing 4" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q4R8Y1 BRDT "Bromodomain testis-specific protein" [Macaca fascicularis (taxid:9541)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6MGA9BRD2_RATNo assigned EC number0.44660.80350.7844yesN/A
Q15059BRD3_HUMANNo assigned EC number0.45760.79200.8498yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query779
cd05497107 cd05497, Bromo_Brdt_I_like, Bromodomain, Brdt_like 2e-65
cd05498102 cd05498, Bromo_Brdt_II_like, Bromodomain, Brdt_lik 3e-56
cd05499102 cd05499, Bromo_BDF1_2_II, Bromodomain 3e-41
cd0550699 cd05506, Bromo_plant1, Bromodomain, uncharacterize 1e-37
smart00297107 smart00297, BROMO, bromo domain 4e-33
smart00297107 smart00297, BROMO, bromo domain 6e-32
cd0436999 cd04369, Bromodomain, Bromodomain 7e-32
cd05509101 cd05509, Bromo_gcn5_like, Bromodomain; Gcn5_like s 3e-30
cd05498102 cd05498, Bromo_Brdt_II_like, Bromodomain, Brdt_lik 3e-29
cd05497107 cd05497, Bromo_Brdt_I_like, Bromodomain, Brdt_like 5e-29
cd0550699 cd05506, Bromo_plant1, Bromodomain, uncharacterize 8e-29
cd0436999 cd04369, Bromodomain, Bromodomain 2e-28
cd05509101 cd05509, Bromo_gcn5_like, Bromodomain; Gcn5_like s 5e-27
cd05499102 cd05499, Bromo_BDF1_2_II, Bromodomain 9e-26
cd05500103 cd05500, Bromo_BDF1_2_I, Bromodomain 2e-25
cd05504115 cd05504, Bromo_Acf1_like, Bromodomain; Acf1_like o 1e-23
cd05500103 cd05500, Bromo_BDF1_2_I, Bromodomain 2e-22
cd05495108 cd05495, Bromo_cbp_like, Bromodomain, cbp_like sub 8e-22
pfam0043984 pfam00439, Bromodomain, Bromodomain 1e-21
cd05510112 cd05510, Bromo_SPT7_like, Bromodomain; SPT7_like s 2e-21
cd05511112 cd05511, Bromo_TFIID, Bromodomain, TFIID-like subf 3e-21
cd05502109 cd05502, Bromo_tif1_like, Bromodomain; tif1_like s 3e-20
pfam0043984 pfam00439, Bromodomain, Bromodomain 8e-20
cd0550397 cd05503, Bromo_BAZ2A_B_like, Bromodomain, BAZ2A/BA 2e-19
cd05504115 cd05504, Bromo_Acf1_like, Bromodomain; Acf1_like o 1e-18
cd05496119 cd05496, Bromo_WDR9_II, Bromodomain; WDR9 repeat I 1e-17
cd05502109 cd05502, Bromo_tif1_like, Bromodomain; tif1_like s 7e-17
cd05511112 cd05511, Bromo_TFIID, Bromodomain, TFIID-like subf 1e-16
cd05495108 cd05495, Bromo_cbp_like, Bromodomain, cbp_like sub 2e-16
cd0550397 cd05503, Bromo_BAZ2A_B_like, Bromodomain, BAZ2A/BA 8e-16
cd05519103 cd05519, Bromo_SNF2, Bromodomain, SNF2-like subfam 8e-16
cd0550597 cd05505, Bromo_WSTF_like, Bromodomain; Williams sy 1e-14
COG5076371 COG5076, COG5076, Transcription factor involved in 2e-14
COG5076371 COG5076, COG5076, Transcription factor involved in 4e-14
cd05507104 cd05507, Bromo_brd8_like, Bromodomain, brd8_like s 9e-14
cd05528112 cd05528, Bromo_AAA, Bromodomain; sub-family co-occ 1e-13
cd0551298 cd05512, Bromo_brd1_like, Bromodomain; brd1_like s 5e-13
cd05529128 cd05529, Bromo_WDR9_I_like, Bromodomain; WDR9 repe 1e-12
cd05529128 cd05529, Bromo_WDR9_I_like, Bromodomain; WDR9 repe 3e-12
cd05510112 cd05510, Bromo_SPT7_like, Bromodomain; SPT7_like s 1e-11
cd0550597 cd05505, Bromo_WSTF_like, Bromodomain; Williams sy 1e-11
cd05507104 cd05507, Bromo_brd8_like, Bromodomain, brd8_like s 1e-11
cd0551398 cd05513, Bromo_brd7_like, Bromodomain, brd7_like s 1e-11
cd05515105 cd05515, Bromo_polybromo_V, Bromodomain, polybromo 2e-11
cd05515105 cd05515, Bromo_polybromo_V, Bromodomain, polybromo 3e-11
cd0551398 cd05513, Bromo_brd7_like, Bromodomain, brd7_like s 5e-11
cd05518103 cd05518, Bromo_polybromo_IV, Bromodomain, polybrom 5e-11
cd0550899 cd05508, Bromo_RACK7, Bromodomain, RACK7_like subf 9e-11
cd0551298 cd05512, Bromo_brd1_like, Bromodomain; brd1_like s 3e-10
cd05501102 cd05501, Bromo_SP100C_like, Bromodomain, SP100C_li 5e-10
cd05496119 cd05496, Bromo_WDR9_II, Bromodomain; WDR9 repeat I 2e-09
cd05518103 cd05518, Bromo_polybromo_IV, Bromodomain, polybrom 3e-09
cd05520103 cd05520, Bromo_polybromo_III, Bromodomain, polybro 3e-09
cd05519103 cd05519, Bromo_SNF2, Bromodomain, SNF2-like subfam 6e-09
cd05528112 cd05528, Bromo_AAA, Bromodomain; sub-family co-occ 9e-09
cd05522104 cd05522, Bromo_Rsc1_2_II, Bromodomain, repeat II i 1e-08
cd05522104 cd05522, Bromo_Rsc1_2_II, Bromodomain, repeat II i 1e-08
cd05516107 cd05516, Bromo_SNF2L2, Bromodomain, SNF2L2-like su 4e-08
cd05521106 cd05521, Bromo_Rsc1_2_I, Bromodomain, repeat I in 2e-07
cd05520103 cd05520, Bromo_polybromo_III, Bromodomain, polybro 2e-06
cd05521106 cd05521, Bromo_Rsc1_2_I, Bromodomain, repeat I in 2e-06
cd05516107 cd05516, Bromo_SNF2L2, Bromodomain, SNF2L2-like su 3e-06
cd05524113 cd05524, Bromo_polybromo_I, Bromodomain, polybromo 3e-06
cd05517103 cd05517, Bromo_polybromo_II, Bromodomain, polybrom 4e-06
cd05494114 cd05494, Bromodomain_1, Bromodomain; uncharacteriz 9e-06
cd0550899 cd05508, Bromo_RACK7, Bromodomain, RACK7_like subf 1e-05
cd05494114 cd05494, Bromodomain_1, Bromodomain; uncharacteriz 2e-05
cd05525106 cd05525, Bromo_ASH1, Bromodomain; ASH1_like sub-fa 2e-05
cd05501102 cd05501, Bromo_SP100C_like, Bromodomain, SP100C_li 4e-05
PTZ001081388 PTZ00108, PTZ00108, DNA topoisomerase 2-like prote 4e-05
cd05524113 cd05524, Bromo_polybromo_I, Bromodomain, polybromo 1e-04
cd05517103 cd05517, Bromo_polybromo_II, Bromodomain, polybrom 1e-04
pfam05110 1154 pfam05110, AF-4, AF-4 proto-oncoprotein 0.002
>gnl|CDD|99929 cd05497, Bromo_Brdt_I_like, Bromodomain, Brdt_like subfamily, repeat I Back     alignment and domain information
 Score =  212 bits (541), Expect = 2e-65
 Identities = 80/107 (74%), Positives = 92/107 (85%)

Query: 120 RNTNQLQYIVKNVMKAVWKHPHAWPFHEPVDAINLNLPDYHKVITQPMDLGTIKKRLENN 179
           R+TNQLQY++K V+KA+WKH  AWPF +PVDA+ LNLPDYHK+I  PMDLGTIKKRLENN
Sbjct: 1   RHTNQLQYLLKVVLKALWKHKFAWPFQQPVDAVKLNLPDYHKIIKTPMDLGTIKKRLENN 60

Query: 180 YYWSGKEAIQDFTTMFTNCYVYNKPGEDVVLMAQNLEQLFLTKITGM 226
           YYWS  E IQDF TMFTNCY+YNKPG+DVVLMAQ LE+LFL K+  M
Sbjct: 61  YYWSASECIQDFNTMFTNCYIYNKPGDDVVLMAQTLEKLFLQKLAQM 107


Human Brdt is a testis-specific member of the BET subfamily of bromodomain proteins; the first bromodomain in Brdt has been shown to be essential for male germ cell differentiation. Bromodomains are 110 amino acid long domains, that are found in many chromatin associated proteins. Bromodomains can interact specifically with acetylated lysine. Length = 107

>gnl|CDD|99930 cd05498, Bromo_Brdt_II_like, Bromodomain, Brdt_like subfamily, repeat II Back     alignment and domain information
>gnl|CDD|99931 cd05499, Bromo_BDF1_2_II, Bromodomain Back     alignment and domain information
>gnl|CDD|99938 cd05506, Bromo_plant1, Bromodomain, uncharacterized subfamily specific to plants Back     alignment and domain information
>gnl|CDD|197636 smart00297, BROMO, bromo domain Back     alignment and domain information
>gnl|CDD|197636 smart00297, BROMO, bromo domain Back     alignment and domain information
>gnl|CDD|99922 cd04369, Bromodomain, Bromodomain Back     alignment and domain information
>gnl|CDD|99941 cd05509, Bromo_gcn5_like, Bromodomain; Gcn5_like subfamily Back     alignment and domain information
>gnl|CDD|99930 cd05498, Bromo_Brdt_II_like, Bromodomain, Brdt_like subfamily, repeat II Back     alignment and domain information
>gnl|CDD|99929 cd05497, Bromo_Brdt_I_like, Bromodomain, Brdt_like subfamily, repeat I Back     alignment and domain information
>gnl|CDD|99938 cd05506, Bromo_plant1, Bromodomain, uncharacterized subfamily specific to plants Back     alignment and domain information
>gnl|CDD|99922 cd04369, Bromodomain, Bromodomain Back     alignment and domain information
>gnl|CDD|99941 cd05509, Bromo_gcn5_like, Bromodomain; Gcn5_like subfamily Back     alignment and domain information
>gnl|CDD|99931 cd05499, Bromo_BDF1_2_II, Bromodomain Back     alignment and domain information
>gnl|CDD|99932 cd05500, Bromo_BDF1_2_I, Bromodomain Back     alignment and domain information
>gnl|CDD|99936 cd05504, Bromo_Acf1_like, Bromodomain; Acf1_like or BAZ1A_like subfamily Back     alignment and domain information
>gnl|CDD|99932 cd05500, Bromo_BDF1_2_I, Bromodomain Back     alignment and domain information
>gnl|CDD|99927 cd05495, Bromo_cbp_like, Bromodomain, cbp_like subfamily Back     alignment and domain information
>gnl|CDD|215921 pfam00439, Bromodomain, Bromodomain Back     alignment and domain information
>gnl|CDD|99942 cd05510, Bromo_SPT7_like, Bromodomain; SPT7_like subfamily Back     alignment and domain information
>gnl|CDD|99943 cd05511, Bromo_TFIID, Bromodomain, TFIID-like subfamily Back     alignment and domain information
>gnl|CDD|99934 cd05502, Bromo_tif1_like, Bromodomain; tif1_like subfamily Back     alignment and domain information
>gnl|CDD|215921 pfam00439, Bromodomain, Bromodomain Back     alignment and domain information
>gnl|CDD|99935 cd05503, Bromo_BAZ2A_B_like, Bromodomain, BAZ2A/BAZ2B_like subfamily Back     alignment and domain information
>gnl|CDD|99936 cd05504, Bromo_Acf1_like, Bromodomain; Acf1_like or BAZ1A_like subfamily Back     alignment and domain information
>gnl|CDD|99928 cd05496, Bromo_WDR9_II, Bromodomain; WDR9 repeat II_like subfamily Back     alignment and domain information
>gnl|CDD|99934 cd05502, Bromo_tif1_like, Bromodomain; tif1_like subfamily Back     alignment and domain information
>gnl|CDD|99943 cd05511, Bromo_TFIID, Bromodomain, TFIID-like subfamily Back     alignment and domain information
>gnl|CDD|99927 cd05495, Bromo_cbp_like, Bromodomain, cbp_like subfamily Back     alignment and domain information
>gnl|CDD|99935 cd05503, Bromo_BAZ2A_B_like, Bromodomain, BAZ2A/BAZ2B_like subfamily Back     alignment and domain information
>gnl|CDD|99950 cd05519, Bromo_SNF2, Bromodomain, SNF2-like subfamily, specific to fungi Back     alignment and domain information
>gnl|CDD|99937 cd05505, Bromo_WSTF_like, Bromodomain; Williams syndrome transcription factor-like subfamily (WSTF-like) Back     alignment and domain information
>gnl|CDD|227408 COG5076, COG5076, Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>gnl|CDD|227408 COG5076, COG5076, Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>gnl|CDD|99939 cd05507, Bromo_brd8_like, Bromodomain, brd8_like subgroup Back     alignment and domain information
>gnl|CDD|99957 cd05528, Bromo_AAA, Bromodomain; sub-family co-occurring with AAA domains Back     alignment and domain information
>gnl|CDD|99944 cd05512, Bromo_brd1_like, Bromodomain; brd1_like subfamily Back     alignment and domain information
>gnl|CDD|99958 cd05529, Bromo_WDR9_I_like, Bromodomain; WDR9 repeat I_like subfamily Back     alignment and domain information
>gnl|CDD|99958 cd05529, Bromo_WDR9_I_like, Bromodomain; WDR9 repeat I_like subfamily Back     alignment and domain information
>gnl|CDD|99942 cd05510, Bromo_SPT7_like, Bromodomain; SPT7_like subfamily Back     alignment and domain information
>gnl|CDD|99937 cd05505, Bromo_WSTF_like, Bromodomain; Williams syndrome transcription factor-like subfamily (WSTF-like) Back     alignment and domain information
>gnl|CDD|99939 cd05507, Bromo_brd8_like, Bromodomain, brd8_like subgroup Back     alignment and domain information
>gnl|CDD|99945 cd05513, Bromo_brd7_like, Bromodomain, brd7_like subgroup Back     alignment and domain information
>gnl|CDD|99946 cd05515, Bromo_polybromo_V, Bromodomain, polybromo repeat V Back     alignment and domain information
>gnl|CDD|99946 cd05515, Bromo_polybromo_V, Bromodomain, polybromo repeat V Back     alignment and domain information
>gnl|CDD|99945 cd05513, Bromo_brd7_like, Bromodomain, brd7_like subgroup Back     alignment and domain information
>gnl|CDD|99949 cd05518, Bromo_polybromo_IV, Bromodomain, polybromo repeat IV Back     alignment and domain information
>gnl|CDD|99940 cd05508, Bromo_RACK7, Bromodomain, RACK7_like subfamily Back     alignment and domain information
>gnl|CDD|99944 cd05512, Bromo_brd1_like, Bromodomain; brd1_like subfamily Back     alignment and domain information
>gnl|CDD|99933 cd05501, Bromo_SP100C_like, Bromodomain, SP100C_like subfamily Back     alignment and domain information
>gnl|CDD|99928 cd05496, Bromo_WDR9_II, Bromodomain; WDR9 repeat II_like subfamily Back     alignment and domain information
>gnl|CDD|99949 cd05518, Bromo_polybromo_IV, Bromodomain, polybromo repeat IV Back     alignment and domain information
>gnl|CDD|99951 cd05520, Bromo_polybromo_III, Bromodomain, polybromo repeat III Back     alignment and domain information
>gnl|CDD|99950 cd05519, Bromo_SNF2, Bromodomain, SNF2-like subfamily, specific to fungi Back     alignment and domain information
>gnl|CDD|99957 cd05528, Bromo_AAA, Bromodomain; sub-family co-occurring with AAA domains Back     alignment and domain information
>gnl|CDD|99953 cd05522, Bromo_Rsc1_2_II, Bromodomain, repeat II in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>gnl|CDD|99953 cd05522, Bromo_Rsc1_2_II, Bromodomain, repeat II in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>gnl|CDD|99947 cd05516, Bromo_SNF2L2, Bromodomain, SNF2L2-like subfamily, specific to animals Back     alignment and domain information
>gnl|CDD|99952 cd05521, Bromo_Rsc1_2_I, Bromodomain, repeat I in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>gnl|CDD|99951 cd05520, Bromo_polybromo_III, Bromodomain, polybromo repeat III Back     alignment and domain information
>gnl|CDD|99952 cd05521, Bromo_Rsc1_2_I, Bromodomain, repeat I in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>gnl|CDD|99947 cd05516, Bromo_SNF2L2, Bromodomain, SNF2L2-like subfamily, specific to animals Back     alignment and domain information
>gnl|CDD|99954 cd05524, Bromo_polybromo_I, Bromodomain, polybromo repeat I Back     alignment and domain information
>gnl|CDD|99948 cd05517, Bromo_polybromo_II, Bromodomain, polybromo repeat II Back     alignment and domain information
>gnl|CDD|99926 cd05494, Bromodomain_1, Bromodomain; uncharacterized subfamily Back     alignment and domain information
>gnl|CDD|99940 cd05508, Bromo_RACK7, Bromodomain, RACK7_like subfamily Back     alignment and domain information
>gnl|CDD|99926 cd05494, Bromodomain_1, Bromodomain; uncharacterized subfamily Back     alignment and domain information
>gnl|CDD|99955 cd05525, Bromo_ASH1, Bromodomain; ASH1_like sub-family Back     alignment and domain information
>gnl|CDD|99933 cd05501, Bromo_SP100C_like, Bromodomain, SP100C_like subfamily Back     alignment and domain information
>gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional Back     alignment and domain information
>gnl|CDD|99954 cd05524, Bromo_polybromo_I, Bromodomain, polybromo repeat I Back     alignment and domain information
>gnl|CDD|99948 cd05517, Bromo_polybromo_II, Bromodomain, polybromo repeat II Back     alignment and domain information
>gnl|CDD|218440 pfam05110, AF-4, AF-4 proto-oncoprotein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 779
KOG1474|consensus640 100.0
KOG1474|consensus640 99.96
cd05497107 Bromo_Brdt_I_like Bromodomain, Brdt_like subfamily 99.96
cd05497107 Bromo_Brdt_I_like Bromodomain, Brdt_like subfamily 99.93
cd05495108 Bromo_cbp_like Bromodomain, cbp_like subfamily. Cb 99.93
cd05496119 Bromo_WDR9_II Bromodomain; WDR9 repeat II_like sub 99.93
cd05498102 Bromo_Brdt_II_like Bromodomain, Brdt_like subfamil 99.93
cd05499102 Bromo_BDF1_2_II Bromodomain. BDF1/BDF2 like subfam 99.93
cd05495108 Bromo_cbp_like Bromodomain, cbp_like subfamily. Cb 99.93
cd05496119 Bromo_WDR9_II Bromodomain; WDR9 repeat II_like sub 99.92
cd0550597 Bromo_WSTF_like Bromodomain; Williams syndrome tra 99.92
cd0550899 Bromo_RACK7 Bromodomain, RACK7_like subfamily. RAC 99.92
cd05504115 Bromo_Acf1_like Bromodomain; Acf1_like or BAZ1A_li 99.92
cd0550597 Bromo_WSTF_like Bromodomain; Williams syndrome tra 99.92
cd05510112 Bromo_SPT7_like Bromodomain; SPT7_like subfamily. 99.91
cd05507104 Bromo_brd8_like Bromodomain, brd8_like subgroup. I 99.91
cd0550397 Bromo_BAZ2A_B_like Bromodomain, BAZ2A/BAZ2B_like s 99.91
cd05501102 Bromo_SP100C_like Bromodomain, SP100C_like subfami 99.91
cd0550699 Bromo_plant1 Bromodomain, uncharacterized subfamil 99.91
cd05500103 Bromo_BDF1_2_I Bromodomain. BDF1/BDF2 like subfami 99.91
cd05502109 Bromo_tif1_like Bromodomain; tif1_like subfamily. 99.91
cd05510112 Bromo_SPT7_like Bromodomain; SPT7_like subfamily. 99.91
cd05504115 Bromo_Acf1_like Bromodomain; Acf1_like or BAZ1A_li 99.91
cd05507104 Bromo_brd8_like Bromodomain, brd8_like subgroup. I 99.91
cd05516107 Bromo_SNF2L2 Bromodomain, SNF2L2-like subfamily, s 99.9
cd05500103 Bromo_BDF1_2_I Bromodomain. BDF1/BDF2 like subfami 99.9
cd05502109 Bromo_tif1_like Bromodomain; tif1_like subfamily. 99.9
cd0550397 Bromo_BAZ2A_B_like Bromodomain, BAZ2A/BAZ2B_like s 99.9
cd05528112 Bromo_AAA Bromodomain; sub-family co-occurring wit 99.9
cd05509101 Bromo_gcn5_like Bromodomain; Gcn5_like subfamily. 99.9
cd0550699 Bromo_plant1 Bromodomain, uncharacterized subfamil 99.9
cd05511112 Bromo_TFIID Bromodomain, TFIID-like subfamily. Hum 99.9
cd05499102 Bromo_BDF1_2_II Bromodomain. BDF1/BDF2 like subfam 99.9
cd05498102 Bromo_Brdt_II_like Bromodomain, Brdt_like subfamil 99.9
cd05516107 Bromo_SNF2L2 Bromodomain, SNF2L2-like subfamily, s 99.9
cd05509101 Bromo_gcn5_like Bromodomain; Gcn5_like subfamily. 99.9
cd0551398 Bromo_brd7_like Bromodomain, brd7_like subgroup. T 99.89
cd0550899 Bromo_RACK7 Bromodomain, RACK7_like subfamily. RAC 99.89
cd05501102 Bromo_SP100C_like Bromodomain, SP100C_like subfami 99.89
cd0551298 Bromo_brd1_like Bromodomain; brd1_like subfamily. 99.89
cd05519103 Bromo_SNF2 Bromodomain, SNF2-like subfamily, speci 99.89
cd05528112 Bromo_AAA Bromodomain; sub-family co-occurring wit 99.88
cd05524113 Bromo_polybromo_I Bromodomain, polybromo repeat I. 99.88
cd0551398 Bromo_brd7_like Bromodomain, brd7_like subgroup. T 99.88
cd05520103 Bromo_polybromo_III Bromodomain, polybromo repeat 99.88
cd05515105 Bromo_polybromo_V Bromodomain, polybromo repeat V. 99.88
cd05518103 Bromo_polybromo_IV Bromodomain, polybromo repeat I 99.87
cd05515105 Bromo_polybromo_V Bromodomain, polybromo repeat V. 99.87
cd05517103 Bromo_polybromo_II Bromodomain, polybromo repeat I 99.87
cd0551298 Bromo_brd1_like Bromodomain; brd1_like subfamily. 99.87
cd05529128 Bromo_WDR9_I_like Bromodomain; WDR9 repeat I_like 99.87
cd05511112 Bromo_TFIID Bromodomain, TFIID-like subfamily. Hum 99.87
COG5076371 Transcription factor involved in chromatin remodel 99.87
cd05519103 Bromo_SNF2 Bromodomain, SNF2-like subfamily, speci 99.87
cd05525106 Bromo_ASH1 Bromodomain; ASH1_like sub-family. ASH1 99.87
cd05525106 Bromo_ASH1 Bromodomain; ASH1_like sub-family. ASH1 99.87
cd05517103 Bromo_polybromo_II Bromodomain, polybromo repeat I 99.87
cd05529128 Bromo_WDR9_I_like Bromodomain; WDR9 repeat I_like 99.86
cd05520103 Bromo_polybromo_III Bromodomain, polybromo repeat 99.86
KOG1472|consensus720 99.86
smart00297107 BROMO bromo domain. 99.86
cd05524113 Bromo_polybromo_I Bromodomain, polybromo repeat I. 99.86
cd05518103 Bromo_polybromo_IV Bromodomain, polybromo repeat I 99.85
cd05522104 Bromo_Rsc1_2_II Bromodomain, repeat II in Rsc1/2_l 99.85
smart00297107 BROMO bromo domain. 99.84
cd05521106 Bromo_Rsc1_2_I Bromodomain, repeat I in Rsc1/2_lik 99.83
cd05492109 Bromo_ZMYND11 Bromodomain; ZMYND11_like sub-family 99.83
cd05522104 Bromo_Rsc1_2_II Bromodomain, repeat II in Rsc1/2_l 99.82
cd05521106 Bromo_Rsc1_2_I Bromodomain, repeat I in Rsc1/2_lik 99.82
cd0436999 Bromodomain Bromodomain. Bromodomains are found in 99.8
PF0043984 Bromodomain: Bromodomain; InterPro: IPR001487 Brom 99.8
cd0436999 Bromodomain Bromodomain. Bromodomains are found in 99.8
PF0043984 Bromodomain: Bromodomain; InterPro: IPR001487 Brom 99.79
KOG0008|consensus1563 99.79
cd05492109 Bromo_ZMYND11 Bromodomain; ZMYND11_like sub-family 99.78
cd05526110 Bromo_polybromo_VI Bromodomain, polybromo repeat V 99.74
cd05526110 Bromo_polybromo_VI Bromodomain, polybromo repeat V 99.73
COG5076371 Transcription factor involved in chromatin remodel 99.69
KOG1245|consensus1404 99.64
KOG1245|consensus1404 99.61
KOG1828|consensus418 99.45
KOG1472|consensus720 99.44
cd05494114 Bromodomain_1 Bromodomain; uncharacterized subfami 99.32
KOG0008|consensus1563 99.26
cd05494114 Bromodomain_1 Bromodomain; uncharacterized subfami 99.2
KOG1827|consensus629 99.18
KOG1827|consensus 629 99.04
cd05491119 Bromo_TBP7_like Bromodomain; TBP7_like subfamily, 98.96
cd05491119 Bromo_TBP7_like Bromodomain; TBP7_like subfamily, 98.91
KOG0955|consensus1051 98.9
KOG0955|consensus1051 98.86
KOG0386|consensus1157 98.75
KOG0386|consensus1157 98.74
KOG1828|consensus418 97.83
cd05493131 Bromo_ALL-1 Bromodomain, ALL-1 like proteins. ALL- 95.43
cd05493131 Bromo_ALL-1 Bromodomain, ALL-1 like proteins. ALL- 95.43
KOG0644|consensus1113 92.74
KOG0644|consensus1113 91.53
KOG3116|consensus177 87.71
PHA03308 1463 transcriptional regulator ICP4; Provisional 83.21
KOG0732|consensus 1080 83.01
>KOG1474|consensus Back     alignment and domain information
Probab=100.00  E-value=2.2e-55  Score=514.13  Aligned_cols=528  Identities=36%  Similarity=0.499  Sum_probs=344.3

Q ss_pred             HHHHcCCCCCCCCCCCCccccCCCCchhhcCCCCCHHHHHHHhhcCCCCCHHHHHHHHHHHhhhhhhhCCCCCHHHHHHH
Q psy14234        134 KAVWKHPHAWPFHEPVDAINLNLPDYHKVITQPMDLGTIKKRLENNYYWSGKEAIQDFTTMFTNCYVYNKPGEDVVLMAQ  213 (779)
Q Consensus       134 ~~L~~~~~s~pF~~PVd~~~~~~PdYy~iIk~PmDL~tIk~kL~~~~Y~s~~ef~~D~~lmf~Na~~yN~~~s~i~~~A~  213 (779)
                      +.+++|.++|+|..||+.+.+.+|+||.+|.+|||++||+++|.+++|++..++++||..+|.||+.||..+.+|+.+++
T Consensus         2 ~~~~~~~~~~~f~~~v~~v~l~~~~~~~~~~~~~d~~~~~~~~e~n~~~~~~~~~~~f~~~~sn~~~~~~~~~~v~~~~~   81 (640)
T KOG1474|consen    2 KEARKHKLAWPFLEPVDAVALNLPAYYEIIKRPMDIGTIEKRVENNYYFSASECIADFKTKFSNCYLFNDSGDDVVRMKQ   81 (640)
T ss_pred             cccccccccccccCccchhhccchhhhcccCCCCCchhhhhhhccCccccHhhhhhhccccccchhcccCCccchhhccc
Confidence            35688999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHhCCCCcccccCCCCCCCCCCCCCCCCCCCCCCCccCCCCCCCCCC-C-CCCCCCCCCCCCCCCCCCCCCC
Q psy14234        214 NLEQLFLTKITGMPSEEVVLDAPQPRSSKKKPPVSASPSLNPVIKTPVIPLNKLP-S-ATSTPKPRPPNPVLGSTATTTT  291 (779)
Q Consensus       214 ~Le~~f~~~~~~~~~~e~~~~~~~~k~~~~k~~~~~~~~~~~~~~~~~~~~~~~~-~-~~~~p~~~~~~~~~~~~~~~~~  291 (779)
                      .++.+|.+++..++.++.+.....++...........        ..+..+.... . ...++.....  +...+...++
T Consensus        82 ~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~--------~~~~~~~~~~~~~l~~~~~~~~~--~~~~~~~~~~  151 (640)
T KOG1474|consen   82 SLEKLFPKKLRSMPSDEEDKSSVGPKASKIPLDKDSS--------SQVRKLSERLKQELQQVRPLTKA--VEFSPEPSVV  151 (640)
T ss_pred             cchhhcccccccccccccCCcccccccccCcCCCCch--------hhhhhhhhccccccccCCccccc--cccccccccc
Confidence            9999999999999998877655544443222111100        0000000000 0 0000000000  0000000000


Q ss_pred             CccccccCCCCCCCChhHHHhhhhccCCCCCCCCCCCC--CCCcchhh-----h-cccccccCCCCCCCCCCCcCCCCCC
Q psy14234        292 APKVNHLNSMNAPDTPDMKKAIKRKADGSIDHTPSSLH--PTPVKSAK-----Q-LNTRRESGSITKKPQRISEEGGGGS  363 (779)
Q Consensus       292 ~~~s~~~~~~~~p~~~~~kk~~krkadtt~d~tPt~~~--~~~~~~~~-----~-~~~rres~R~~k~p~~~l~~~~~~~  363 (779)
                      ..      ......+.....++++.+|+.   ++....  ......+.     . ...+++++      ...  .. ...
T Consensus       152 ~~------~~~~~~~~~~~~~~~~~~d~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~------~~~--~~-~~~  213 (640)
T KOG1474|consen  152 SP------VSPASQPFKSKNGVKKVADTC---VKSYKSKSEREPSPGQKREGTVAPNSSRESG------DSA--AE-EEA  213 (640)
T ss_pred             CC------CCCcccccccccchhhhhccc---cccccccCcCCCCccccccccccCccccccc------ccc--cc-ccc
Confidence            00      000011222233444555544   222000  00000000     0 00000100      000  00 011


Q ss_pred             CCCCCCcHHHHHHHHHHHHHHHhccCCCCccCccccCCccccCCCchhhhhcCCCCHHHHHHHHhcCCCCCHHHHHHHHH
Q psy14234        364 GLGGSKTPLWYKYCSEIIAELFHKKHQNYAWPFYTPVDVEKLGLTDYFDIIKKPMDLGTVRKKMRNRTYKTAKEFADDVR  443 (779)
Q Consensus       364 ~~~~~~~~~~~k~c~~iL~~l~~~k~~~~a~pF~~PVd~~~~~~pdY~~iIk~PMDL~tIk~KL~~~~Y~s~~eF~~Dv~  443 (779)
                      ....+.+..++++|..||+.|+.++|   +|||+.|||++.|||||||+||+|||||+||++||.+|.|.++.+|++|||
T Consensus       214 ~~~~~~~~~~lk~C~~iLk~l~~~k~---awpF~~PVD~v~LgLpDY~~IIK~PMDLgTIK~kL~~~~Y~~~~eF~~DVR  290 (640)
T KOG1474|consen  214 KPKSKLTVELLKQCLSILKRLMKHKH---AWPFNEPVDVVKLGLPDYHDIIKHPMDLGTIKKKLEKGEYKSAEEFAADVR  290 (640)
T ss_pred             cccccccHHHHHHHHHHHHHHHhccC---CCCcCCCcCHHhcCCcchhhhcCCCccHHHHHhhhcccccCCHHHHHHHHH
Confidence            11227788999999999999999987   699999999999999999999999999999999999999999999999999


Q ss_pred             HhhhhhcccCCCCChHHHHHHHHHHHHHHHHhcCCCchhhhhhhc-----------------------c--------CCC
Q psy14234        444 LIFSNCYKYNPPDHNVVTMARQLSAVFEDRFAKMPDESNLASRAA-----------------------A--------SVS  492 (779)
Q Consensus       444 Lmf~Na~~yN~~~s~v~~~A~~Lq~~Fe~~~~~i~~~~~~~~~~~-----------------------s--------~~~  492 (779)
                      |||.|||+||++|++||.||..|+.+|+.+|+.++.+........                       +        +..
T Consensus       291 L~F~Ncm~YNp~g~dV~~Ma~~L~~~Fe~rw~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  370 (640)
T KOG1474|consen  291 LTFDNCMTYNPEGSDVYAMAKKLQEVFEERWASMPLEIEESESAVKEEAGMASSDQIPSNSVEGPRSSSFESRESASEPS  370 (640)
T ss_pred             HHHHHHHhcCCCCCHHHHHHHHHHHHHHHHHhhccccccccccccccccccccccccccccccCcccccchhcccccCcc
Confidence            999999999999999999999999999999999876554322110                       0        001


Q ss_pred             CCCCchHHHHHHHHHHHHHHHHHHHHHHHhhhccCCchhhcccCCCCCCCCCCCCc---cccchhccccccCCCCCCCCC
Q psy14234        493 SDDDSEDERQNQLKYLQEQLKSLTDQIRLLVEDSTKPKKKKKKNRDQPKSKMPMGQ---NSAMMNDHVNKMNKAPAPLNN  569 (779)
Q Consensus       493 ~~~d~eee~~~~l~~lq~ql~~~~~~l~~l~~~~~~k~kkk~~~~~~~k~~~~~~~---~~~~~~~~~~~~~~~~~~~~~  569 (779)
                      .....++++...++.|+..+..++.+|..+.+.+..++....+.+...........   ..+......            
T Consensus       371 ~~~~~~~e~~~~~~~l~~~~~~~~~~l~~~~~~~~~~~~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~------------  438 (640)
T KOG1474|consen  371 SELMSEEERKKLLAELKLLLKDVPPQLIALLQRPVSKPPRKIEEELESDKRPLVTGKLIKEKNKKEKA------------  438 (640)
T ss_pred             cccccHHhhhhhHhhhhcchhhhhHHHHhhhhccccCccccccccccccccccchhhhhhhhhccccc------------
Confidence            22345666788889999999999999999988887776555433222111110000   000000000            


Q ss_pred             CCCCCCcCCCCCC-CCCCccccC--CCCCCCCcchhhccccccCCCcccccCCCCCHHHHHHHHHHccCCCCcchHHHHH
Q psy14234        570 GQKPKSLNNVRKP-QASNPQQAK--KPKPNNANTVAAKKQVRTFDSEDEDVAKPMSYDEKRQLSLDINKLPGDKLGKVVH  646 (779)
Q Consensus       570 ~~~~k~~~~~~~~-~~~~~~~~~--~~k~~~~~~~~~~~~~~~~~s~~e~~~~pmt~dEK~qLs~~In~LpgekL~~Vv~  646 (779)
                       ....+....... ........+  .|.+..              +.. ...+|    +++++.+.+|.+..+...++|+
T Consensus       439 -~~~~~r~~t~~~~~~l~~~~~~~~~p~~l~--------------~~~-~~~~~----~~~~~~l~~~~~~~~~~~~~vd  498 (640)
T KOG1474|consen  439 -ANENKRDMTAPEKAKLKELLQNLLPPNKLE--------------SIV-EILKP----EKRQLDLSQNDDEIELDLDSVD  498 (640)
T ss_pred             -cccccccccccccccchhhccCCCCCcccc--------------Ccc-cccch----hhhcccccccccchhhcccccc
Confidence             000000000000 000000000  000000              000 01133    8899999999999999999999


Q ss_pred             HHhhcCCCCCCCCCCcEEEeCCCCChHHHHHHHHHHHHHHhhhcCCC--------CCCChhHHHHHHHHHHHHHHhhhhc
Q psy14234        647 IIQSREPSLREPNPDEIEIDFETLKPSTLRELEQYVSSCLRKRTYKK--------TPKPKDEKFAEKKHELEKRLQDVTS  718 (779)
Q Consensus       647 IIq~~ep~l~~~n~dEIEiD~etL~~~TLreLe~yV~~cL~kk~~k~--------~~ks~~~~~~~k~~ele~~l~~~~g  718 (779)
                      |++.++|+   .+++++|++++++...|.+++..++..|++...+..        .....++...++..++..+......
T Consensus       499 ~~~~~~~~---~~~~~~e~~~~~~~~~~~~~~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s  575 (640)
T KOG1474|consen  499 GSQSREPS---SNPLEIETIRETLKLSTERELELSKASSSRSLMRNRSGSLPERLSRSISEEKLREKSEKSSSEASSSSS  575 (640)
T ss_pred             cccccCCC---cccchhhhhhccccchhhHHHHHHHHhhhhhhccCcccccccchhhhhhHHhhhhhhHhhhhhhhhhhH
Confidence            99999998   678999999999999999999999999999887752        2233355567777777778888888


Q ss_pred             CCCcccccC
Q psy14234        719 QIDSTNKKL  727 (779)
Q Consensus       719 ~~~~~~~~~  727 (779)
                      +++...+..
T Consensus       576 ~~~~~~~~~  584 (640)
T KOG1474|consen  576 EDGENKAAS  584 (640)
T ss_pred             HHHhhcccc
Confidence            777655544



>KOG1474|consensus Back     alignment and domain information
>cd05497 Bromo_Brdt_I_like Bromodomain, Brdt_like subfamily, repeat I Back     alignment and domain information
>cd05497 Bromo_Brdt_I_like Bromodomain, Brdt_like subfamily, repeat I Back     alignment and domain information
>cd05495 Bromo_cbp_like Bromodomain, cbp_like subfamily Back     alignment and domain information
>cd05496 Bromo_WDR9_II Bromodomain; WDR9 repeat II_like subfamily Back     alignment and domain information
>cd05498 Bromo_Brdt_II_like Bromodomain, Brdt_like subfamily, repeat II Back     alignment and domain information
>cd05499 Bromo_BDF1_2_II Bromodomain Back     alignment and domain information
>cd05495 Bromo_cbp_like Bromodomain, cbp_like subfamily Back     alignment and domain information
>cd05496 Bromo_WDR9_II Bromodomain; WDR9 repeat II_like subfamily Back     alignment and domain information
>cd05505 Bromo_WSTF_like Bromodomain; Williams syndrome transcription factor-like subfamily (WSTF-like) Back     alignment and domain information
>cd05508 Bromo_RACK7 Bromodomain, RACK7_like subfamily Back     alignment and domain information
>cd05504 Bromo_Acf1_like Bromodomain; Acf1_like or BAZ1A_like subfamily Back     alignment and domain information
>cd05505 Bromo_WSTF_like Bromodomain; Williams syndrome transcription factor-like subfamily (WSTF-like) Back     alignment and domain information
>cd05510 Bromo_SPT7_like Bromodomain; SPT7_like subfamily Back     alignment and domain information
>cd05507 Bromo_brd8_like Bromodomain, brd8_like subgroup Back     alignment and domain information
>cd05503 Bromo_BAZ2A_B_like Bromodomain, BAZ2A/BAZ2B_like subfamily Back     alignment and domain information
>cd05501 Bromo_SP100C_like Bromodomain, SP100C_like subfamily Back     alignment and domain information
>cd05506 Bromo_plant1 Bromodomain, uncharacterized subfamily specific to plants Back     alignment and domain information
>cd05500 Bromo_BDF1_2_I Bromodomain Back     alignment and domain information
>cd05502 Bromo_tif1_like Bromodomain; tif1_like subfamily Back     alignment and domain information
>cd05510 Bromo_SPT7_like Bromodomain; SPT7_like subfamily Back     alignment and domain information
>cd05504 Bromo_Acf1_like Bromodomain; Acf1_like or BAZ1A_like subfamily Back     alignment and domain information
>cd05507 Bromo_brd8_like Bromodomain, brd8_like subgroup Back     alignment and domain information
>cd05516 Bromo_SNF2L2 Bromodomain, SNF2L2-like subfamily, specific to animals Back     alignment and domain information
>cd05500 Bromo_BDF1_2_I Bromodomain Back     alignment and domain information
>cd05502 Bromo_tif1_like Bromodomain; tif1_like subfamily Back     alignment and domain information
>cd05503 Bromo_BAZ2A_B_like Bromodomain, BAZ2A/BAZ2B_like subfamily Back     alignment and domain information
>cd05528 Bromo_AAA Bromodomain; sub-family co-occurring with AAA domains Back     alignment and domain information
>cd05509 Bromo_gcn5_like Bromodomain; Gcn5_like subfamily Back     alignment and domain information
>cd05506 Bromo_plant1 Bromodomain, uncharacterized subfamily specific to plants Back     alignment and domain information
>cd05511 Bromo_TFIID Bromodomain, TFIID-like subfamily Back     alignment and domain information
>cd05499 Bromo_BDF1_2_II Bromodomain Back     alignment and domain information
>cd05498 Bromo_Brdt_II_like Bromodomain, Brdt_like subfamily, repeat II Back     alignment and domain information
>cd05516 Bromo_SNF2L2 Bromodomain, SNF2L2-like subfamily, specific to animals Back     alignment and domain information
>cd05509 Bromo_gcn5_like Bromodomain; Gcn5_like subfamily Back     alignment and domain information
>cd05513 Bromo_brd7_like Bromodomain, brd7_like subgroup Back     alignment and domain information
>cd05508 Bromo_RACK7 Bromodomain, RACK7_like subfamily Back     alignment and domain information
>cd05501 Bromo_SP100C_like Bromodomain, SP100C_like subfamily Back     alignment and domain information
>cd05512 Bromo_brd1_like Bromodomain; brd1_like subfamily Back     alignment and domain information
>cd05519 Bromo_SNF2 Bromodomain, SNF2-like subfamily, specific to fungi Back     alignment and domain information
>cd05528 Bromo_AAA Bromodomain; sub-family co-occurring with AAA domains Back     alignment and domain information
>cd05524 Bromo_polybromo_I Bromodomain, polybromo repeat I Back     alignment and domain information
>cd05513 Bromo_brd7_like Bromodomain, brd7_like subgroup Back     alignment and domain information
>cd05520 Bromo_polybromo_III Bromodomain, polybromo repeat III Back     alignment and domain information
>cd05515 Bromo_polybromo_V Bromodomain, polybromo repeat V Back     alignment and domain information
>cd05518 Bromo_polybromo_IV Bromodomain, polybromo repeat IV Back     alignment and domain information
>cd05515 Bromo_polybromo_V Bromodomain, polybromo repeat V Back     alignment and domain information
>cd05517 Bromo_polybromo_II Bromodomain, polybromo repeat II Back     alignment and domain information
>cd05512 Bromo_brd1_like Bromodomain; brd1_like subfamily Back     alignment and domain information
>cd05529 Bromo_WDR9_I_like Bromodomain; WDR9 repeat I_like subfamily Back     alignment and domain information
>cd05511 Bromo_TFIID Bromodomain, TFIID-like subfamily Back     alignment and domain information
>COG5076 Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>cd05519 Bromo_SNF2 Bromodomain, SNF2-like subfamily, specific to fungi Back     alignment and domain information
>cd05525 Bromo_ASH1 Bromodomain; ASH1_like sub-family Back     alignment and domain information
>cd05525 Bromo_ASH1 Bromodomain; ASH1_like sub-family Back     alignment and domain information
>cd05517 Bromo_polybromo_II Bromodomain, polybromo repeat II Back     alignment and domain information
>cd05529 Bromo_WDR9_I_like Bromodomain; WDR9 repeat I_like subfamily Back     alignment and domain information
>cd05520 Bromo_polybromo_III Bromodomain, polybromo repeat III Back     alignment and domain information
>KOG1472|consensus Back     alignment and domain information
>smart00297 BROMO bromo domain Back     alignment and domain information
>cd05524 Bromo_polybromo_I Bromodomain, polybromo repeat I Back     alignment and domain information
>cd05518 Bromo_polybromo_IV Bromodomain, polybromo repeat IV Back     alignment and domain information
>cd05522 Bromo_Rsc1_2_II Bromodomain, repeat II in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>smart00297 BROMO bromo domain Back     alignment and domain information
>cd05521 Bromo_Rsc1_2_I Bromodomain, repeat I in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>cd05492 Bromo_ZMYND11 Bromodomain; ZMYND11_like sub-family Back     alignment and domain information
>cd05522 Bromo_Rsc1_2_II Bromodomain, repeat II in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>cd05521 Bromo_Rsc1_2_I Bromodomain, repeat I in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>cd04369 Bromodomain Bromodomain Back     alignment and domain information
>PF00439 Bromodomain: Bromodomain; InterPro: IPR001487 Bromodomains are found in a variety of mammalian, invertebrate and yeast DNA-binding proteins [] Back     alignment and domain information
>cd04369 Bromodomain Bromodomain Back     alignment and domain information
>PF00439 Bromodomain: Bromodomain; InterPro: IPR001487 Bromodomains are found in a variety of mammalian, invertebrate and yeast DNA-binding proteins [] Back     alignment and domain information
>KOG0008|consensus Back     alignment and domain information
>cd05492 Bromo_ZMYND11 Bromodomain; ZMYND11_like sub-family Back     alignment and domain information
>cd05526 Bromo_polybromo_VI Bromodomain, polybromo repeat VI Back     alignment and domain information
>cd05526 Bromo_polybromo_VI Bromodomain, polybromo repeat VI Back     alignment and domain information
>COG5076 Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>KOG1245|consensus Back     alignment and domain information
>KOG1245|consensus Back     alignment and domain information
>KOG1828|consensus Back     alignment and domain information
>KOG1472|consensus Back     alignment and domain information
>cd05494 Bromodomain_1 Bromodomain; uncharacterized subfamily Back     alignment and domain information
>KOG0008|consensus Back     alignment and domain information
>cd05494 Bromodomain_1 Bromodomain; uncharacterized subfamily Back     alignment and domain information
>KOG1827|consensus Back     alignment and domain information
>KOG1827|consensus Back     alignment and domain information
>cd05491 Bromo_TBP7_like Bromodomain; TBP7_like subfamily, limited to fungi Back     alignment and domain information
>cd05491 Bromo_TBP7_like Bromodomain; TBP7_like subfamily, limited to fungi Back     alignment and domain information
>KOG0955|consensus Back     alignment and domain information
>KOG0955|consensus Back     alignment and domain information
>KOG0386|consensus Back     alignment and domain information
>KOG0386|consensus Back     alignment and domain information
>KOG1828|consensus Back     alignment and domain information
>cd05493 Bromo_ALL-1 Bromodomain, ALL-1 like proteins Back     alignment and domain information
>cd05493 Bromo_ALL-1 Bromodomain, ALL-1 like proteins Back     alignment and domain information
>KOG0644|consensus Back     alignment and domain information
>KOG0644|consensus Back     alignment and domain information
>KOG3116|consensus Back     alignment and domain information
>PHA03308 transcriptional regulator ICP4; Provisional Back     alignment and domain information
>KOG0732|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query779
4a9e_A154 N-Terminal Bromodomain Of Human Brd2 With 3-Methyl- 1e-47
4a9e_A154 N-Terminal Bromodomain Of Human Brd2 With 3-Methyl- 3e-21
2ydw_A153 Crystal Structure Of The First Bromodomain Of Human 1e-47
2ydw_A153 Crystal Structure Of The First Bromodomain Of Human 3e-21
2yw5_A138 Solution Structure Of The Bromodomain From Human Br 2e-47
2yw5_A138 Solution Structure Of The Bromodomain From Human Br 9e-22
2l5e_A128 Complex Between Bd1 Of Brd3 And Gata-1 C-Tail Lengt 2e-47
2l5e_A128 Complex Between Bd1 Of Brd3 And Gata-1 C-Tail Lengt 8e-22
2nxb_A123 Crystal Structure Of Human Bromodomain Containing P 7e-47
2nxb_A123 Crystal Structure Of Human Bromodomain Containing P 1e-21
2oss_A127 Crystal Structure Of The Bromo Domain 1 In Human Br 1e-46
2oss_A127 Crystal Structure Of The Bromo Domain 1 In Human Br 1e-19
3jvj_A131 Crystal Structure Of The Bromodomain 1 In Mouse Brd 1e-46
3jvj_A131 Crystal Structure Of The Bromodomain 1 In Mouse Brd 8e-20
4hbw_A127 Crystal Structure Of The First Bromodomain Of Human 1e-46
4hbw_A127 Crystal Structure Of The First Bromodomain Of Human 1e-19
4don_A145 Brd4 Bromodomain 1 Complex With A Fragment 3,4-dihy 2e-45
4don_A145 Brd4 Bromodomain 1 Complex With A Fragment 3,4-dihy 3e-19
3aqa_A128 Crystal Structure Of The Human Brd2 Bd1 Bromodomain 4e-42
3aqa_A128 Crystal Structure Of The Human Brd2 Bd1 Bromodomain 4e-18
1x0j_A122 Crystal Structure Analysis Of The N-Terminal Bromod 6e-42
1x0j_A122 Crystal Structure Analysis Of The N-Terminal Bromod 8e-18
2rfj_A119 Crystal Structure Of The Bromo Domain 1 In Human Br 1e-40
2rfj_A119 Crystal Structure Of The Bromo Domain 1 In Human Br 6e-20
2ouo_A130 Crystal Structure Of The Bromo Domain 2 In Human Br 6e-40
2lsp_B128 Solution Structures Of Brd4 Second Bromodomain With 8e-40
2wp2_A120 Structure Of Brdt Bromodomain Bd1 Bound To A Diacet 9e-40
2wp2_A120 Structure Of Brdt Bromodomain Bd1 Bound To A Diacet 3e-19
3oni_A114 Crystal Structure Of The Second Bromodomain Of Huma 2e-39
2dvv_A112 Crystal Structure Of The Second Bromodomain Of The 3e-39
2g4a_A116 Solution Structure Of A Bromodomain From Ring3 Prot 4e-39
3jvl_A120 Crystal Structure Of Bromodomain 2 Of Mouse Brd4 Le 4e-38
2wp1_A126 Structure Of Brdt Bromodomain 2 Bound To An Acetyla 6e-38
2i8n_A114 Solution Structure Of The Second Bromodomain Of Brd 8e-37
2oo1_A113 Crystal Structure Of The Bromo Domain 2 Of Human Br 5e-35
2e7n_A117 Solution Structure Of The Second Bromodomain From H 2e-34
2dww_A114 Crystal Structure Of Bromodomain-Containing Protein 7e-34
2jns_A90 Solution Structure Of The Bromodomain-Containing Pr 4e-30
3gg3_A119 Crystal Structure Of The Bromodomain Of Human Pcaf 7e-16
3gg3_A119 Crystal Structure Of The Bromodomain Of Human Pcaf 5e-11
1n72_A118 Structure And Ligand Of A Histone Acetyltransferase 9e-16
1n72_A118 Structure And Ligand Of A Histone Acetyltransferase 5e-11
3uv2_A126 Crystal Structure Of The Bromodomain Of Human Nucle 1e-14
3uv2_A126 Crystal Structure Of The Bromodomain Of Human Nucle 2e-10
3qzs_A115 Crystal Structure Of Bptf Bromo In Complex With His 1e-14
3qzs_A115 Crystal Structure Of Bptf Bromo In Complex With His 1e-10
3qzt_A115 Crystal Structure Of Bptf Bromo In Complex With His 2e-14
3qzt_A115 Crystal Structure Of Bptf Bromo In Complex With His 2e-10
3qzv_A174 Crystal Structure Of Bptf Phd-Linker-Bromo In Compl 3e-14
3qzv_A174 Crystal Structure Of Bptf Phd-Linker-Bromo In Compl 9e-11
2ri7_A174 Crystal Structure Of Phd Finger-Linker-Bromodomain 3e-14
2ri7_A174 Crystal Structure Of Phd Finger-Linker-Bromodomain 1e-10
3d7c_A112 Crystal Structure Of The Bromodomain Of Human Gcn5, 7e-14
3d7c_A112 Crystal Structure Of The Bromodomain Of Human Gcn5, 7e-11
1f68_A103 Nmr Solution Structure Of The Bromodomain From Huma 1e-13
1f68_A103 Nmr Solution Structure Of The Bromodomain From Huma 8e-11
3i3j_A124 Crystal Structure Of The Bromodomain Of Human Ep300 2e-13
1jsp_B121 Nmr Structure Of Cbp Bromodomain In Complex With P5 4e-13
3dwy_A119 Crystal Structure Of The Bromodomain Of Human Crebb 4e-13
2f6j_A174 Crystal Structure Of Phd Finger-Linker-Bromodomain 6e-13
2f6j_A174 Crystal Structure Of Phd Finger-Linker-Bromodomain 2e-09
1e6i_A121 Bromodomain From Gcn5 Complexed With Acetylated H4 9e-13
3q2e_A123 Crystal Structure Of The Second Bromodomain Of Huma 1e-12
3nxb_A116 Crystal Structure Of The Bromodomain Of Human Cecr2 2e-12
3nxb_A116 Crystal Structure Of The Bromodomain Of Human Cecr2 4e-09
3g0l_A117 Crystal Structure Of Human Bromodomain Adjacent To 3e-11
3mb3_A135 Crystal Structure Of The Second Bromodomain Of Plec 3e-11
2e7o_A112 Solution Structure Of The Bromodomain From Human Br 4e-11
2yyn_A135 Crystal Sturcture Of Human Bromodomain Protein Leng 2e-10
2yyn_A135 Crystal Sturcture Of Human Bromodomain Protein Leng 3e-09
3o33_A184 Crystal Structure Of Trim24 Phd-Bromo In The Free S 6e-10
3o33_A184 Crystal Structure Of Trim24 Phd-Bromo In The Free S 6e-09
3aad_A292 Structure Of The Histone Chaperone Cia/asf1-double 7e-10
1eqf_A280 Crystal Structure Of The Double Bromodomain Module 9e-10
3uv5_A265 Crystal Structure Of The Tandem Bromodomains Of Hum 1e-09
3uv4_A158 Crystal Structure Of The Second Bromodomain Of Huma 1e-09
3hmh_A155 Crystal Structure Of The Second Bromodomain Of Huma 1e-08
3lxj_A136 Crystal Structure Of The Bromodomain Of Human Aaa D 2e-08
3rcw_A135 Crystal Structure Of The Bromodomain Of Human Brd1 2e-07
3fkm_X166 Plasmodium Falciparum Bromodomain-Containing Protei 2e-07
3u5m_A207 Crystal Structure Of Trim33 Phd-Bromo In The Free S 2e-07
2ktb_B121 Solution Structure Of The Second Bromodomain Of Hum 1e-06
2dkw_A131 Solution Structure Of The Bromodomain Of Human Prot 1e-06
3ljw_A120 Crystal Structure Of The Second Bromodomain Of Huma 1e-06
3hmf_A116 Crystal Structure Of The Second Bromodomain Of Huma 2e-06
3tlp_A150 Crystal Structure Of The Fourth Bromodomain Of Huma 2e-06
3tlp_A150 Crystal Structure Of The Fourth Bromodomain Of Huma 7e-04
2d9e_A121 Solution Structure Of The Bromodomain Of Peregrin L 1e-05
2i7k_A117 Solution Structure Of The Bromodomain Of Human Brd7 2e-05
2i7k_A117 Solution Structure Of The Bromodomain Of Human Brd7 3e-04
3dai_A130 Crystal Structure Of The Bromodomain Of The Human A 3e-05
3hme_A123 Crystal Structure Of Human Bromodomain Containing 9 6e-05
3hme_A123 Crystal Structure Of Human Bromodomain Containing 9 1e-04
3g0j_A124 Crystal Structure Of The Fifth Bromodomain Of Human 2e-04
3k2j_A130 Crystal Structure Of The 3rd Bromodomain Of Human P 2e-04
2yqd_A120 Solution Structure Of The Fifth Bromodomain From Mo 2e-04
>pdb|4A9E|A Chain A, N-Terminal Bromodomain Of Human Brd2 With 3-Methyl-1,2,3,4- Tetrahydroquinazolin-2-One Length = 154 Back     alignment and structure

Iteration: 1

Score = 188 bits (477), Expect = 1e-47, Method: Compositional matrix adjust. Identities = 79/114 (69%), Positives = 95/114 (83%) Query: 117 RPGRNTNQLQYIVKNVMKAVWKHPHAWPFHEPVDAINLNLPDYHKVITQPMDLGTIKKRL 176 +PGR TNQLQY+ K VMKA+WKH AWPF +PVDA+ L LPDYHK+I QPMD+GTIK+RL Sbjct: 25 KPGRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKRRL 84 Query: 177 ENNYYWSGKEAIQDFTTMFTNCYVYNKPGEDVVLMAQNLEQLFLTKITGMPSEE 230 ENNYYW+ E +QDF TMFTNCY+YNKP +D+VLMAQ LE++FL K+ MP EE Sbjct: 85 ENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKIFLQKVASMPQEE 138
>pdb|4A9E|A Chain A, N-Terminal Bromodomain Of Human Brd2 With 3-Methyl-1,2,3,4- Tetrahydroquinazolin-2-One Length = 154 Back     alignment and structure
>pdb|2YDW|A Chain A, Crystal Structure Of The First Bromodomain Of Human Brd2 With The Inhibitor Gw841819x Length = 153 Back     alignment and structure
>pdb|2YDW|A Chain A, Crystal Structure Of The First Bromodomain Of Human Brd2 With The Inhibitor Gw841819x Length = 153 Back     alignment and structure
>pdb|2YW5|A Chain A, Solution Structure Of The Bromodomain From Human Bromodomain Containing Protein 3 Length = 138 Back     alignment and structure
>pdb|2YW5|A Chain A, Solution Structure Of The Bromodomain From Human Bromodomain Containing Protein 3 Length = 138 Back     alignment and structure
>pdb|2L5E|A Chain A, Complex Between Bd1 Of Brd3 And Gata-1 C-Tail Length = 128 Back     alignment and structure
>pdb|2L5E|A Chain A, Complex Between Bd1 Of Brd3 And Gata-1 C-Tail Length = 128 Back     alignment and structure
>pdb|2NXB|A Chain A, Crystal Structure Of Human Bromodomain Containing Protein 3 (Brd3) Length = 123 Back     alignment and structure
>pdb|2NXB|A Chain A, Crystal Structure Of Human Bromodomain Containing Protein 3 (Brd3) Length = 123 Back     alignment and structure
>pdb|2OSS|A Chain A, Crystal Structure Of The Bromo Domain 1 In Human Bromodomain Containing Protein 4 (Brd4) Length = 127 Back     alignment and structure
>pdb|2OSS|A Chain A, Crystal Structure Of The Bromo Domain 1 In Human Bromodomain Containing Protein 4 (Brd4) Length = 127 Back     alignment and structure
>pdb|3JVJ|A Chain A, Crystal Structure Of The Bromodomain 1 In Mouse Brd4 Length = 131 Back     alignment and structure
>pdb|3JVJ|A Chain A, Crystal Structure Of The Bromodomain 1 In Mouse Brd4 Length = 131 Back     alignment and structure
>pdb|4HBW|A Chain A, Crystal Structure Of The First Bromodomain Of Human Brd4 In Complex With A Quinazoline Ligand Length = 127 Back     alignment and structure
>pdb|4HBW|A Chain A, Crystal Structure Of The First Bromodomain Of Human Brd4 In Complex With A Quinazoline Ligand Length = 127 Back     alignment and structure
>pdb|4DON|A Chain A, Brd4 Bromodomain 1 Complex With A Fragment 3,4-dihydro-3-methyl-2(1h)- Quinazolinon Length = 145 Back     alignment and structure
>pdb|4DON|A Chain A, Brd4 Bromodomain 1 Complex With A Fragment 3,4-dihydro-3-methyl-2(1h)- Quinazolinon Length = 145 Back     alignment and structure
>pdb|3AQA|A Chain A, Crystal Structure Of The Human Brd2 Bd1 Bromodomain In Complex With A Brd2-Interactive Compound, Bic1 Length = 128 Back     alignment and structure
>pdb|3AQA|A Chain A, Crystal Structure Of The Human Brd2 Bd1 Bromodomain In Complex With A Brd2-Interactive Compound, Bic1 Length = 128 Back     alignment and structure
>pdb|1X0J|A Chain A, Crystal Structure Analysis Of The N-Terminal Bromodomain Of Human Brd2 Length = 122 Back     alignment and structure
>pdb|1X0J|A Chain A, Crystal Structure Analysis Of The N-Terminal Bromodomain Of Human Brd2 Length = 122 Back     alignment and structure
>pdb|2RFJ|A Chain A, Crystal Structure Of The Bromo Domain 1 In Human Bromodomain Containing Protein, Testis Specific (Brdt) Length = 119 Back     alignment and structure
>pdb|2RFJ|A Chain A, Crystal Structure Of The Bromo Domain 1 In Human Bromodomain Containing Protein, Testis Specific (Brdt) Length = 119 Back     alignment and structure
>pdb|2OUO|A Chain A, Crystal Structure Of The Bromo Domain 2 In Human Bromodomain Containing Protein 4 (Brd4) Length = 130 Back     alignment and structure
>pdb|2LSP|B Chain B, Solution Structures Of Brd4 Second Bromodomain With Nf-Kb-K310ac Peptide Length = 128 Back     alignment and structure
>pdb|2WP2|A Chain A, Structure Of Brdt Bromodomain Bd1 Bound To A Diacetylated Histone H4 Peptide. Length = 120 Back     alignment and structure
>pdb|2WP2|A Chain A, Structure Of Brdt Bromodomain Bd1 Bound To A Diacetylated Histone H4 Peptide. Length = 120 Back     alignment and structure
>pdb|3ONI|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Brd2 In Complex With The Inhibitor Jq1 Length = 114 Back     alignment and structure
>pdb|2DVV|A Chain A, Crystal Structure Of The Second Bromodomain Of The Human Brd2 Protein Length = 112 Back     alignment and structure
>pdb|2G4A|A Chain A, Solution Structure Of A Bromodomain From Ring3 Protein Length = 116 Back     alignment and structure
>pdb|3JVL|A Chain A, Crystal Structure Of Bromodomain 2 Of Mouse Brd4 Length = 120 Back     alignment and structure
>pdb|2WP1|A Chain A, Structure Of Brdt Bromodomain 2 Bound To An Acetylated Histone H3 Peptide Length = 126 Back     alignment and structure
>pdb|2I8N|A Chain A, Solution Structure Of The Second Bromodomain Of Brd4 Length = 114 Back     alignment and structure
>pdb|2OO1|A Chain A, Crystal Structure Of The Bromo Domain 2 Of Human Bromodomain Containing Protein 3 (Brd3) Length = 113 Back     alignment and structure
>pdb|2E7N|A Chain A, Solution Structure Of The Second Bromodomain From Human Bromodomain-Containing Protein 3 Length = 117 Back     alignment and structure
>pdb|2DWW|A Chain A, Crystal Structure Of Bromodomain-Containing Protein 4 Length = 114 Back     alignment and structure
>pdb|2JNS|A Chain A, Solution Structure Of The Bromodomain-Containing Protein 4 Et Domain Length = 90 Back     alignment and structure
>pdb|3GG3|A Chain A, Crystal Structure Of The Bromodomain Of Human Pcaf Length = 119 Back     alignment and structure
>pdb|3GG3|A Chain A, Crystal Structure Of The Bromodomain Of Human Pcaf Length = 119 Back     alignment and structure
>pdb|1N72|A Chain A, Structure And Ligand Of A Histone Acetyltransferase Bromodomain Length = 118 Back     alignment and structure
>pdb|1N72|A Chain A, Structure And Ligand Of A Histone Acetyltransferase Bromodomain Length = 118 Back     alignment and structure
>pdb|3UV2|A Chain A, Crystal Structure Of The Bromodomain Of Human Nucleosome-Remodeling Factor Subunit Bptf Length = 126 Back     alignment and structure
>pdb|3UV2|A Chain A, Crystal Structure Of The Bromodomain Of Human Nucleosome-Remodeling Factor Subunit Bptf Length = 126 Back     alignment and structure
>pdb|3QZS|A Chain A, Crystal Structure Of Bptf Bromo In Complex With Histone H4k16ac - Form I Length = 115 Back     alignment and structure
>pdb|3QZS|A Chain A, Crystal Structure Of Bptf Bromo In Complex With Histone H4k16ac - Form I Length = 115 Back     alignment and structure
>pdb|3QZT|A Chain A, Crystal Structure Of Bptf Bromo In Complex With Histone H4k16ac - Form Ii Length = 115 Back     alignment and structure
>pdb|3QZT|A Chain A, Crystal Structure Of Bptf Bromo In Complex With Histone H4k16ac - Form Ii Length = 115 Back     alignment and structure
>pdb|3QZV|A Chain A, Crystal Structure Of Bptf Phd-Linker-Bromo In Complex With Histone H4k12ac Peptide Length = 174 Back     alignment and structure
>pdb|3QZV|A Chain A, Crystal Structure Of Bptf Phd-Linker-Bromo In Complex With Histone H4k12ac Peptide Length = 174 Back     alignment and structure
>pdb|2RI7|A Chain A, Crystal Structure Of Phd Finger-Linker-Bromodomain Y17e Mutant From Human Bptf In The H3(1-9)k4me2 Bound State Length = 174 Back     alignment and structure
>pdb|2RI7|A Chain A, Crystal Structure Of Phd Finger-Linker-Bromodomain Y17e Mutant From Human Bptf In The H3(1-9)k4me2 Bound State Length = 174 Back     alignment and structure
>pdb|3D7C|A Chain A, Crystal Structure Of The Bromodomain Of Human Gcn5, The General Control Of Amino-Acid Synthesis Protein 5-Like 2 Length = 112 Back     alignment and structure
>pdb|3D7C|A Chain A, Crystal Structure Of The Bromodomain Of Human Gcn5, The General Control Of Amino-Acid Synthesis Protein 5-Like 2 Length = 112 Back     alignment and structure
>pdb|1F68|A Chain A, Nmr Solution Structure Of The Bromodomain From Human Gcn5 Length = 103 Back     alignment and structure
>pdb|1F68|A Chain A, Nmr Solution Structure Of The Bromodomain From Human Gcn5 Length = 103 Back     alignment and structure
>pdb|3I3J|A Chain A, Crystal Structure Of The Bromodomain Of Human Ep300 Length = 124 Back     alignment and structure
>pdb|1JSP|B Chain B, Nmr Structure Of Cbp Bromodomain In Complex With P53 Peptide Length = 121 Back     alignment and structure
>pdb|3DWY|A Chain A, Crystal Structure Of The Bromodomain Of Human Crebbp Length = 119 Back     alignment and structure
>pdb|2F6J|A Chain A, Crystal Structure Of Phd Finger-Linker-Bromodomain Fragment Of Human Bptf In The H3(1-15)k4me3 Bound State Length = 174 Back     alignment and structure
>pdb|2F6J|A Chain A, Crystal Structure Of Phd Finger-Linker-Bromodomain Fragment Of Human Bptf In The H3(1-15)k4me3 Bound State Length = 174 Back     alignment and structure
>pdb|1E6I|A Chain A, Bromodomain From Gcn5 Complexed With Acetylated H4 Peptide Length = 121 Back     alignment and structure
>pdb|3Q2E|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Bromodomain And Wd Repeat-Containing Protein 1 Isoform A (Wdr9) Length = 123 Back     alignment and structure
>pdb|3NXB|A Chain A, Crystal Structure Of The Bromodomain Of Human Cecr2 Length = 116 Back     alignment and structure
>pdb|3NXB|A Chain A, Crystal Structure Of The Bromodomain Of Human Cecr2 Length = 116 Back     alignment and structure
>pdb|3G0L|A Chain A, Crystal Structure Of Human Bromodomain Adjacent To Zinc Finger Domain 2b (Baz2b) Length = 117 Back     alignment and structure
>pdb|3MB3|A Chain A, Crystal Structure Of The Second Bromodomain Of Pleckstrin Homology Domain Interacting Protein (Phip) Length = 135 Back     alignment and structure
>pdb|2E7O|A Chain A, Solution Structure Of The Bromodomain From Human Bromodomain Adjacent To Zinc Finger Domain 2b Length = 112 Back     alignment and structure
>pdb|2YYN|A Chain A, Crystal Sturcture Of Human Bromodomain Protein Length = 135 Back     alignment and structure
>pdb|2YYN|A Chain A, Crystal Sturcture Of Human Bromodomain Protein Length = 135 Back     alignment and structure
>pdb|3O33|A Chain A, Crystal Structure Of Trim24 Phd-Bromo In The Free State Length = 184 Back     alignment and structure
>pdb|3O33|A Chain A, Crystal Structure Of Trim24 Phd-Bromo In The Free State Length = 184 Back     alignment and structure
>pdb|3AAD|A Chain A, Structure Of The Histone Chaperone Cia/asf1-double Bromodomain Complex Linking Histone Modifications And Site-specific Histone Eviction Length = 292 Back     alignment and structure
>pdb|1EQF|A Chain A, Crystal Structure Of The Double Bromodomain Module From Human Tafii250 Length = 280 Back     alignment and structure
>pdb|3UV5|A Chain A, Crystal Structure Of The Tandem Bromodomains Of Human Transcription Initiation Factor Tfiid Subunit 1 (Taf1) Length = 265 Back     alignment and structure
>pdb|3UV4|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Transcription Initiation Factor Tfiid Subunit 1 (Taf1) Length = 158 Back     alignment and structure
>pdb|3HMH|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Tbp-Associated Factor Rna Polymerase 1-Like (Taf1l) Length = 155 Back     alignment and structure
>pdb|3LXJ|A Chain A, Crystal Structure Of The Bromodomain Of Human Aaa Domain Containing 2b (Atad2b) Length = 136 Back     alignment and structure
>pdb|3RCW|A Chain A, Crystal Structure Of The Bromodomain Of Human Brd1 Length = 135 Back     alignment and structure
>pdb|3FKM|X Chain X, Plasmodium Falciparum Bromodomain-Containing Protein Pf10_0328 Length = 166 Back     alignment and structure
>pdb|3U5M|A Chain A, Crystal Structure Of Trim33 Phd-Bromo In The Free State Length = 207 Back     alignment and structure
>pdb|2KTB|B Chain B, Solution Structure Of The Second Bromodomain Of Human Polybr Complex With An Acetylated Peptide From Histone 3 Length = 121 Back     alignment and structure
>pdb|2DKW|A Chain A, Solution Structure Of The Bromodomain Of Human Protein Kiaa1240 Length = 131 Back     alignment and structure
>pdb|3LJW|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Polybromo Length = 120 Back     alignment and structure
>pdb|3HMF|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 116 Back     alignment and structure
>pdb|3TLP|A Chain A, Crystal Structure Of The Fourth Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 150 Back     alignment and structure
>pdb|3TLP|A Chain A, Crystal Structure Of The Fourth Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 150 Back     alignment and structure
>pdb|2D9E|A Chain A, Solution Structure Of The Bromodomain Of Peregrin Length = 121 Back     alignment and structure
>pdb|2I7K|A Chain A, Solution Structure Of The Bromodomain Of Human Brd7 Protein Length = 117 Back     alignment and structure
>pdb|2I7K|A Chain A, Solution Structure Of The Bromodomain Of Human Brd7 Protein Length = 117 Back     alignment and structure
>pdb|3DAI|A Chain A, Crystal Structure Of The Bromodomain Of The Human Atad2 Length = 130 Back     alignment and structure
>pdb|3HME|A Chain A, Crystal Structure Of Human Bromodomain Containing 9 Isoform 1 (Brd9) Length = 123 Back     alignment and structure
>pdb|3HME|A Chain A, Crystal Structure Of Human Bromodomain Containing 9 Isoform 1 (Brd9) Length = 123 Back     alignment and structure
>pdb|3G0J|A Chain A, Crystal Structure Of The Fifth Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 124 Back     alignment and structure
>pdb|3K2J|A Chain A, Crystal Structure Of The 3rd Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 130 Back     alignment and structure
>pdb|2YQD|A Chain A, Solution Structure Of The Fifth Bromodomain From Mouse Polybromo-1 Length = 120 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query779
3jvl_A120 Bromodomain-containing protein 4; alpha helical, N 3e-57
3jvl_A120 Bromodomain-containing protein 4; alpha helical, N 9e-43
4alg_A154 Bromodomain-containing protein 2; signaling protei 7e-56
4alg_A154 Bromodomain-containing protein 2; signaling protei 7e-44
2ouo_A130 HUNK1 protein, bromodomain-containing protein 4; B 4e-55
2ouo_A130 HUNK1 protein, bromodomain-containing protein 4; B 4e-42
2oss_A127 HUNK1 protein, bromodomain-containing protein 4; B 8e-55
2oss_A127 HUNK1 protein, bromodomain-containing protein 4; B 2e-46
3p1f_A119 CREB-binding protein; structural genomics consorti 1e-51
3p1f_A119 CREB-binding protein; structural genomics consorti 3e-41
3fkm_X166 Signaling protein; bromodomain, malaria, structura 1e-48
3fkm_X166 Signaling protein; bromodomain, malaria, structura 2e-46
3g0l_A117 Hwalp4, bromodomain adjacent to zinc finger domain 6e-47
3g0l_A117 Hwalp4, bromodomain adjacent to zinc finger domain 1e-40
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 1e-46
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 2e-39
3q2e_A123 Bromodomain and WD repeat-containing protein 1; st 2e-46
3q2e_A123 Bromodomain and WD repeat-containing protein 1; st 2e-36
3d7c_A112 General control of amino acid synthesis protein 5; 2e-46
3d7c_A112 General control of amino acid synthesis protein 5; 7e-41
1e6i_A121 Transcriptional activator GCN5; gene regulation, b 9e-46
1e6i_A121 Transcriptional activator GCN5; gene regulation, b 1e-43
3mb3_A135 PH-interacting protein; PHIP, pleckstrin homology 4e-44
3mb3_A135 PH-interacting protein; PHIP, pleckstrin homology 2e-36
2yyn_A135 Transcription intermediary factor 1-alpha; bromo d 6e-44
2yyn_A135 Transcription intermediary factor 1-alpha; bromo d 5e-42
3nxb_A116 CAT eye syndrome critical region protein 2; struct 7e-42
3nxb_A116 CAT eye syndrome critical region protein 2; struct 7e-41
3uv4_A158 Second bromodomain of human transcription initiat 8e-41
3uv4_A158 Second bromodomain of human transcription initiat 3e-39
2i7k_A117 Bromodomain-containing protein 7; helix, LEFT-hand 1e-39
2i7k_A117 Bromodomain-containing protein 7; helix, LEFT-hand 1e-36
2dkw_A131 Hypothetical protein KIAA1240; bromodomain-like, f 7e-39
2dkw_A131 Hypothetical protein KIAA1240; bromodomain-like, f 6e-34
3ljw_A120 Protein polybromo-1; alpha helix, alternative spli 2e-38
3ljw_A120 Protein polybromo-1; alpha helix, alternative spli 3e-34
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 2e-38
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 4e-38
2d9e_A121 Peregrin; four-helix bundle, transcription activat 8e-38
2d9e_A121 Peregrin; four-helix bundle, transcription activat 3e-37
3hme_A123 Bromodomain-containing protein 9; BRD9, bromodomai 1e-37
3hme_A123 Bromodomain-containing protein 9; BRD9, bromodomai 2e-37
3uv5_A265 Transcription initiation factor TFIID subunit 1; t 1e-37
3uv5_A265 Transcription initiation factor TFIID subunit 1; t 2e-34
3uv5_A265 Transcription initiation factor TFIID subunit 1; t 4e-31
3uv5_A265 Transcription initiation factor TFIID subunit 1; t 2e-29
3rcw_A135 Bromodomain-containing protein 1; transcription, s 9e-37
3rcw_A135 Bromodomain-containing protein 1; transcription, s 3e-35
3dai_A130 ATPase family AAA domain-containing protein 2; anc 2e-36
3dai_A130 ATPase family AAA domain-containing protein 2; anc 3e-32
3k2j_A130 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 2e-35
3k2j_A130 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 2e-32
3aad_A292 Transcription initiation factor TFIID subunit 1; p 2e-35
3aad_A292 Transcription initiation factor TFIID subunit 1; p 1e-31
3aad_A292 Transcription initiation factor TFIID subunit 1; p 2e-30
3aad_A292 Transcription initiation factor TFIID subunit 1; p 4e-27
3tlp_A150 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 2e-35
3tlp_A150 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 4e-30
3mb4_A124 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 4e-35
3mb4_A124 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 5e-31
3iu5_A116 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 3e-34
3iu5_A116 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 1e-29
2dat_A123 Possible global transcription activator SNF2L2; br 1e-33
2dat_A123 Possible global transcription activator SNF2L2; br 7e-33
3mqm_A126 Probable histone-lysine N-methyltransferase ASH1L; 2e-33
3mqm_A126 Probable histone-lysine N-methyltransferase ASH1L; 4e-29
2grc_A129 Probable global transcription activator SNF2L4; br 2e-33
2grc_A129 Probable global transcription activator SNF2L4; br 8e-33
2r0y_A311 Chromatin structure-remodeling complex protein RSC 1e-29
2r0y_A311 Chromatin structure-remodeling complex protein RSC 1e-27
2r0y_A311 Chromatin structure-remodeling complex protein RSC 6e-23
2r0y_A311 Chromatin structure-remodeling complex protein RSC 2e-22
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 3e-28
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 2e-25
2jns_A90 Bromodomain-containing protein 4; ET-domain, struc 6e-28
2r10_A361 Chromatin structure-remodeling complex protein RSC 8e-27
2r10_A361 Chromatin structure-remodeling complex protein RSC 6e-25
2r10_A361 Chromatin structure-remodeling complex protein RSC 6e-21
2r10_A361 Chromatin structure-remodeling complex protein RSC 2e-19
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 4e-23
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 7e-16
3iu6_A147 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 3e-22
3iu6_A147 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 4e-19
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 2e-15
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 2e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-07
>3jvl_A Bromodomain-containing protein 4; alpha helical, N-acetyl lysine binding domain, signaling protein; 1.20A {Mus musculus} PDB: 3jvm_A 2dww_A 2i8n_A 3oni_A* 2dvv_A* 2e3k_A* 2g4a_A 3s92_A* 2oo1_A* 2e7n_A 2wp1_A* Length = 120 Back     alignment and structure
 Score =  190 bits (484), Expect = 3e-57
 Identities = 75/114 (65%), Positives = 86/114 (75%)

Query: 367 GSKTPLWYKYCSEIIAELFHKKHQNYAWPFYTPVDVEKLGLTDYFDIIKKPMDLGTVRKK 426
           GSK     K CS I+ E+F KKH  YAWPFY PVDVE LGL DY DIIK PMD+ T++ K
Sbjct: 4   GSKISEQLKCCSGILKEMFAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSK 63

Query: 427 MRNRTYKTAKEFADDVRLIFSNCYKYNPPDHNVVTMARQLSAVFEDRFAKMPDE 480
           + +R Y+ A+EF  DVRL+FSNCYKYNPPDH VV MAR+L  VFE RFAKMPDE
Sbjct: 64  LESREYRDAQEFGADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPDE 117


>3jvl_A Bromodomain-containing protein 4; alpha helical, N-acetyl lysine binding domain, signaling protein; 1.20A {Mus musculus} PDB: 3jvm_A 2dww_A 2i8n_A 3oni_A* 2dvv_A* 2e3k_A* 2g4a_A 3s92_A* 2oo1_A* 2e7n_A 2wp1_A* Length = 120 Back     alignment and structure
>4alg_A Bromodomain-containing protein 2; signaling protein, inhibitor, histone, epigenetic reader; HET: 1GH; 1.60A {Homo sapiens} PDB: 4a9e_A 4a9h_A* 4a9i_A* 4a9j_A* 4a9m_A* 4a9n_A* 4a9o_A* 4a9p_A* 4a9f_A* 4alh_A* 4akn_A* 2yek_A* 2ydw_A* 2yw5_A Length = 154 Back     alignment and structure
>4alg_A Bromodomain-containing protein 2; signaling protein, inhibitor, histone, epigenetic reader; HET: 1GH; 1.60A {Homo sapiens} PDB: 4a9e_A 4a9h_A* 4a9i_A* 4a9j_A* 4a9m_A* 4a9n_A* 4a9o_A* 4a9p_A* 4a9f_A* 4alh_A* 4akn_A* 2yek_A* 2ydw_A* 2yw5_A Length = 154 Back     alignment and structure
>2ouo_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.89A {Homo sapiens} PDB: 2yem_A* Length = 130 Back     alignment and structure
>2ouo_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.89A {Homo sapiens} PDB: 2yem_A* Length = 130 Back     alignment and structure
>2oss_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.35A {Homo sapiens} PDB: 2yel_A* 3mxf_A* 3p5o_A* 3svf_A* 3svg_A* 3u5j_A* 3u5k_A* 3u5l_A* 3uvw_A* 3uvx_A* 3uvy_A* 3uw9_A* 3zyu_A* 4a9l_A* 4e96_A* 3jvj_A 3jvk_A* 3muk_A* 3mul_A* 2nxb_A ... Length = 127 Back     alignment and structure
>2oss_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.35A {Homo sapiens} PDB: 2yel_A* 3mxf_A* 3p5o_A* 3svf_A* 3svg_A* 3u5j_A* 3u5k_A* 3u5l_A* 3uvw_A* 3uvx_A* 3uvy_A* 3uw9_A* 3zyu_A* 4a9l_A* 4e96_A* 3jvj_A 3jvk_A* 3muk_A* 3mul_A* 2nxb_A ... Length = 127 Back     alignment and structure
>3p1f_A CREB-binding protein; structural genomics consortium, SGC, CBP, crebbp, CREB bindi protein isoform A, KAT3A, RSTS, RST, bromodomain, transcrip; HET: 3PF; 1.63A {Homo sapiens} PDB: 3dwy_A 3p1d_A 3p1c_A 3p1e_A* 3svh_A* 4a9k_A* 1jsp_B* 2d82_A* 2l84_A* 2l85_A* 2rny_A* 3i3j_A Length = 119 Back     alignment and structure
>3p1f_A CREB-binding protein; structural genomics consortium, SGC, CBP, crebbp, CREB bindi protein isoform A, KAT3A, RSTS, RST, bromodomain, transcrip; HET: 3PF; 1.63A {Homo sapiens} PDB: 3dwy_A 3p1d_A 3p1c_A 3p1e_A* 3svh_A* 4a9k_A* 1jsp_B* 2d82_A* 2l84_A* 2l85_A* 2rny_A* 3i3j_A Length = 119 Back     alignment and structure
>3fkm_X Signaling protein; bromodomain, malaria, structural genomics, structural genomi consortium, SGC; 2.50A {Plasmodium falciparum 3D7} Length = 166 Back     alignment and structure
>3fkm_X Signaling protein; bromodomain, malaria, structural genomics, structural genomi consortium, SGC; 2.50A {Plasmodium falciparum 3D7} Length = 166 Back     alignment and structure
>3g0l_A Hwalp4, bromodomain adjacent to zinc finger domain protei; BAZB2, KIAA1 WALP4, structural genomics consortium, SGC, transcription; 2.03A {Homo sapiens} PDB: 3q2f_A* 2e7o_A Length = 117 Back     alignment and structure
>3g0l_A Hwalp4, bromodomain adjacent to zinc finger domain protei; BAZB2, KIAA1 WALP4, structural genomics consortium, SGC, transcription; 2.03A {Homo sapiens} PDB: 3q2f_A* 2e7o_A Length = 117 Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Length = 174 Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Length = 174 Back     alignment and structure
>3q2e_A Bromodomain and WD repeat-containing protein 1; structural genomics consortium, SGC, cell cycle progression, signal transduction, apoptosis; 1.74A {Homo sapiens} Length = 123 Back     alignment and structure
>3q2e_A Bromodomain and WD repeat-containing protein 1; structural genomics consortium, SGC, cell cycle progression, signal transduction, apoptosis; 1.74A {Homo sapiens} Length = 123 Back     alignment and structure
>3d7c_A General control of amino acid synthesis protein 5; GCN5, bromodomain, structural genomics consortium, SGC, HOST-virus interaction, nucleus; 2.06A {Homo sapiens} SCOP: a.29.2.1 PDB: 1f68_A 1jm4_B* 1n72_A 1wug_A* 1wum_A* 1zs5_A* 2rnw_A* 2rnx_A* 3gg3_A Length = 112 Back     alignment and structure
>3d7c_A General control of amino acid synthesis protein 5; GCN5, bromodomain, structural genomics consortium, SGC, HOST-virus interaction, nucleus; 2.06A {Homo sapiens} SCOP: a.29.2.1 PDB: 1f68_A 1jm4_B* 1n72_A 1wug_A* 1wum_A* 1zs5_A* 2rnw_A* 2rnx_A* 3gg3_A Length = 112 Back     alignment and structure
>1e6i_A Transcriptional activator GCN5; gene regulation, bromodomain, histone binding, N-acetyl lysine; HET: ALY; 1.87A {Saccharomyces cerevisiae} SCOP: a.29.2.1 Length = 121 Back     alignment and structure
>1e6i_A Transcriptional activator GCN5; gene regulation, bromodomain, histone binding, N-acetyl lysine; HET: ALY; 1.87A {Saccharomyces cerevisiae} SCOP: a.29.2.1 Length = 121 Back     alignment and structure
>3mb3_A PH-interacting protein; PHIP, pleckstrin homology domain interacting protein, DCAF14 DDB1 and CUL4 associated factor 14, SGC; 2.25A {Homo sapiens} Length = 135 Back     alignment and structure
>3mb3_A PH-interacting protein; PHIP, pleckstrin homology domain interacting protein, DCAF14 DDB1 and CUL4 associated factor 14, SGC; 2.25A {Homo sapiens} Length = 135 Back     alignment and structure
>2yyn_A Transcription intermediary factor 1-alpha; bromo domain, structural genomics, NPPSFA; 2.50A {Homo sapiens} Length = 135 Back     alignment and structure
>2yyn_A Transcription intermediary factor 1-alpha; bromo domain, structural genomics, NPPSFA; 2.50A {Homo sapiens} Length = 135 Back     alignment and structure
>3nxb_A CAT eye syndrome critical region protein 2; structural genomics consortium, SGC, CECR2, CAT eye syndrome chromosome region candidate 2, bromodomain; 1.83A {Homo sapiens} Length = 116 Back     alignment and structure
>3nxb_A CAT eye syndrome critical region protein 2; structural genomics consortium, SGC, CECR2, CAT eye syndrome chromosome region candidate 2, bromodomain; 1.83A {Homo sapiens} Length = 116 Back     alignment and structure
>3uv4_A Second bromodomain of human transcription initiat TFIID subunit 1 (TAF1); structural genomics consortium, SGC; 1.89A {Homo sapiens} PDB: 3hmh_A Length = 158 Back     alignment and structure
>3uv4_A Second bromodomain of human transcription initiat TFIID subunit 1 (TAF1); structural genomics consortium, SGC; 1.89A {Homo sapiens} PDB: 3hmh_A Length = 158 Back     alignment and structure
>2i7k_A Bromodomain-containing protein 7; helix, LEFT-handed four-helix bundle, transcription; NMR {Homo sapiens} Length = 117 Back     alignment and structure
>2i7k_A Bromodomain-containing protein 7; helix, LEFT-handed four-helix bundle, transcription; NMR {Homo sapiens} Length = 117 Back     alignment and structure
>2dkw_A Hypothetical protein KIAA1240; bromodomain-like, five-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 131 Back     alignment and structure
>2dkw_A Hypothetical protein KIAA1240; bromodomain-like, five-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 131 Back     alignment and structure
>3ljw_A Protein polybromo-1; alpha helix, alternative splicing, bromodomain, chromatin RE DNA-binding, nucleus, phosphoprotein, transcription; 1.50A {Homo sapiens} PDB: 2ktb_B* 3hmf_A Length = 120 Back     alignment and structure
>3ljw_A Protein polybromo-1; alpha helix, alternative splicing, bromodomain, chromatin RE DNA-binding, nucleus, phosphoprotein, transcription; 1.50A {Homo sapiens} PDB: 2ktb_B* 3hmf_A Length = 120 Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Length = 184 Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Length = 184 Back     alignment and structure
>2d9e_A Peregrin; four-helix bundle, transcription activator, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>2d9e_A Peregrin; four-helix bundle, transcription activator, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>3hme_A Bromodomain-containing protein 9; BRD9, bromodomain containing 9 isoform 1, LAVS3040, rhabdomyosarcoma antigen MU-RMS-40.8; 2.23A {Homo sapiens} Length = 123 Back     alignment and structure
>3hme_A Bromodomain-containing protein 9; BRD9, bromodomain containing 9 isoform 1, LAVS3040, rhabdomyosarcoma antigen MU-RMS-40.8; 2.23A {Homo sapiens} Length = 123 Back     alignment and structure
>3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Length = 265 Back     alignment and structure
>3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Length = 265 Back     alignment and structure
>3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Length = 265 Back     alignment and structure
>3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Length = 265 Back     alignment and structure
>3rcw_A Bromodomain-containing protein 1; transcription, structural genomics, structural consortium, SGC; 2.21A {Homo sapiens} Length = 135 Back     alignment and structure
>3rcw_A Bromodomain-containing protein 1; transcription, structural genomics, structural consortium, SGC; 2.21A {Homo sapiens} Length = 135 Back     alignment and structure
>3dai_A ATPase family AAA domain-containing protein 2; ancca, AAA+ nuclear coregulator cancer-associated Pro2000 protein, two AAA DOMA containing protein; 1.95A {Homo sapiens} PDB: 3lxj_A Length = 130 Back     alignment and structure
>3dai_A ATPase family AAA domain-containing protein 2; ancca, AAA+ nuclear coregulator cancer-associated Pro2000 protein, two AAA DOMA containing protein; 1.95A {Homo sapiens} PDB: 3lxj_A Length = 130 Back     alignment and structure
>3k2j_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo01D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.20A {Homo sapiens} Length = 130 Back     alignment and structure
>3k2j_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo01D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.20A {Homo sapiens} Length = 130 Back     alignment and structure
>3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Length = 292 Back     alignment and structure
>3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Length = 292 Back     alignment and structure
>3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Length = 292 Back     alignment and structure
>3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Length = 292 Back     alignment and structure
>3tlp_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.13A {Homo sapiens} Length = 150 Back     alignment and structure
>3tlp_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.13A {Homo sapiens} Length = 150 Back     alignment and structure
>3mb4_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 1.66A {Homo sapiens} PDB: 3g0j_A 2yqd_A Length = 124 Back     alignment and structure
>3mb4_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 1.66A {Homo sapiens} PDB: 3g0j_A 2yqd_A Length = 124 Back     alignment and structure
>3iu5_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; 1.63A {Homo sapiens} Length = 116 Back     alignment and structure
>3iu5_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; 1.63A {Homo sapiens} Length = 116 Back     alignment and structure
>2dat_A Possible global transcription activator SNF2L2; bromodomain, all alpha protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2dat_A Possible global transcription activator SNF2L2; bromodomain, all alpha protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>3mqm_A Probable histone-lysine N-methyltransferase ASH1L; KIAA1420, absent small and homeotic disks prote homolog, lysine N-methyltransferase 2H, KMT2H; 2.54A {Homo sapiens} Length = 126 Back     alignment and structure
>3mqm_A Probable histone-lysine N-methyltransferase ASH1L; KIAA1420, absent small and homeotic disks prote homolog, lysine N-methyltransferase 2H, KMT2H; 2.54A {Homo sapiens} Length = 126 Back     alignment and structure
>2grc_A Probable global transcription activator SNF2L4; bromodomain, BRG1, chromatin remodelling, acely-lysine binding, protein-protein interactions; 1.50A {Homo sapiens} PDB: 3uvd_A 2h60_A Length = 129 Back     alignment and structure
>2grc_A Probable global transcription activator SNF2L4; bromodomain, BRG1, chromatin remodelling, acely-lysine binding, protein-protein interactions; 1.50A {Homo sapiens} PDB: 3uvd_A 2h60_A Length = 129 Back     alignment and structure
>2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Length = 311 Back     alignment and structure
>2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Length = 311 Back     alignment and structure
>2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Length = 311 Back     alignment and structure
>2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Length = 311 Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Length = 207 Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Length = 207 Back     alignment and structure
>2jns_A Bromodomain-containing protein 4; ET-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 90 Back     alignment and structure
>2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Length = 361 Back     alignment and structure
>2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Length = 361 Back     alignment and structure
>2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Length = 361 Back     alignment and structure
>2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Length = 361 Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Length = 189 Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Length = 189 Back     alignment and structure
>3iu6_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; HET: OCS; 1.79A {Homo sapiens} Length = 147 Back     alignment and structure
>3iu6_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; HET: OCS; 1.79A {Homo sapiens} Length = 147 Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Length = 183 Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Length = 183 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query779
3uv5_A265 Transcription initiation factor TFIID subunit 1; t 100.0
3aad_A292 Transcription initiation factor TFIID subunit 1; p 100.0
2r10_A361 Chromatin structure-remodeling complex protein RSC 100.0
2r0y_A311 Chromatin structure-remodeling complex protein RSC 100.0
4alg_A154 Bromodomain-containing protein 2; signaling protei 99.97
2ouo_A130 HUNK1 protein, bromodomain-containing protein 4; B 99.97
2oss_A127 HUNK1 protein, bromodomain-containing protein 4; B 99.97
3jvl_A120 Bromodomain-containing protein 4; alpha helical, N 99.96
2ouo_A130 HUNK1 protein, bromodomain-containing protein 4; B 99.94
2oss_A127 HUNK1 protein, bromodomain-containing protein 4; B 99.94
2dat_A123 Possible global transcription activator SNF2L2; br 99.94
4alg_A154 Bromodomain-containing protein 2; signaling protei 99.94
3g0l_A117 Hwalp4, bromodomain adjacent to zinc finger domain 99.93
3g0l_A117 Hwalp4, bromodomain adjacent to zinc finger domain 99.93
3d7c_A112 General control of amino acid synthesis protein 5; 99.93
3jvl_A120 Bromodomain-containing protein 4; alpha helical, N 99.93
2grc_A129 Probable global transcription activator SNF2L4; br 99.93
2dat_A123 Possible global transcription activator SNF2L2; br 99.93
3d7c_A112 General control of amino acid synthesis protein 5; 99.93
3mb4_A124 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.93
1e6i_A121 Transcriptional activator GCN5; gene regulation, b 99.93
3fkm_X166 Signaling protein; bromodomain, malaria, structura 99.93
3p1f_A119 CREB-binding protein; structural genomics consorti 99.92
3p1f_A119 CREB-binding protein; structural genomics consorti 99.92
3fkm_X166 Signaling protein; bromodomain, malaria, structura 99.92
3iu5_A116 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.92
1e6i_A121 Transcriptional activator GCN5; gene regulation, b 99.92
2yyn_A135 Transcription intermediary factor 1-alpha; bromo d 99.92
2d9e_A121 Peregrin; four-helix bundle, transcription activat 99.92
3nxb_A116 CAT eye syndrome critical region protein 2; struct 99.92
2d9e_A121 Peregrin; four-helix bundle, transcription activat 99.92
2i7k_A117 Bromodomain-containing protein 7; helix, LEFT-hand 99.92
3mb4_A124 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.92
2i7k_A117 Bromodomain-containing protein 7; helix, LEFT-hand 99.92
3mb3_A135 PH-interacting protein; PHIP, pleckstrin homology 99.92
3q2e_A123 Bromodomain and WD repeat-containing protein 1; st 99.92
3ljw_A120 Protein polybromo-1; alpha helix, alternative spli 99.92
3mqm_A126 Probable histone-lysine N-methyltransferase ASH1L; 99.92
3nxb_A116 CAT eye syndrome critical region protein 2; struct 99.92
2yyn_A135 Transcription intermediary factor 1-alpha; bromo d 99.92
3q2e_A123 Bromodomain and WD repeat-containing protein 1; st 99.92
3mb3_A135 PH-interacting protein; PHIP, pleckstrin homology 99.91
3k2j_A130 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.91
2grc_A129 Probable global transcription activator SNF2L4; br 99.91
3hme_A123 Bromodomain-containing protein 9; BRD9, bromodomai 99.91
3ljw_A120 Protein polybromo-1; alpha helix, alternative spli 99.91
3rcw_A135 Bromodomain-containing protein 1; transcription, s 99.91
3hme_A123 Bromodomain-containing protein 9; BRD9, bromodomai 99.91
3mqm_A126 Probable histone-lysine N-methyltransferase ASH1L; 99.91
3rcw_A135 Bromodomain-containing protein 1; transcription, s 99.91
3uv4_A158 Second bromodomain of human transcription initiat 99.91
2jns_A90 Bromodomain-containing protein 4; ET-domain, struc 99.9
3iu5_A116 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.9
3k2j_A130 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.9
3uv4_A158 Second bromodomain of human transcription initiat 99.9
3tlp_A150 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.89
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 99.89
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 99.89
3dai_A130 ATPase family AAA domain-containing protein 2; anc 99.89
3tlp_A150 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.88
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 99.87
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 99.87
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 99.87
3dai_A130 ATPase family AAA domain-containing protein 2; anc 99.87
2dkw_A131 Hypothetical protein KIAA1240; bromodomain-like, f 99.87
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 99.86
2dkw_A131 Hypothetical protein KIAA1240; bromodomain-like, f 99.86
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 99.85
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 99.85
3uv5_A265 Transcription initiation factor TFIID subunit 1; t 99.85
3aad_A292 Transcription initiation factor TFIID subunit 1; p 99.82
2r0y_A311 Chromatin structure-remodeling complex protein RSC 99.81
2r10_A361 Chromatin structure-remodeling complex protein RSC 99.8
3iu6_A147 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.73
3iu6_A147 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.71
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 99.45
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 99.4
2lm0_A125 AF4/FMR2 family member 1/protein AF-9 chimera; int 93.82
>3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Back     alignment and structure
Probab=100.00  E-value=5.8e-45  Score=385.16  Aligned_cols=225  Identities=28%  Similarity=0.501  Sum_probs=190.5

Q ss_pred             hHHHHHHHHHHHHHHHcCCCCCCCCCCCCccccCCCCchhhcCCCCCHHHHHHHhhcCCCCCHHHHHHHHHHHhhhhhhh
Q psy14234        122 TNQLQYIVKNVMKAVWKHPHAWPFHEPVDAINLNLPDYHKVITQPMDLGTIKKRLENNYYWSGKEAIQDFTTMFTNCYVY  201 (779)
Q Consensus       122 ~~~l~~~~~~il~~L~~~~~s~pF~~PVd~~~~~~PdYy~iIk~PmDL~tIk~kL~~~~Y~s~~ef~~D~~lmf~Na~~y  201 (779)
                      ...|..+|..||..|++|+.+|||..||++.  .+||||.+|++||||+||++||++|.|.++.+|+.||+|||+||++|
T Consensus        12 ~~~l~~~l~~il~~l~~~~~~~~F~~pv~~~--~~pdY~~iI~~PmdL~tI~~kl~~~~Y~~~~~f~~D~~li~~Na~~y   89 (265)
T 3uv5_A           12 MVTLSSILESIINDMRDLPNTYPFHTPVNAK--VVKDYYKIITRPMDLQTLRENVRKRLYPSREEFREHLELIVKNSATY   89 (265)
T ss_dssp             HHHHHHHHHHHHHHHHTSTTCGGGTSCCCTT--TSTTHHHHCSSCCCHHHHHHHHHTTCCSSHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHcCCCchhhhCCCChh--hcCCHHHHhCCCCcHHHHHHHHHcCCCCCHHHHHHHHHHHHhhhhhc
Confidence            5689999999999999999999999999976  69999999999999999999999999999999999999999999999


Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHhCCCCcccccCCCCCCCCCCCCCCCCCCCCCCCccCCCCCCCCCCCCCCCCCCCCCCC
Q psy14234        202 NKPGEDVVLMAQNLEQLFLTKITGMPSEEVVLDAPQPRSSKKKPPVSASPSLNPVIKTPVIPLNKLPSATSTPKPRPPNP  281 (779)
Q Consensus       202 N~~~s~i~~~A~~Le~~f~~~~~~~~~~e~~~~~~~~k~~~~k~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~  281 (779)
                      |+++|.|+.+|..|+.+|.+.|.++......                                                 
T Consensus        90 N~~~s~i~~~A~~l~~~~~~~~~~~~~~~~~-------------------------------------------------  120 (265)
T 3uv5_A           90 NGPKHSLTQISQSMLDLCDEKLKEKEDKLAR-------------------------------------------------  120 (265)
T ss_dssp             HCTTCHHHHHHHHHHHHHHHHHHHTHHHHHH-------------------------------------------------
T ss_pred             CCCCChHHHHHHHHHHHHHHHHHHHhhhhhh-------------------------------------------------
Confidence            9999999999999999999999875221000                                                 


Q ss_pred             CCCCCCCCCCCccccccCCCCCCCChhHHHhhhhccCCCCCCCCCCCCCCCcchhhhcccccccCCCCCCCCCCCcCCCC
Q psy14234        282 VLGSTATTTTAPKVNHLNSMNAPDTPDMKKAIKRKADGSIDHTPSSLHPTPVKSAKQLNTRRESGSITKKPQRISEEGGG  361 (779)
Q Consensus       282 ~~~~~~~~~~~~~s~~~~~~~~p~~~~~kk~~krkadtt~d~tPt~~~~~~~~~~~~~~~rres~R~~k~p~~~l~~~~~  361 (779)
                                                 ..++.          .|                          ...   +   
T Consensus       121 ---------------------------~ek~i----------~p--------------------------~~d---d---  131 (265)
T 3uv5_A          121 ---------------------------LEKAI----------NP--------------------------LLD---D---  131 (265)
T ss_dssp             ---------------------------HHHHH----------ST--------------------------TTT---C---
T ss_pred             ---------------------------hhhhh----------hh--------------------------ccc---c---
Confidence                                       00000          00                          000   0   


Q ss_pred             CCCCCCCCcHHHHHHHHHHHHHHHhc--cCCCCccCccccCCccccCCCchhhhhcCCCCHHHHHHHHhcCCCCCHHHHH
Q psy14234        362 GSGLGGSKTPLWYKYCSEIIAELFHK--KHQNYAWPFYTPVDVEKLGLTDYFDIIKKPMDLGTVRKKMRNRTYKTAKEFA  439 (779)
Q Consensus       362 ~~~~~~~~~~~~~k~c~~iL~~l~~~--k~~~~a~pF~~PVd~~~~~~pdY~~iIk~PMDL~tIk~KL~~~~Y~s~~eF~  439 (779)
                                .....|..||..++.+  ..+..+|||+.||+...  +||||+||++||||+||++||++|.|.++.+|.
T Consensus       132 ----------~~~~~~~~il~~i~~~~l~~~~~~~~F~~pv~~~~--~pdY~~iIk~Pmdl~tI~~kl~~~~Y~~~~~f~  199 (265)
T 3uv5_A          132 ----------DDQVAFSFILDNIVTQKMMAVPDSWPFHHPVNKKF--VPDYYKVIVNPMDLETIRKNISKHKYQSRESFL  199 (265)
T ss_dssp             ----------HHHHHHHHHHHHHHHHTTTTSTTCGGGTSCCCTTT--STTHHHHCSSCCCHHHHHHHHHTTCCSSHHHHH
T ss_pred             ----------chhhHHHHHHHHHHHHHHHhhhhhHHHhCCCChhH--hCcHHHHhCCcccHHHHHHHHhcCCCCCHHHHH
Confidence                      0122234444444332  22356999999999876  899999999999999999999999999999999


Q ss_pred             HHHHHhhhhhcccCCCCChHHHHHHHHHHHHHHHHhcCC
Q psy14234        440 DDVRLIFSNCYKYNPPDHNVVTMARQLSAVFEDRFAKMP  478 (779)
Q Consensus       440 ~Dv~Lmf~Na~~yN~~~s~v~~~A~~Lq~~Fe~~~~~i~  478 (779)
                      .||+|||.||++||+++|.||.+|..|+.+|+..|.++.
T Consensus       200 ~D~~lif~Na~~yN~~~s~~~~~A~~l~~~~~~~~~~~~  238 (265)
T 3uv5_A          200 DDVNLILANSVKYNGPESQYTKTAQEIVNVCYQTLTEYD  238 (265)
T ss_dssp             HHHHHHHHHHHHHTCTTCHHHHHHHHHHHHHHHHHHHTH
T ss_pred             HHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHH
Confidence            999999999999999999999999999999999999985



>3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Back     alignment and structure
>2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Back     alignment and structure
>2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Back     alignment and structure
>4alg_A Bromodomain-containing protein 2; signaling protein, inhibitor, histone, epigenetic reader; HET: 1GH; 1.60A {Homo sapiens} PDB: 4a9e_A 4a9h_A* 4a9i_A* 4a9j_A* 4a9m_A* 4a9n_A* 4a9o_A* 4a9p_A* 4a9f_A* 4alh_A* 4akn_A* 2yek_A* 2ydw_A* 2yw5_A Back     alignment and structure
>2ouo_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.89A {Homo sapiens} PDB: 2yem_A* Back     alignment and structure
>2oss_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.35A {Homo sapiens} PDB: 2yel_A* 3mxf_A* 3p5o_A* 3svf_A* 3svg_A* 3u5j_A* 3u5k_A* 3u5l_A* 3uvw_A* 3uvx_A* 3uvy_A* 3uw9_A* 3zyu_A* 4a9l_A* 4e96_A* 3jvj_A 3jvk_A* 3muk_A* 3mul_A* 2nxb_A ... Back     alignment and structure
>3jvl_A Bromodomain-containing protein 4; alpha helical, N-acetyl lysine binding domain, signaling protein; 1.20A {Mus musculus} PDB: 3jvm_A 2dww_A 2i8n_A 3oni_A* 2dvv_A* 2e3k_A* 2g4a_A 3s92_A* 2oo1_A* 2e7n_A 2wp1_A* Back     alignment and structure
>2ouo_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.89A {Homo sapiens} PDB: 2yem_A* Back     alignment and structure
>2oss_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.35A {Homo sapiens} PDB: 2yel_A* 3mxf_A* 3p5o_A* 3svf_A* 3svg_A* 3u5j_A* 3u5k_A* 3u5l_A* 3uvw_A* 3uvx_A* 3uvy_A* 3uw9_A* 3zyu_A* 4a9l_A* 4e96_A* 3jvj_A 3jvk_A* 3muk_A* 3mul_A* 2nxb_A ... Back     alignment and structure
>2dat_A Possible global transcription activator SNF2L2; bromodomain, all alpha protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4alg_A Bromodomain-containing protein 2; signaling protein, inhibitor, histone, epigenetic reader; HET: 1GH; 1.60A {Homo sapiens} PDB: 4a9e_A 4a9h_A* 4a9i_A* 4a9j_A* 4a9m_A* 4a9n_A* 4a9o_A* 4a9p_A* 4a9f_A* 4alh_A* 4akn_A* 2yek_A* 2ydw_A* 2yw5_A Back     alignment and structure
>3g0l_A Hwalp4, bromodomain adjacent to zinc finger domain protei; BAZB2, KIAA1 WALP4, structural genomics consortium, SGC, transcription; 2.03A {Homo sapiens} PDB: 3q2f_A* 2e7o_A Back     alignment and structure
>3g0l_A Hwalp4, bromodomain adjacent to zinc finger domain protei; BAZB2, KIAA1 WALP4, structural genomics consortium, SGC, transcription; 2.03A {Homo sapiens} PDB: 3q2f_A* 2e7o_A Back     alignment and structure
>3d7c_A General control of amino acid synthesis protein 5; GCN5, bromodomain, structural genomics consortium, SGC, HOST-virus interaction, nucleus; 2.06A {Homo sapiens} SCOP: a.29.2.1 PDB: 1f68_A 1jm4_B* 1n72_A 1wug_A* 1wum_A* 1zs5_A* 2rnw_A* 2rnx_A* 3gg3_A Back     alignment and structure
>3jvl_A Bromodomain-containing protein 4; alpha helical, N-acetyl lysine binding domain, signaling protein; 1.20A {Mus musculus} PDB: 3jvm_A 2dww_A 2i8n_A 3oni_A* 2dvv_A* 2e3k_A* 2g4a_A 3s92_A* 2oo1_A* 2e7n_A 2wp1_A* Back     alignment and structure
>2grc_A Probable global transcription activator SNF2L4; bromodomain, BRG1, chromatin remodelling, acely-lysine binding, protein-protein interactions; 1.50A {Homo sapiens} PDB: 3uvd_A 2h60_A Back     alignment and structure
>2dat_A Possible global transcription activator SNF2L2; bromodomain, all alpha protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3d7c_A General control of amino acid synthesis protein 5; GCN5, bromodomain, structural genomics consortium, SGC, HOST-virus interaction, nucleus; 2.06A {Homo sapiens} SCOP: a.29.2.1 PDB: 1f68_A 1jm4_B* 1n72_A 1wug_A* 1wum_A* 1zs5_A* 2rnw_A* 2rnx_A* 3gg3_A Back     alignment and structure
>3mb4_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 1.66A {Homo sapiens} PDB: 3g0j_A 2yqd_A Back     alignment and structure
>1e6i_A Transcriptional activator GCN5; gene regulation, bromodomain, histone binding, N-acetyl lysine; HET: ALY; 1.87A {Saccharomyces cerevisiae} SCOP: a.29.2.1 Back     alignment and structure
>3fkm_X Signaling protein; bromodomain, malaria, structural genomics, structural genomi consortium, SGC; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>3p1f_A CREB-binding protein; structural genomics consortium, SGC, CBP, crebbp, CREB bindi protein isoform A, KAT3A, RSTS, RST, bromodomain, transcrip; HET: 3PF; 1.63A {Homo sapiens} SCOP: a.29.2.1 PDB: 3dwy_A 3p1d_A 3p1c_A 3p1e_A* 3svh_A* 4a9k_A* 1jsp_B* 2d82_A* 2l84_A* 2l85_A* 2rny_A* 3i3j_A Back     alignment and structure
>3p1f_A CREB-binding protein; structural genomics consortium, SGC, CBP, crebbp, CREB bindi protein isoform A, KAT3A, RSTS, RST, bromodomain, transcrip; HET: 3PF; 1.63A {Homo sapiens} SCOP: a.29.2.1 PDB: 3dwy_A 3p1d_A 3p1c_A 3p1e_A* 3svh_A* 4a9k_A* 1jsp_B* 2d82_A* 2l84_A* 2l85_A* 2rny_A* 3i3j_A Back     alignment and structure
>3fkm_X Signaling protein; bromodomain, malaria, structural genomics, structural genomi consortium, SGC; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>3iu5_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; 1.63A {Homo sapiens} Back     alignment and structure
>1e6i_A Transcriptional activator GCN5; gene regulation, bromodomain, histone binding, N-acetyl lysine; HET: ALY; 1.87A {Saccharomyces cerevisiae} SCOP: a.29.2.1 Back     alignment and structure
>2yyn_A Transcription intermediary factor 1-alpha; bromo domain, structural genomics, NPPSFA; 2.50A {Homo sapiens} Back     alignment and structure
>2d9e_A Peregrin; four-helix bundle, transcription activator, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3nxb_A CAT eye syndrome critical region protein 2; structural genomics consortium, SGC, CECR2, CAT eye syndrome chromosome region candidate 2, bromodomain; 1.83A {Homo sapiens} SCOP: a.29.2.0 Back     alignment and structure
>2d9e_A Peregrin; four-helix bundle, transcription activator, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2i7k_A Bromodomain-containing protein 7; helix, LEFT-handed four-helix bundle, transcription; NMR {Homo sapiens} Back     alignment and structure
>3mb4_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 1.66A {Homo sapiens} PDB: 3g0j_A 2yqd_A Back     alignment and structure
>2i7k_A Bromodomain-containing protein 7; helix, LEFT-handed four-helix bundle, transcription; NMR {Homo sapiens} Back     alignment and structure
>3mb3_A PH-interacting protein; PHIP, pleckstrin homology domain interacting protein, DCAF14 DDB1 and CUL4 associated factor 14, SGC; 2.25A {Homo sapiens} Back     alignment and structure
>3q2e_A Bromodomain and WD repeat-containing protein 1; structural genomics consortium, SGC, cell cycle progression, signal transduction, apoptosis; 1.74A {Homo sapiens} Back     alignment and structure
>3ljw_A Protein polybromo-1; alpha helix, alternative splicing, bromodomain, chromatin RE DNA-binding, nucleus, phosphoprotein, transcription; 1.50A {Homo sapiens} PDB: 2ktb_B* 3hmf_A Back     alignment and structure
>3mqm_A Probable histone-lysine N-methyltransferase ASH1L; KIAA1420, absent small and homeotic disks prote homolog, lysine N-methyltransferase 2H, KMT2H; 2.54A {Homo sapiens} Back     alignment and structure
>3nxb_A CAT eye syndrome critical region protein 2; structural genomics consortium, SGC, CECR2, CAT eye syndrome chromosome region candidate 2, bromodomain; 1.83A {Homo sapiens} SCOP: a.29.2.0 Back     alignment and structure
>2yyn_A Transcription intermediary factor 1-alpha; bromo domain, structural genomics, NPPSFA; 2.50A {Homo sapiens} Back     alignment and structure
>3q2e_A Bromodomain and WD repeat-containing protein 1; structural genomics consortium, SGC, cell cycle progression, signal transduction, apoptosis; 1.74A {Homo sapiens} Back     alignment and structure
>3mb3_A PH-interacting protein; PHIP, pleckstrin homology domain interacting protein, DCAF14 DDB1 and CUL4 associated factor 14, SGC; 2.25A {Homo sapiens} Back     alignment and structure
>3k2j_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo01D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.20A {Homo sapiens} Back     alignment and structure
>2grc_A Probable global transcription activator SNF2L4; bromodomain, BRG1, chromatin remodelling, acely-lysine binding, protein-protein interactions; 1.50A {Homo sapiens} PDB: 3uvd_A 2h60_A Back     alignment and structure
>3hme_A Bromodomain-containing protein 9; BRD9, bromodomain containing 9 isoform 1, LAVS3040, rhabdomyosarcoma antigen MU-RMS-40.8; 2.23A {Homo sapiens} Back     alignment and structure
>3ljw_A Protein polybromo-1; alpha helix, alternative splicing, bromodomain, chromatin RE DNA-binding, nucleus, phosphoprotein, transcription; 1.50A {Homo sapiens} PDB: 2ktb_B* 3hmf_A Back     alignment and structure
>3rcw_A Bromodomain-containing protein 1; transcription, structural genomics, structural consortium, SGC; 2.21A {Homo sapiens} Back     alignment and structure
>3hme_A Bromodomain-containing protein 9; BRD9, bromodomain containing 9 isoform 1, LAVS3040, rhabdomyosarcoma antigen MU-RMS-40.8; 2.23A {Homo sapiens} Back     alignment and structure
>3mqm_A Probable histone-lysine N-methyltransferase ASH1L; KIAA1420, absent small and homeotic disks prote homolog, lysine N-methyltransferase 2H, KMT2H; 2.54A {Homo sapiens} Back     alignment and structure
>3rcw_A Bromodomain-containing protein 1; transcription, structural genomics, structural consortium, SGC; 2.21A {Homo sapiens} Back     alignment and structure
>3uv4_A Second bromodomain of human transcription initiat TFIID subunit 1 (TAF1); structural genomics consortium, SGC; 1.89A {Homo sapiens} PDB: 3hmh_A Back     alignment and structure
>2jns_A Bromodomain-containing protein 4; ET-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>3iu5_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; 1.63A {Homo sapiens} Back     alignment and structure
>3k2j_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo01D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.20A {Homo sapiens} Back     alignment and structure
>3uv4_A Second bromodomain of human transcription initiat TFIID subunit 1 (TAF1); structural genomics consortium, SGC; 1.89A {Homo sapiens} PDB: 3hmh_A Back     alignment and structure
>3tlp_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.13A {Homo sapiens} Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Back     alignment and structure
>3dai_A ATPase family AAA domain-containing protein 2; ancca, AAA+ nuclear coregulator cancer-associated Pro2000 protein, two AAA DOMA containing protein; 1.95A {Homo sapiens} PDB: 3lxj_A Back     alignment and structure
>3tlp_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.13A {Homo sapiens} Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>3dai_A ATPase family AAA domain-containing protein 2; ancca, AAA+ nuclear coregulator cancer-associated Pro2000 protein, two AAA DOMA containing protein; 1.95A {Homo sapiens} PDB: 3lxj_A Back     alignment and structure
>2dkw_A Hypothetical protein KIAA1240; bromodomain-like, five-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Back     alignment and structure
>2dkw_A Hypothetical protein KIAA1240; bromodomain-like, five-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure
>3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Back     alignment and structure
>3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Back     alignment and structure
>2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Back     alignment and structure
>2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Back     alignment and structure
>3iu6_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; HET: OCS; 1.79A {Homo sapiens} Back     alignment and structure
>3iu6_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; HET: OCS; 1.79A {Homo sapiens} Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Back     alignment and structure
>2lm0_A AF4/FMR2 family member 1/protein AF-9 chimera; intrinsically disordered, nuclear protein; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 779
d1e6ia_111 a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces c 7e-32
d1e6ia_111 a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces c 3e-29
d3dwya1114 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP { 1e-31
d3dwya1114 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP { 6e-30
d3d7ca1102 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [T 1e-30
d3d7ca1102 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [T 1e-27
d1eqfa1139 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain 4e-30
d1eqfa1139 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain 4e-28
d1eqfa2128 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain 1e-29
d1eqfa2128 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain 2e-29
d1wuma1118 a.29.2.1 (A:715-832) P300/CAF histone acetyltransf 5e-29
d1wuma1118 a.29.2.1 (A:715-832) P300/CAF histone acetyltransf 1e-24
>d1e6ia_ a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 111 Back     information, alignment and structure

class: All alpha proteins
fold: Bromodomain-like
superfamily: Bromodomain
family: Bromodomain
domain: GCN5
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
 Score =  117 bits (295), Expect = 7e-32
 Identities = 37/111 (33%), Positives = 61/111 (54%), Gaps = 5/111 (4%)

Query: 373 WYKYCSEIIAELFHKKHQNYAWPFYTPVDVEKLGLTDYFDIIKKPMDLGTVRKKMRNRTY 432
                  I+ EL +      AWPF  PV+ E++   DY+D IK+PMDL T+  K+ +  Y
Sbjct: 4   HDAAIQNILTELQNHAA---AWPFLQPVNKEEV--PDYYDFIKEPMDLSTMEIKLESNKY 58

Query: 433 KTAKEFADDVRLIFSNCYKYNPPDHNVVTMARQLSAVFEDRFAKMPDESNL 483
           +  ++F  D RL+F+NC  YN  + +    A +L   F ++  ++P+ S+L
Sbjct: 59  QKMEDFIYDARLVFNNCRMYNGENTSYYKYANRLEKFFNNKVKEIPEYSHL 109


>d1e6ia_ a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 111 Back     information, alignment and structure
>d3dwya1 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d3dwya1 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d3d7ca1 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d3d7ca1 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1eqfa1 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Length = 139 Back     information, alignment and structure
>d1eqfa1 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Length = 139 Back     information, alignment and structure
>d1eqfa2 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1eqfa2 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1wuma1 a.29.2.1 (A:715-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d1wuma1 a.29.2.1 (A:715-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query779
d3d7ca1102 GCN5 {Human (Homo sapiens) [TaxId: 9606]} 99.93
d1e6ia_111 GCN5 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.92
d1e6ia_111 GCN5 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.92
d3d7ca1102 GCN5 {Human (Homo sapiens) [TaxId: 9606]} 99.92
d3dwya1114 CREB-binding protein, CBP {Human (Homo sapiens) [T 99.92
d3dwya1114 CREB-binding protein, CBP {Human (Homo sapiens) [T 99.92
d1wuma1118 P300/CAF histone acetyltransferase bromodomain {Hu 99.92
d1eqfa1139 TAFII250 double bromodomain module {Human (Homo sa 99.92
d1eqfa2128 TAFII250 double bromodomain module {Human (Homo sa 99.91
d1eqfa2128 TAFII250 double bromodomain module {Human (Homo sa 99.9
d1wuma1118 P300/CAF histone acetyltransferase bromodomain {Hu 99.9
d1eqfa1139 TAFII250 double bromodomain module {Human (Homo sa 99.9
>d3d7ca1 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Bromodomain-like
superfamily: Bromodomain
family: Bromodomain
domain: GCN5
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.93  E-value=3.9e-26  Score=204.64  Aligned_cols=101  Identities=38%  Similarity=0.686  Sum_probs=97.2

Q ss_pred             HHHHHHHHHHHHHHHcCCCCCCCCCCCCccccCCCCchhhcCCCCCHHHHHHHhhcCCCCCHHHHHHHHHHHhhhhhhhC
Q psy14234        123 NQLQYIVKNVMKAVWKHPHAWPFHEPVDAINLNLPDYHKVITQPMDLGTIKKRLENNYYWSGKEAIQDFTTMFTNCYVYN  202 (779)
Q Consensus       123 ~~l~~~~~~il~~L~~~~~s~pF~~PVd~~~~~~PdYy~iIk~PmDL~tIk~kL~~~~Y~s~~ef~~D~~lmf~Na~~yN  202 (779)
                      ++|...|..||..|++|+.++||+.||++.  ++||||.+|++||||+||++||++|.|.++.+|+.||+|||.||++||
T Consensus         1 d~L~~~l~~il~~l~~~~~s~~F~~pv~~~--~~pdY~~~I~~PmdL~tI~~kl~~~~Y~s~~~f~~D~~li~~Na~~yN   78 (102)
T d3d7ca1           1 DQLYTTLKNLLAQIKSHPSAWPFMEPVKKS--EAPDYYEVIRFPIDLKTMTERLRSRYYVTRKLFVADLQRVIANCREYN   78 (102)
T ss_dssp             HHHHHHHHHHHHHHHHSGGGGGGSSCCCTT--TSTTHHHHCSSCCCHHHHHHHHHTTCCCSHHHHHHHHHHHHHHHHHHS
T ss_pred             ChHHHHHHHHHHHHHhCCCCCccCCCCChh--hCcCHHHHcCCccCHHHHHHHhccCccCCHHHHHHHHHHHHHHHHHHC
Confidence            478899999999999999999999999965  799999999999999999999999999999999999999999999999


Q ss_pred             CCCCHHHHHHHHHHHHHHHHHhC
Q psy14234        203 KPGEDVVLMAQNLEQLFLTKITG  225 (779)
Q Consensus       203 ~~~s~i~~~A~~Le~~f~~~~~~  225 (779)
                      +++|.++.+|..|+++|.++|++
T Consensus        79 ~~~s~~~~~A~~l~~~f~~~~ke  101 (102)
T d3d7ca1          79 PPDSEYCRCASALEKFFYFKLKE  101 (102)
T ss_dssp             CTTSHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCCHHHHHHHHHHHHHHHHHhc
Confidence            99999999999999999999874



>d1e6ia_ a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e6ia_ a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3d7ca1 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dwya1 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dwya1 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wuma1 a.29.2.1 (A:715-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eqfa1 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eqfa2 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eqfa2 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wuma1 a.29.2.1 (A:715-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eqfa1 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure