Psyllid ID: psy14257


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-
MTCIIAYWKCDGDEDCKDGSDELAEHCQDRKCDESHFTCNETLRCIPLAWACDGQPDCGLNDTSDEDHCVNDCTDWSDETNCTHSGNRTISAPACEPHEFDCQDVLRTCIPKALVCDGEPACFNGEDEMFCDEKQCLRSDCHHDCYNTPEGFMCVCPRDMYLQPDLITCSYLHPCEAWGTCSQDCEPSVSNNSYKCTCHAGYELEPDMFTCKSKSKNDSSPFVIFSNRHELRGVDLRTFNVIALISSLKNTIALDFYYTPTANMVFWTDVIDDKIYNATLIGNSLSNIDVVVQTGLSTAEGLAVDWIGKNLYMFWAFWSLSPSNSSDGGIEKAGMHGENRSPLVTKNIQWPSSLVIDYNQDILYWCDSHLNTVESVRVDGSERTVSFNLEVLGSDSRVGIPNCRPEDNLWIGKNLYWVESNLDQIEVAKLSGQFRRTLIAGDMESPRAIALDPRFGLLFWTDWDSKAPRIERCSMSGEHRSVIVRVDLLTSRGAWPNGLTLDYQLTRIYWIDAKSDSIHTVTYDGKDHHVVLSNHDSLTHPFAIALFENHVYWTDWRTNSVIRANKWNGSDVTLIQRTLTQPFIYVNGVVKKSPCEMNNGNCSHLCLIGMNGTYKCQCPHVMKLMSDNKTCQVADSQFIIFSRPREIRGVDLEHPYYHTIPTISIPQVFSPNNLNFDAANKKIYWTDQEYNEVKRSSIVGGQIQLVVDAVFEFYLTPLSKRSSIVGGQIQLVVDAGISHPSGLAIDWIAQNMFIAVSSPTQSKIVVCNLEGEYQTTILSNESNDTSTLSKISSIAVWPVKGKMFWSNVTKQVVTIEMAFMDGTKRETVVSQKKYPAVTGVS
cEEEccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccEEcccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccEEEccccccccccccccccEEEccccccEEEEccEEcccccEEEEEEcccccEEEcccccccccccEEEEccccccccEEEEEcccccEEEEcccccccccccccccEEEEccccccccEEEEccccccEEEEEEccccEEEEEEccccEEEEEEEcccccEEEEEEEEEccccccccccccccccccccccEEEEEccccEEEEEEcccccEEEEEccccccccEEEEEcccccEEEEEcccccccEEEEEccccccEEEEEcccccccccccEEEEEEccccEEEEEEcccccEEEEEcccccEEEEEEccccccccEEEEEEccEEEEEEccccEEEEEEccccccEEEEcccccccEEEEEcccccccccccccccccccccccccccccccccccEEccccccEEEcccEEEEEEccccEEEEEccccccccccccccccccccEEEEEEccccEEEEEEccccEEEEEEEccccEEEEEEEEEEEEcccccccccccccEEEEEEEcccccccEEEEEcccccEEEEEccccccEEEEEEcccccEEEEEcccccccccccccEEEEEEccccEEEEEEccccccEEEEEEccccccEEEEEccccccEEEcc
cccccccEEEcccccccccccccccccccccccccccEEcccccEccccEEcccccccccccccccccccccccccccccccccccccccccccccccccEccccccEEccccEEccccccccccccccccccccccccccccccEEcccccEEccccccccccccccccccccccccccccccccccccccccccccccccEccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccEEEEcccccccccEEEccccccEEEcccccEEEEEEccccEEEEEEcccccEEEEEcccccccEEEEEcccccEEEEEEcccccEEEEEccccccEEEEEEEEEcccccccccccccEEEEEcccEEEEEEccccEEEEEEccccccEEEEccccccEEEEEEEccccEEEEEEccccccEEEEEEccccccEEEEccccEcccccccccEEEEccccEEEEEEccccEEEEEEcccccEEEEEEccccccccEEEEEEccEEEEEEccccEEEEEEccccccEEEEEccccccccEEEEEcccccccccccccccEEEccccccEEEEcccccEEcccccEEccccccEEEEEccccEEEEccccccccccEEEEccccccEEEEEEEccccEEEEEEccccEEEEEEEcccccEEEEccccccccccccEEEccccccEEEEEEcccccccEEEEEEccccEEEEEccccccEEEEEEEcccEEEEEEEcccccccccccccEEEEcccccEEEEEcccccccHHHEEcccccccEEEEEccccccccccc
MTCIIAywkcdgdedckdgsDELAehcqdrkcdeshftcnetlrciplawacdgqpdcglndtsdedhcvndctdwsdetncthsgnrtisapacephefdcqDVLRtcipkalvcdgepacfngedemfcdekqclrsdchhdcyntpegfmcvcprdmylqpdlitcsylhpceawgtcsqdcepsvsnnsykctchagyelepdmftckskskndsspfvifsnrhelrgvdlrTFNVIALISSLKNTIaldfyytptanmvFWTDVIDDKIYNATLIGNSLSNIDVVVQTGLSTAEGLAVDWIGKNLYMFWAFwslspsnssdggiekagmhgenrsplvtkniqwpsslvidynQDILYWCDSHLNTVEsvrvdgsertVSFNLEvlgsdsrvgipncrpednlwigknLYWVESNLDQIEVAKLSGQFRRTLiagdmespraialdprfgllfwtdwdskapriercsmsgehrSVIVRVDLltsrgawpngltldyqLTRIYwidaksdsihtvtydgkdhhvvlsnhdslthPFAIALFENhvywtdwrtnsvirankwngsdvTLIQRTLtqpfiyvngvvkkspcemnngncshlcligmngtykcqcphvmklmsdnktcqvadSQFIifsrpreirgvdlehpyyhtiptisipqvfspnnlnfdaankkiywtdqeynevkrssivggQIQLVVDAVFEFYltplskrssivggQIQLVVDagishpsglaIDWIAQNMFiavssptqsKIVVCNlegeyqttilsnesndtstlskissiavwpvkgkmfWSNVTKQVVTIEMAFMDGTKRETVVsqkkypavtgvs
MTCIIAywkcdgdedCKDGSDELAEHCQDRKCDESHFTCNETLRCIPLAWACDGQPDCGLNDTSDEDHCVNDCTDWSDETNCTHSGNRTISAPACEPHEFDCQDVLRTCIPKALVCDGEPACFNGEDEMFCDEKQCLRSDCHHDCYNTPEGFMCVCPRDMYLQPDLITCSYLHPCEAWGTCSQDCEPSVSNNSYKCTCHAGYELEPDMFTCKSKSKNDSSPFVIFsnrhelrgvDLRTFNVIALISSLKNTIALDFYYTPTANMVFWTDVIDDKIYNATLIGNSLSNIDVVVQTGLSTAEGLAVDWIGKNLYMFWAFWSLSPSNSSDGGIEKAGMHGENRSPLVTKNIQWPSSLVIDYNQDILYWCDSHLNTVESVRVDGSERTVSFNlevlgsdsrvgipncRPEDNLWIGKNLYWVESNLDQIEVAKLSGQFRRTLIAGDMESPRAIALDPRFGLLFWTDWDSKAPRiercsmsgehrsvIVRVDlltsrgawpngltldYQLTRIYWIDAKSDSIHTVTYDGKDHHVVLSNHDSLTHPFAIALFENHVYWTDWRTNSVIRANKWNGSDVTLIQRTLTQPFIYVNGVVKKSPCEMNNGNCSHLCLIGMNGTYKCQCPHVMKLMSDNKTCQVADSQFIIFSRPREIRGVDLEHPYYHTIPtisipqvfspNNLNFDAANKKIYWTDQEYNEVKRSSIVGGQIQLVVDAVFEFYLTPLSKRSSIVGGQIQLVVDAGISHPSGLAIDWIAQNMFIAVSSPTQSKIVVCNLEGEYQTTIlsnesndtstlSKISSIAVWPVKGKMFWSNVTKQVVTIEMAfmdgtkretvvsqkkypavtgvs
MTCIIAYWKCDGDEDCKDGSDELAEHCQDRKCDESHFTCNETLRCIPLAWACDGQPDCGLNDTSDEDHCVNDCTDWSDETNCTHSGNRTISAPACEPHEFDCQDVLRTCIPKALVCDGEPACFNGEDEMFCDEKQCLRSDCHHDCYNTPEGFMCVCPRDMYLQPDLITCSYLHPCEAWGTCSQDCEPSVSNNSYKCTCHAGYELEPDMFTCKSKSKNDSSPFVIFSNRHELRGVDLRTFNVIALISSLKNTIALDFYYTPTANMVFWTDVIDDKIYNATLIGNSLSNIDVVVQTGLSTAEGLAVDWIGKNLYMFWAFWSLSPSNSSDGGIEKAGMHGENRSPLVTKNIQWPSSLVIDYNQDILYWCDSHLNTVESVRVDGSERTVSFNLEVLGSDSRVGIPNCRPEDNLWIGKNLYWVESNLDQIEVAKLSGQFRRTLIAGDMESPRAIALDPRFGLLFWTDWDSKAPRIERCSMSGEHRSVIVRVDLLTSRGAWPNGLTLDYQLTRIYWIDAKSDSIHTVTYDGKDHHVVLSNHDSLTHPFAIALFENHVYWTDWRTNSVIRANKWNGSDVTLIQRTLTQPFIYVNGVVKKSPCEMNNGNCSHLCLIGMNGTYKCQCPHVMKLMSDNKTCQVADSQFIIFSRPREIRGVDLEHPYYHTIPTISIPQVFSPNNLNFDAANKKIYWTDQEYNEVKRSSIVGGQIQLVVDAVFEFYLTPLSKRSSIVGGQIQLVVDAGISHPSGLAIDWIAQNMFIAVSSPTQSKIVVCNLEGEYQTTILSNESNDTSTLSKISSIAVWPVKGKMFWSNVTKQVVTIEMAFMDGTKRETVVSQKKYPAVTGVS
**CIIAYWKCDGDEDCK*****LAEHCQDRKCDESHFTCNETLRCIPLAWACDGQPDCGLNDTSDEDHCVNDCTDWSDETNCTHSGNRTISAPACEPHEFDCQDVLRTCIPKALVCDGEPACFNGEDEMFCDEKQCLRSDCHHDCYNTPEGFMCVCPRDMYLQPDLITCSYLHPCEAWGTCSQDCEPSVSNNSYKCTCHAGYELEPDMFTC*********PFVIFSNRHELRGVDLRTFNVIALISSLKNTIALDFYYTPTANMVFWTDVIDDKIYNATLIGNSLSNIDVVVQTGLSTAEGLAVDWIGKNLYMFWAFWSL**********************LVTKNIQWPSSLVIDYNQDILYWCDSHLNTVESVRVDGSERTVSFNLEVLGSDSRVGIPNCRPEDNLWIGKNLYWVESNLDQIEVAKLSGQFRRTLIAGDMESPRAIALDPRFGLLFWTDWDSKAPRIERCSMSGEHRSVIVRVDLLTSRGAWPNGLTLDYQLTRIYWIDAKSDSIHTVTYDGKDHHVVLSNHDSLTHPFAIALFENHVYWTDWRTNSVIRANKWNGSDVTLIQRTLTQPFIYVNGVVKKSPCEMNNGNCSHLCLIGMNGTYKCQCPHVMKLMSDNKTCQVADSQFIIFSRPREIRGVDLEHPYYHTIPTISIPQVFSPNNLNFDAANKKIYWTDQEYNEVKRSSIVGGQIQLVVDAVFEFYLTPLSKRSSIVGGQIQLVVDAGISHPSGLAIDWIAQNMFIAVSSPTQSKIVVCNLEGEYQTTILSN******TLSKISSIAVWPVKGKMFWSNVTKQVVTIEMAFMDGT******************
MTCIIAYWKCDGDEDCKDGSDELAEHCQDRKCDESHFTCNETLRCIPLAWACDGQPDCGLNDTSDEDHCVNDCTDWSDETNCTHSGNRTISAPACEPHEFDCQDVLRTCIPKALVCDGEPACFNGEDEMFCDEKQCLRSDCHHDCYNTPEGFMCVCPRDMYLQPDLITCSYLHPCEAWGTCSQDCEPSVSNNSYKCTCHAGYELEPDMFTCKSKSKNDSSPFVIFSNRHELRGVDLRTFNVIALISSLKNTIALDFYYTPTANMVFWTDVIDDKIYNATLIGNSLSNIDVVVQTGLSTAEGLAVDWIGKNLYMFWAFWSLSPSNSSDGGIEKAGMHGENRSPLVTKNIQWPSSLVIDYNQDILYWCDSHLNTVESVRV***********EVLGSDSRVGIPNCRPEDNLWIGKNLYWVESNLDQIEVAKLSGQFRRTLIAGDMESPRAIALDPRFGLLFWTDWDSKAPRIERCSMSGEHRSVIVRVDLLTSRGAWPNGLTLDYQLTRIYWIDAKSDSIHTVTYDGKDHHVVLSNHDSLTHPFAIALFENHVYWTDWRTNSVIRANKWNGSDVTLIQRTLTQPFIYVNGVVKKSPCEMNNGNCSHLCLIGMNGTYKCQCPHVMKLMSDNKTCQVADSQFIIFSRPREIRGVDLEHPYYHTIPTISIPQVFSPNNLNFDAANKKIYWTDQEYNEVKRSSIVGGQIQLVVDAVFEFYLTPLSKRSSIVGGQIQLVVDAGISHPSGLAIDWIAQNMFIAVSSPTQSKIVVCNLEGEYQTTILSNESNDTSTLSKISSIAVWPVKGKMFWSNVTKQVVTIEMAFMDGTKRETVVSQKKYPAVTGVS
MTCIIAYWKCDGDEDCKDGSDELAEHCQDRKCDESHFTCNETLRCIPLAWACDGQPDCGLNDTSDEDHCVNDCTDWSDETNCTHSGNRTISAPACEPHEFDCQDVLRTCIPKALVCDGEPACFNGEDEMFCDEKQCLRSDCHHDCYNTPEGFMCVCPRDMYLQPDLITCSYLHPCEAWGTCSQDCEPSVSNNSYKCTCHAGYELEPDMFTCKSKSKNDSSPFVIFSNRHELRGVDLRTFNVIALISSLKNTIALDFYYTPTANMVFWTDVIDDKIYNATLIGNSLSNIDVVVQTGLSTAEGLAVDWIGKNLYMFWAFWSLSPSNSSDGGIEKAGMHGENRSPLVTKNIQWPSSLVIDYNQDILYWCDSHLNTVESVRVDGSERTVSFNLEVLGSDSRVGIPNCRPEDNLWIGKNLYWVESNLDQIEVAKLSGQFRRTLIAGDMESPRAIALDPRFGLLFWTDWDSKAPRIERCSMSGEHRSVIVRVDLLTSRGAWPNGLTLDYQLTRIYWIDAKSDSIHTVTYDGKDHHVVLSNHDSLTHPFAIALFENHVYWTDWRTNSVIRANKWNGSDVTLIQRTLTQPFIYVNGVVKKSPCEMNNGNCSHLCLIGMNGTYKCQCPHVMKLMSDNKTCQVADSQFIIFSRPREIRGVDLEHPYYHTIPTISIPQVFSPNNLNFDAANKKIYWTDQEYNEVKRSSIVGGQIQLVVDAVFEFYLTPLSKRSSIVGGQIQLVVDAGISHPSGLAIDWIAQNMFIAVSSPTQSKIVVCNLEGEYQTTILSNESNDTSTLSKISSIAVWPVKGKMFWSNVTKQVVTIEMAFMDGTKRETVVSQKKYPAVTGVS
MTCIIAYWKCDGDEDCKDGSDELAEHCQDRKCDESHFTCNETLRCIPLAWACDGQPDCGLNDTSDEDHCVNDCTDWSDETNCTHSGNRTISAPACEPHEFDCQDVLRTCIPKALVCDGEPACFNGEDEMFCDEKQCLRSDCHHDCYNTPEGFMCVCPRDMYLQPDLITCSYLHPCEAWGTCSQDCEPSVSNNSYKCTCHAGYELEPDMFTCKSKSKNDSSPFVIFSNRHELRGVDLRTFNVIALISSLKNTIALDFYYTPTANMVFWTDVIDDKIYNATLIGNSLSNIDVVVQTGLSTAEGLAVDWIGKNLYMFWAFWSLSPSNSSDGGIEKAGMHGENRSPLVTKNIQWPSSLVIDYNQDILYWCDSHLNTVESVRVDGSERTVSFNLEVLGSDSRVGIPNCRPEDNLWIGKNLYWVESNLDQIEVAKLSGQFRRTLIAGDMESPRAIALDPRFGLLFWTDWDSKAPRIERCSMSGEHRSVIVRVDLLTSRGAWPNGLTLDYQLTRIYWIDAKSDSIHTVTYDGKDHHVVLSNHDSLTHPFAIALFENHVYWTDWRTNSVIRANKWNGSDVTLIQRTLTQPFIYVNGVVKKSPCEMNNGNCSHLCLIGMNGTYKCQCPHVMKLMSDNKTCQVADSQFIIFSRPREIRGVDLEHPYYHTIPTISIPQVFSPNNLNFDAANKKIYWTDQEYNEVKRSSIVGGQIQLVVDAVFEFYLTPLSKRSSIVGGQIQLVVDAGISHPSGLAIDWIAQNMFIAVSSPTQSKIVVCNLEGEYQTTILSNESNDTSTLSKISSIAVWPVKGKMFWSNVTKQVVTIEMAFMDGTKRETVVSQKKYPAVTGVS
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTCIIAYWKCDGDEDCKDGSDELAEHCQDRKCDESHFTCNETLRCIPLAWACDGQPDCGLNDTSDEDHCVNDCTDWSDETNCTHSGNRTISAPACEPHEFDCQDVLRTCIPKALVCDGEPACFNGEDEMFCDEKQCLRSDCHHDCYNTPEGFMCVCPRDMYLQPDLITCSYLHPCEAWGTCSQDCEPSVSNNSYKCTCHAGYELEPDMFTCKSKSKNDSSPFVIFSNRHELRGVDLRTFNVIALISSLKNTIALDFYYTPTANMVFWTDVIDDKIYNATLIGNSLSNIDVVVQTGLSTAEGLAVDWIGKNLYMFWAFWSLSPSNSSDGGIEKAGMHGENRSPLVTKNIQWPSSLVIDYNQDILYWCDSHLNTVESVRVDGSERTVSFNLEVLGSDSRVGIPNCRPEDNLWIGKNLYWVESNLDQIEVAKLSGQFRRTLIAGDMESPRAIALDPRFGLLFWTDWDSKAPRIERCSMSGEHRSVIVRVDLLTSRGAWPNGLTLDYQLTRIYWIDAKSDSIHTVTYDGKDHHVVLSNHDSLTHPFAIALFENHVYWTDWRTNSVIRANKWNGSDVTLIQRTLTQPFIYVNGVVKKSPCEMNNGNCSHLCLIGMNGTYKCQCPHVMKLMSDNKTCQVADSQFIIFSRPREIRGVDLEHPYYHTIPTISIPQVFSPNNLNFDAANKKIYWTDQEYNEVKRSSIVGGQIQLVVDAVFEFYLTPLSKRSSIVGGQIQLVVDAGISHPSGLAIDWIAQNMFIAVSSPTQSKIVVCNLEGEYQTTILSNESNDTSTLSKISSIAVWPVKGKMFWSNVTKQVVTIEMAFMDGTKRETVVSQKKYPAVTGVS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query841 2.2.26 [Sep-21-2011]
Q9NZR2 4599 Low-density lipoprotein r yes N/A 0.828 0.151 0.332 1e-109
Q07954 4544 Prolow-density lipoprotei no N/A 0.545 0.101 0.393 1e-101
Q91ZX7 4545 Prolow-density lipoprotei yes N/A 0.545 0.100 0.393 1e-100
P98157 4543 Low-density lipoprotein r yes N/A 0.545 0.101 0.387 1e-99
Q9JI18 4599 Low-density lipoprotein r no N/A 0.545 0.099 0.385 1e-96
O88572 1613 Low-density lipoprotein r no N/A 0.526 0.274 0.313 1e-70
O75581 1613 Low-density lipoprotein r no N/A 0.526 0.274 0.305 5e-69
O75197 1615 Low-density lipoprotein r no N/A 0.502 0.261 0.314 5e-65
Q91VN0 1614 Low-density lipoprotein r no N/A 0.502 0.262 0.309 8e-64
O75096 1905 Low-density lipoprotein r no N/A 0.495 0.218 0.286 9e-62
>sp|Q9NZR2|LRP1B_HUMAN Low-density lipoprotein receptor-related protein 1B OS=Homo sapiens GN=LRP1B PE=1 SV=2 Back     alignment and function desciption
 Score =  396 bits (1017), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 284/854 (33%), Positives = 414/854 (48%), Gaps = 157/854 (18%)

Query: 3    CIIAYWKCDGDEDCKDGSDELAEHCQDRK------CDESHFTCNETLRCIPLAWACDGQP 56
            CI  +W CDGD DC D SDE   +C   +      C+ + F C+    C+P  W CDG+ 
Sbjct: 1018 CIPGHWACDGDNDCGDFSDEAQINCTKEEIHSPAGCNGNEFQCHPDGNCVPDLWRCDGE- 1076

Query: 57   DCGLNDTSDEDHCVNDCTDWSDETNCTHSGNRTISAPACEPHEFDCQDVLRTCIPKALVC 116
                           DC D SDE  C    N TI        +F C    R CI KA VC
Sbjct: 1077 --------------KDCEDGSDEKGC----NGTIRLCD-HKTKFSCWSTGR-CINKAWVC 1116

Query: 117  DGEPACFNGEDEMFCDEKQCLRSDCHHDCYNTPEGFMCVCPRDMYLQ----PDLITCSYL 172
            DG+  C +  DE  CD   C      H C N  +  +C+ P  +       PD     YL
Sbjct: 1117 DGDIDCEDQSDEDDCDSFLCGPP--KHPCAN--DTSVCLQPEKLCNGKKDCPDGSDEGYL 1172

Query: 173  HPCEAW----GTCSQDCEPSVSNNSYKCTCHAGYELEPDMFTCKSKSKNDSSPFVIFSNR 228
              C+      G CS  C   V      C+C  G +L  D         N +   V + + 
Sbjct: 1173 --CDECSLNNGGCSNHCS-VVPGRGIVCSCPEGLQLNKD---------NKTCEIVDYCSN 1220

Query: 229  HELRGVDLRTFNVIALISSLKNTIALDFYYTPTANMVFWTDVIDDKIYNATLIGNSLSNI 288
            H              +    K+T+    Y         W   +D         G S +++
Sbjct: 1221 H---------LKCSQVCEQHKHTVKCSCYEG-------WKLDVD---------GESCTSV 1255

Query: 289  DVVVQTGLSTAEGLAVDWIGKNLYMFWAFWSLSPSNSSDGGIEKAGMHGENRSPLVTKNI 348
            D                        F AF   S  +     I +  +H  + S LV   +
Sbjct: 1256 DP-----------------------FEAFIIFSIRHE----IRRIDLHKRDYSLLV-PGL 1287

Query: 349  QWPSSLVIDYNQDILYWCDSHLNTVESVRVDGSERTVSFNLEVLGSDSRVGIPNCRPEDN 408
            +   +L   +NQ +LYW D   + +   ++  S    +  + V   +  +  P     D 
Sbjct: 1288 RNTIALDFHFNQSLLYWTDVVEDRIYRGKLSESGGVSAIEVVV---EHGLATPEGLTVD- 1343

Query: 409  LWIGKNLYWVESNLDQIEVAKLSGQFRRTLIAGDMESPRAIALDPRFGLLFWTDWDSKAP 468
             WI  N+YW++SNLDQIEVAKL G  R TLIAG ME PRAIALDPR+G+LFWTDWD+  P
Sbjct: 1344 -WIAGNIYWIDSNLDQIEVAKLDGSLRTTLIAGAMEHPRAIALDPRYGILFWTDWDANFP 1402

Query: 469  RIERCSMSGEHRSVIVRVDLLTSRGAWPNGLTLDYQLTRIYWIDAKSDSIHTVTYDGKDH 528
            RIE  SMSG  R  I + D+ T  GAWPNGLT+D+   RI W DA+SD+I++  YDG + 
Sbjct: 1403 RIESASMSGAGRKTIYK-DMKT--GAWPNGLTVDHFEKRIVWTDARSDAIYSALYDGTNM 1459

Query: 529  HVVLSNHDSLTHPFAIALFENHVYWTDWRTNSVIRANKWNGSDVTLIQRTLTQPF---IY 585
              ++  H+ L+HPFA++L+ + VYWTDWRTN++ +ANKW G +V++IQ+T  QPF   IY
Sbjct: 1460 IEIIRGHEYLSHPFAVSLYGSEVYWTDWRTNTLSKANKWTGQNVSVIQKTSAQPFDLQIY 1519

Query: 586  VNGVVKKS--PCEMNNGN--CSHLCLIGMNGTYKCQCPHVMKLMSDNKTCQVADSQFIIF 641
                  ++  PC  N+G   CSH+CLI  N +  C CPH+MKL SD KTC     +F+++
Sbjct: 1520 HPSRQPQAPNPCAANDGKGPCSHMCLINHNRSAACACPHLMKLSSDKKTCYEM-KKFLLY 1578

Query: 642  SRPREIRGVDLEHPYYHTIPTISIPQVFSPNNLNFDAANKKIYWTDQEYNEVKRSSIVGG 701
            +R  EIRGVD+++PY++ I   ++P +     ++FDA+ +++YWTD     +K  +I   
Sbjct: 1579 ARRSEIRGVDIDNPYFNFITAFTVPDIDDVTVIDFDASEERLYWTD-----IKTQTI--- 1630

Query: 702  QIQLVVDAVFEFYLTPLSKRSSIVGGQIQLVVDAGISHPSGLAIDWIAQNMFIAVSSPTQ 761
                              KR+ I G  ++ V+   I    GLA+DW+++N++   S   +
Sbjct: 1631 ------------------KRAFINGTGLETVISRDIQSIRGLAVDWVSRNLYWISSEFDE 1672

Query: 762  SKIVVCNLEGEYQTTILSNESNDTSTLSKISSIAVWPVKGKMFWSNVTKQVVTIEMAFMD 821
            ++I V  L+G  +T+I+         + K   +A  PV+GK++W++      TI MA MD
Sbjct: 1673 TQINVARLDGSLKTSIIHG-------IDKPQCLAAHPVRGKLYWTDGN----TINMANMD 1721

Query: 822  GTKRETVVSQKKYP 835
            G+  + +   +K P
Sbjct: 1722 GSNSKILFQNQKEP 1735




Potential cell surface proteins that bind and internalize ligands in the process of receptor-mediated endocytosis.
Homo sapiens (taxid: 9606)
>sp|Q07954|LRP1_HUMAN Prolow-density lipoprotein receptor-related protein 1 OS=Homo sapiens GN=LRP1 PE=1 SV=2 Back     alignment and function description
>sp|Q91ZX7|LRP1_MOUSE Prolow-density lipoprotein receptor-related protein 1 OS=Mus musculus GN=Lrp1 PE=1 SV=1 Back     alignment and function description
>sp|P98157|LRP1_CHICK Low-density lipoprotein receptor-related protein 1 OS=Gallus gallus GN=LRP1 PE=2 SV=1 Back     alignment and function description
>sp|Q9JI18|LRP1B_MOUSE Low-density lipoprotein receptor-related protein 1B OS=Mus musculus GN=Lrp1b PE=2 SV=1 Back     alignment and function description
>sp|O88572|LRP6_MOUSE Low-density lipoprotein receptor-related protein 6 OS=Mus musculus GN=Lrp6 PE=1 SV=1 Back     alignment and function description
>sp|O75581|LRP6_HUMAN Low-density lipoprotein receptor-related protein 6 OS=Homo sapiens GN=LRP6 PE=1 SV=2 Back     alignment and function description
>sp|O75197|LRP5_HUMAN Low-density lipoprotein receptor-related protein 5 OS=Homo sapiens GN=LRP5 PE=1 SV=2 Back     alignment and function description
>sp|Q91VN0|LRP5_MOUSE Low-density lipoprotein receptor-related protein 5 OS=Mus musculus GN=Lrp5 PE=1 SV=3 Back     alignment and function description
>sp|O75096|LRP4_HUMAN Low-density lipoprotein receptor-related protein 4 OS=Homo sapiens GN=LRP4 PE=1 SV=4 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query841
242018517 4603 low-density lipoprotein receptor, putati 0.824 0.150 0.367 1e-146
321462894 4592 hypothetical protein DAPPUDRAFT_307561 [ 0.542 0.099 0.495 1e-134
270010181 4576 hypothetical protein TcasGA2_TC009548 [T 0.524 0.096 0.489 1e-127
427796811 4696 Putative prolow-density lipoprotein rece 0.468 0.083 0.502 1e-126
427795113 3609 Putative prolow-density lipoprotein rece 0.468 0.109 0.502 1e-126
328702065 2150 PREDICTED: low-density lipoprotein recep 0.552 0.216 0.467 1e-125
195024691 4620 GH21081 [Drosophila grimshawi] gi|193901 0.819 0.149 0.359 1e-121
195381779 4618 GJ21697 [Drosophila virilis] gi|19414441 0.808 0.147 0.349 1e-121
195551463 1857 GD15368 [Drosophila simulans] gi|1942018 0.831 0.376 0.354 1e-121
195332400 4717 GM21016 [Drosophila sechellia] gi|194124 0.832 0.148 0.355 1e-121
>gi|242018517|ref|XP_002429721.1| low-density lipoprotein receptor, putative [Pediculus humanus corporis] gi|212514727|gb|EEB16983.1| low-density lipoprotein receptor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  525 bits (1351), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 330/898 (36%), Positives = 455/898 (50%), Gaps = 205/898 (22%)

Query: 3    CIIAYWKCDGDEDCKDGSDELAEHCQDRKCDESHFTCNETLRCIPLAWACDGQPDCGLND 62
            C+   + CDGD DC+DGSDE  + C +   + S   C     C+PL+  C+G  DC  +D
Sbjct: 852  CVPVEFVCDGDNDCRDGSDE--KSCGEICGNSSEIYCPAEGICLPLSKKCNGVIDC--SD 907

Query: 63   TSDEDHC--------------------------------------------VNDCTDWSD 78
             SDE  C                                             NDC D SD
Sbjct: 908  ESDEQKCENGGDQKSKTVNRPANGFAVFCSSHEFKCWNNIECVRKNFVCDGRNDCLDGSD 967

Query: 79   ETNCTH------SGNRTISAPACEPHEFDCQ-------DVLRTCIPKALVCDGEPACFNG 125
            E NCT       SG   I+ P   P  F+C+       D    CI  + +CD +  C +G
Sbjct: 968  EKNCTEIHNCTESGTCFITPPTPTP-SFECEQPSHRLCDNGTKCIKVSQLCDNKKDCSDG 1026

Query: 126  EDE-MFCDEKQC-LRSDCHHDCYNTPEGFMCVCPRDMYLQPDLITCSYLHPCEAWGTCSQ 183
             DE + C+E+ C   S C H C N P GF+C CP+ ++LQPD  TCS  HPCE+WG CSQ
Sbjct: 1027 SDEGLRCEEQLCSFTSHCSHYCQNAPNGFVCYCPKGLHLQPDSTTCSESHPCESWGVCSQ 1086

Query: 184  DCEPSVSNNSYKCTCHAGYELEPDMFTCKSKSKNDSSPFVIFSNRHELRGVDLRTFNVIA 243
             C P    N +KC C   + L+PD FTCKSK  + + P VIFSNRHELRGV+LR F V A
Sbjct: 1087 YCIPL--KNKHKCKCEDDHLLQPDGFTCKSK--DGAIPQVIFSNRHELRGVELRNFTVKA 1142

Query: 244  LISSLKNTIALDFYYTPTANMVFWTDVIDDKIYNATLIGNSLSNIDVVVQTGLSTAEGLA 303
            LISSLKNTIALDFY+T  A+M++WTDV+DDKIY  TLIG SL+NI+VVVQTGL+TAEGLA
Sbjct: 1143 LISSLKNTIALDFYHTKAADMIYWTDVVDDKIYRGTLIGGSLTNIEVVVQTGLATAEGLA 1202

Query: 304  VDWIGKNLYMFWAFWSLSPSNSSDGGIEKAGMHGENRSPLVTKNIQWPSSLVIDYNQDIL 363
            VDWIG+NLY  W   +L         IE A ++G  R  L+  ++  P ++ +D     L
Sbjct: 1203 VDWIGENLY--WVESNLDQ-------IEVAKLNGSFRKTLIAGDMDSPRAIALDPRDGYL 1253

Query: 364  YWC--DSHLNTVESVRVDGSERTVSFNLEVLGSDSRVGIPNCRPEDNLWIGKNLYWVESN 421
            +W   D+H   +E   + G+ R     ++ +   +    PN    D  ++ + +YW+++ 
Sbjct: 1254 FWSDWDAHAPRIERCSMSGTNRKRVLRVDQITDGA---WPNGLTLD--YVLRRIYWIDAR 1308

Query: 422  LDQIEVAKLSGQFRRTLIAGD--MESPRAIALDPRFGLLFWTDWDSKAPRIERCSMSGEH 479
             D I      G   + +I G   +  P AIA+   +  ++WTDW S +            
Sbjct: 1309 SDSIHTTTYDGLMHKEVIRGHETLSHPFAIAIFENY--VYWTDWRSNS------------ 1354

Query: 480  RSVIVRVDLLTSRGAWPNGLTLDYQLTRIYWIDAKSDSIHTVTYDGKDHHVVLSNHDSLT 539
               ++R +                                   ++G D H++     +LT
Sbjct: 1355 ---VIRAN----------------------------------KWNGSDLHII---QRTLT 1374

Query: 540  HPFAIALFENHVYWTDWRTNSVIRANKWNGSDVTLIQRTLTQPFIYVNGVVKKSPCEMNN 599
             PF I +                                   P      V + SPCE NN
Sbjct: 1375 QPFDIQIL---------------------------------HPSRQPRDVNRPSPCEKNN 1401

Query: 600  GNCSHLCLIGMNGTYKCQCPHVMKLMSDNKTCQVADSQFIIFSRPREIRGVDLEHPYYHT 659
            G CSHLCLI +N TY C CPHVM+L SDNKTC V + + ++FSR  EIRGVDL   YYHT
Sbjct: 1402 GGCSHLCLININNTYTCDCPHVMRLSSDNKTCIVVNERIVLFSRANEIRGVDLTSAYYHT 1461

Query: 660  IPTISIPQVFSPNNLNFDAANKKIYWTDQEYNEVKRSSIVGGQIQLVVDAVFEFYLTPLS 719
            IPTI++P   +P  ++FDAANKKIYW D + NEVK S+++                    
Sbjct: 1462 IPTINVPHAITPATIDFDAANKKIYWADVQMNEVKTSNLI-------------------- 1501

Query: 720  KRSSIVGGQIQLVVDAGISHPSGLAIDWIAQNMFIAVSSPTQSKIVVCNLEGEYQTTILS 779
                  GG  + ++D+GI HP+GLAIDWI+ N+F+  S   ++ I VCNL+GE+ T I  
Sbjct: 1502 ------GGPAETIIDSGIEHPNGLAIDWISGNLFVTSSGAGENHISVCNLKGEFITII-- 1553

Query: 780  NESNDTSTLSKISSIAVWPVKGKMFWSNVTKQVVTIEMAFMDGTKRETVVSQKKYPAV 837
                + S L ++ S+++ PV G ++WS+V   +  IE + MDG  R  +VSQ+  P++
Sbjct: 1554 ----NGSNLFQVRSLSLNPVNGTLYWSSVKNDLHIIEQSRMDGFDRVILVSQRDQPSL 1607




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|321462894|gb|EFX73914.1| hypothetical protein DAPPUDRAFT_307561 [Daphnia pulex] Back     alignment and taxonomy information
>gi|270010181|gb|EFA06629.1| hypothetical protein TcasGA2_TC009548 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|427796811|gb|JAA63857.1| Putative prolow-density lipoprotein receptor-related protein 1, partial [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|427795113|gb|JAA63008.1| Putative prolow-density lipoprotein receptor-related protein 1, partial [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|328702065|ref|XP_001946912.2| PREDICTED: low-density lipoprotein receptor-related protein 1-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|195024691|ref|XP_001985922.1| GH21081 [Drosophila grimshawi] gi|193901922|gb|EDW00789.1| GH21081 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|195381779|ref|XP_002049622.1| GJ21697 [Drosophila virilis] gi|194144419|gb|EDW60815.1| GJ21697 [Drosophila virilis] Back     alignment and taxonomy information
>gi|195551463|ref|XP_002076234.1| GD15368 [Drosophila simulans] gi|194201883|gb|EDX15459.1| GD15368 [Drosophila simulans] Back     alignment and taxonomy information
>gi|195332400|ref|XP_002032886.1| GM21016 [Drosophila sechellia] gi|194124856|gb|EDW46899.1| GM21016 [Drosophila sechellia] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query841
FB|FBgn0053087 4699 LRP1 "LDL receptor protein 1" 0.374 0.067 0.551 3.4e-133
UNIPROTKB|E1BGJ0 4544 LRP1 "Uncharacterized protein" 0.351 0.065 0.527 3.8e-132
UNIPROTKB|J9P315 4544 LRP1 "Uncharacterized protein" 0.439 0.081 0.457 4.8e-120
UNIPROTKB|F1PPZ1 4436 LRP1B "Uncharacterized protein 0.437 0.082 0.433 1.9e-117
UNIPROTKB|P98157 4543 LRP1 "Low-density lipoprotein 0.439 0.081 0.454 2.5e-116
MGI|MGI:96828 4545 Lrp1 "low density lipoprotein 0.439 0.081 0.457 3.9e-115
UNIPROTKB|Q9NZR2 4599 LRP1B "Low-density lipoprotein 0.437 0.080 0.433 1.5e-114
UNIPROTKB|E2R4Q1 4528 LRP1 "Uncharacterized protein" 0.565 0.105 0.387 2.2e-114
UNIPROTKB|G3V928 4545 Lrp1 "Protein Lrp1" [Rattus no 0.439 0.081 0.457 2.4e-114
UNIPROTKB|Q07954 4544 LRP1 "Prolow-density lipoprote 0.439 0.081 0.454 4.8e-114
FB|FBgn0053087 LRP1 "LDL receptor protein 1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 937 (334.9 bits), Expect = 3.4e-133, Sum P(4) = 3.4e-133
 Identities = 182/330 (55%), Positives = 232/330 (70%)

Query:   410 WIGKNLYWVESNLDQIEVAKLSGQFRRTLIAGDMESPRAIALDPRFGLLFWTDWDSKAPR 469
             W+GKNLYW++SNLDQIEVAKL+G FRRTLIAG+MESPRAIALDPR GLLFWTDWD  +PR
Sbjct:  1403 WVGKNLYWIDSNLDQIEVAKLNGSFRRTLIAGNMESPRAIALDPREGLLFWTDWDDNSPR 1462

Query:   470 IERCSMSGEHRSVIVRVDLLTSRGAWPNGLTLDYQLTRIYWIDAKSDSIHTVTYDGKDHH 529
             IER SMSG+ R +I       S G WPNGLTLDY   R+YW+DAKSDSI +  YDG +HH
Sbjct:  1463 IERASMSGDGRRMI-STSWQLSAG-WPNGLTLDYTQKRVYWVDAKSDSISSTMYDGSEHH 1520

Query:   530 VVLSNHDSLTHPFAIALFENHVYWTDWRTNSVIRANKWNGSDVTLIQRTLTQPF-IYVNG 588
             VVL N + L+HPFAI++FEN+VYWTDWRT SVIRANKWNGSDV ++QRT +QPF I V  
Sbjct:  1521 VVLRNKEILSHPFAISVFENYVYWTDWRTTSVIRANKWNGSDVQVLQRTQSQPFGIQVLH 1580

Query:   589 VVK----KSPCEMNNGNCSHLCLIGMNGTYKCQCPHVMKLMSDNKTCQVADSQFIIFSRP 644
               +    ++PC  NNG CSHLCL+   GT+KC+CPHVM+L   N+   V + Q ++F   
Sbjct:  1581 SSRQPWDRNPCGENNGGCSHLCLLSGRGTFKCECPHVMRLDPANERNCVPNEQVLLFVMV 1640

Query:   645 REIRGVDLEHPYYHTIPTISIPQVFSPNNLNFDAANKKIYWTDQEYNEVKRSSIVGGQIQ 704
              EIRG+DL  P +HTIPTI   Q  SP  ++F     +I+W+D + NE+  + I  G I+
Sbjct:  1641 DEIRGIDLHQPNHHTIPTIR--Q--SPRRIDFLVDESRIFWSDIQQNEISSAGISNGLIE 1696

Query:   705 LVVDAVFE----FYLTPLSKRSSIVGGQIQ 730
              +++   E    F +  +++      GQI+
Sbjct:  1697 PIINTNIEKPYGFAVDWIARNMYFSSGQIK 1726


GO:0005041 "low-density lipoprotein receptor activity" evidence=ISS
GO:0005509 "calcium ion binding" evidence=IEA
UNIPROTKB|E1BGJ0 LRP1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|J9P315 LRP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1PPZ1 LRP1B "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P98157 LRP1 "Low-density lipoprotein receptor-related protein 1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:96828 Lrp1 "low density lipoprotein receptor-related protein 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q9NZR2 LRP1B "Low-density lipoprotein receptor-related protein 1B" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2R4Q1 LRP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|G3V928 Lrp1 "Protein Lrp1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q07954 LRP1 "Prolow-density lipoprotein receptor-related protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query841
smart0013543 smart00135, LY, Low-density lipoprotein-receptor Y 3e-09
cd0011235 cd00112, LDLa, Low Density Lipoprotein Receptor Cl 2e-08
pfam0005737 pfam00057, Ldl_recept_a, Low-density lipoprotein r 7e-08
smart0013543 smart00135, LY, Low-density lipoprotein-receptor Y 3e-07
cd0011235 cd00112, LDLa, Low Density Lipoprotein Receptor Cl 3e-07
pfam0005737 pfam00057, Ldl_recept_a, Low-density lipoprotein r 3e-07
smart0013543 smart00135, LY, Low-density lipoprotein-receptor Y 7e-07
pfam0005842 pfam00058, Ldl_recept_b, Low-density lipoprotein r 1e-06
smart0013543 smart00135, LY, Low-density lipoprotein-receptor Y 1e-05
pfam0005842 pfam00058, Ldl_recept_b, Low-density lipoprotein r 1e-05
smart0019233 smart00192, LDLa, Low-density lipoprotein receptor 1e-05
smart0019233 smart00192, LDLa, Low-density lipoprotein receptor 1e-05
cd0011235 cd00112, LDLa, Low Density Lipoprotein Receptor Cl 4e-05
pfam0005842 pfam00058, Ldl_recept_b, Low-density lipoprotein r 4e-05
pfam0005737 pfam00057, Ldl_recept_a, Low-density lipoprotein r 1e-04
smart0019233 smart00192, LDLa, Low-density lipoprotein receptor 1e-04
smart0013543 smart00135, LY, Low-density lipoprotein-receptor Y 4e-04
smart0013543 smart00135, LY, Low-density lipoprotein-receptor Y 0.001
smart0013543 smart00135, LY, Low-density lipoprotein-receptor Y 0.002
smart0013543 smart00135, LY, Low-density lipoprotein-receptor Y 0.003
pfam1266224 pfam12662, cEGF, Complement Clr-like EGF-like 0.004
>gnl|CDD|214531 smart00135, LY, Low-density lipoprotein-receptor YWTD domain Back     alignment and domain information
 Score = 53.0 bits (128), Expect = 3e-09
 Identities = 16/45 (35%), Positives = 25/45 (55%), Gaps = 2/45 (4%)

Query: 436 RTLIAGDMESPRAIALDPRFGLLFWTDWDSKAPRIERCSMSGEHR 480
           RTL++  +  P  +A+D   G L+WTDW      IE  ++ G +R
Sbjct: 1   RTLLSSGLGHPNGLAVDWIEGRLYWTDW--GLDVIEVANLDGTNR 43


Type "B" repeats in low-density lipoprotein (LDL) receptor that plays a central role in mammalian cholesterol metabolism. Also present in a variety of molecules similar to gp300/megalin. Length = 43

>gnl|CDD|238060 cd00112, LDLa, Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure Back     alignment and domain information
>gnl|CDD|200964 pfam00057, Ldl_recept_a, Low-density lipoprotein receptor domain class A Back     alignment and domain information
>gnl|CDD|214531 smart00135, LY, Low-density lipoprotein-receptor YWTD domain Back     alignment and domain information
>gnl|CDD|238060 cd00112, LDLa, Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure Back     alignment and domain information
>gnl|CDD|200964 pfam00057, Ldl_recept_a, Low-density lipoprotein receptor domain class A Back     alignment and domain information
>gnl|CDD|214531 smart00135, LY, Low-density lipoprotein-receptor YWTD domain Back     alignment and domain information
>gnl|CDD|215683 pfam00058, Ldl_recept_b, Low-density lipoprotein receptor repeat class B Back     alignment and domain information
>gnl|CDD|214531 smart00135, LY, Low-density lipoprotein-receptor YWTD domain Back     alignment and domain information
>gnl|CDD|215683 pfam00058, Ldl_recept_b, Low-density lipoprotein receptor repeat class B Back     alignment and domain information
>gnl|CDD|197566 smart00192, LDLa, Low-density lipoprotein receptor domain class A Back     alignment and domain information
>gnl|CDD|197566 smart00192, LDLa, Low-density lipoprotein receptor domain class A Back     alignment and domain information
>gnl|CDD|238060 cd00112, LDLa, Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure Back     alignment and domain information
>gnl|CDD|215683 pfam00058, Ldl_recept_b, Low-density lipoprotein receptor repeat class B Back     alignment and domain information
>gnl|CDD|200964 pfam00057, Ldl_recept_a, Low-density lipoprotein receptor domain class A Back     alignment and domain information
>gnl|CDD|197566 smart00192, LDLa, Low-density lipoprotein receptor domain class A Back     alignment and domain information
>gnl|CDD|214531 smart00135, LY, Low-density lipoprotein-receptor YWTD domain Back     alignment and domain information
>gnl|CDD|214531 smart00135, LY, Low-density lipoprotein-receptor YWTD domain Back     alignment and domain information
>gnl|CDD|214531 smart00135, LY, Low-density lipoprotein-receptor YWTD domain Back     alignment and domain information
>gnl|CDD|214531 smart00135, LY, Low-density lipoprotein-receptor YWTD domain Back     alignment and domain information
>gnl|CDD|221695 pfam12662, cEGF, Complement Clr-like EGF-like Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 841
KOG1214|consensus1289 100.0
KOG1215|consensus877 100.0
KOG1215|consensus 877 100.0
KOG1214|consensus1289 100.0
PLN029191057 haloacid dehalogenase-like hydrolase family protei 99.85
PLN029191057 haloacid dehalogenase-like hydrolase family protei 99.83
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 99.74
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 99.73
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.46
PRK11028330 6-phosphogluconolactonase; Provisional 99.45
PRK11028330 6-phosphogluconolactonase; Provisional 99.45
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.44
COG3386307 Gluconolactonase [Carbohydrate transport and metab 99.41
COG3386307 Gluconolactonase [Carbohydrate transport and metab 99.38
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 99.31
COG3391381 Uncharacterized conserved protein [Function unknow 99.2
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 99.2
KOG4659|consensus 1899 99.19
COG3391381 Uncharacterized conserved protein [Function unknow 99.17
KOG4659|consensus 1899 99.14
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.13
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 99.11
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 99.1
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 99.08
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.06
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 99.04
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 98.92
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 98.86
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 98.83
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 98.77
PF1467036 FXa_inhibition: Coagulation Factor Xa inhibitory s 98.75
KOG1520|consensus376 98.74
PF0005737 Ldl_recept_a: Low-density lipoprotein receptor dom 98.72
cd0011235 LDLa Low Density Lipoprotein Receptor Class A doma 98.67
PF0005842 Ldl_recept_b: Low-density lipoprotein receptor rep 98.63
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 98.63
PF0005842 Ldl_recept_b: Low-density lipoprotein receptor rep 98.62
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 98.59
PF1467036 FXa_inhibition: Coagulation Factor Xa inhibitory s 98.53
KOG4499|consensus310 98.52
KOG1520|consensus376 98.5
PF03022287 MRJP: Major royal jelly protein; InterPro: IPR0035 98.45
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 98.4
TIGR03606454 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH 98.37
KOG4260|consensus350 98.35
PRK04043419 tolB translocation protein TolB; Provisional 98.3
smart0013543 LY Low-density lipoprotein-receptor YWTD domain. T 98.27
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 98.27
smart0019233 LDLa Low-density lipoprotein receptor domain class 98.25
PF0005737 Ldl_recept_a: Low-density lipoprotein receptor dom 98.19
KOG1219|consensus4289 98.18
PF03022287 MRJP: Major royal jelly protein; InterPro: IPR0035 98.13
KOG4499|consensus310 98.12
smart0013543 LY Low-density lipoprotein-receptor YWTD domain. T 98.12
PF1266224 cEGF: Complement Clr-like EGF-like 98.11
PRK04792448 tolB translocation protein TolB; Provisional 98.11
PRK04792448 tolB translocation protein TolB; Provisional 98.11
PF0308889 Str_synth: Strictosidine synthase; InterPro: IPR01 98.1
cd0011235 LDLa Low Density Lipoprotein Receptor Class A doma 98.08
TIGR03606454 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH 98.0
PRK04043419 tolB translocation protein TolB; Provisional 98.0
COG2133399 Glucose/sorbosone dehydrogenases [Carbohydrate tra 97.99
PRK05137435 tolB translocation protein TolB; Provisional 97.98
COG3204316 Uncharacterized protein conserved in bacteria [Fun 97.92
PRK05137435 tolB translocation protein TolB; Provisional 97.89
PRK04922433 tolB translocation protein TolB; Provisional 97.87
TIGR03118336 PEPCTERM_chp_1 conserved hypothetical protein TIGR 97.87
PF12999176 PRKCSH-like: Glucosidase II beta subunit-like 97.86
PRK04922433 tolB translocation protein TolB; Provisional 97.86
PRK00178430 tolB translocation protein TolB; Provisional 97.84
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 97.84
PRK01029428 tolB translocation protein TolB; Provisional 97.83
PRK02889427 tolB translocation protein TolB; Provisional 97.82
PRK02889427 tolB translocation protein TolB; Provisional 97.82
PRK03629429 tolB translocation protein TolB; Provisional 97.81
PRK03629429 tolB translocation protein TolB; Provisional 97.8
PF0308889 Str_synth: Strictosidine synthase; InterPro: IPR01 97.79
PRK02888635 nitrous-oxide reductase; Validated 97.78
KOG4260|consensus350 97.75
PRK00178430 tolB translocation protein TolB; Provisional 97.73
KOG1219|consensus4289 97.73
COG2133399 Glucose/sorbosone dehydrogenases [Carbohydrate tra 97.72
COG4946 668 Uncharacterized protein related to the periplasmic 97.7
PF0764542 EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 97.67
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 97.67
PRK01029428 tolB translocation protein TolB; Provisional 97.65
COG3204316 Uncharacterized protein conserved in bacteria [Fun 97.63
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 97.63
TIGR03118336 PEPCTERM_chp_1 conserved hypothetical protein TIGR 97.62
TIGR03032335 conserved hypothetical protein TIGR03032. This pro 97.61
smart0019233 LDLa Low-density lipoprotein receptor domain class 97.6
PF12999176 PRKCSH-like: Glucosidase II beta subunit-like 97.54
PF0764542 EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 97.42
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 97.37
PRK01742429 tolB translocation protein TolB; Provisional 97.27
COG4946 668 Uncharacterized protein related to the periplasmic 97.19
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 97.14
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 97.07
PRK01742429 tolB translocation protein TolB; Provisional 97.06
PF1266224 cEGF: Complement Clr-like EGF-like 97.04
PF0143628 NHL: NHL repeat; InterPro: IPR001258 The NHL repea 97.03
PF0143628 NHL: NHL repeat; InterPro: IPR001258 The NHL repea 97.02
PF02333381 Phytase: Phytase; InterPro: IPR003431 Phytase (3.1 96.98
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 96.86
PRK02888635 nitrous-oxide reductase; Validated 96.83
KOG4289|consensus 2531 96.77
COG5276370 Uncharacterized conserved protein [Function unknow 96.73
KOG3509|consensus 964 96.53
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 96.46
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 96.02
PF02333381 Phytase: Phytase; InterPro: IPR003431 Phytase (3.1 96.02
PF1294736 EGF_3: EGF domain; InterPro: IPR024731 This entry 95.98
COG3823262 Glutamine cyclotransferase [Posttranslational modi 95.91
cd01475224 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, 95.51
cd01475224 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, 95.37
smart0017939 EGF_CA Calcium-binding EGF-like domain. 95.15
PF13449326 Phytase-like: Esterase-like activity of phytase 94.83
COG0823425 TolB Periplasmic component of the Tol biopolymer t 94.65
TIGR03032335 conserved hypothetical protein TIGR03032. This pro 94.64
KOG1446|consensus311 94.64
KOG0315|consensus311 94.53
PF05787524 DUF839: Bacterial protein of unknown function (DUF 94.25
PF13449326 Phytase-like: Esterase-like activity of phytase 94.02
KOG1225|consensus525 93.98
PF0173186 Arylesterase: Arylesterase; InterPro: IPR002640 Th 93.9
smart0018135 EGF Epidermal growth factor-like domain. 93.89
COG3823262 Glutamine cyclotransferase [Posttranslational modi 93.61
smart0017939 EGF_CA Calcium-binding EGF-like domain. 93.54
PF05787524 DUF839: Bacterial protein of unknown function (DUF 93.51
KOG1217|consensus487 93.5
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 93.49
KOG0289|consensus506 93.42
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 93.23
KOG1225|consensus525 93.12
PF0173186 Arylesterase: Arylesterase; InterPro: IPR002640 Th 93.03
COG0823425 TolB Periplasmic component of the Tol biopolymer t 93.03
KOG0285|consensus460 92.66
PRK13616591 lipoprotein LpqB; Provisional 91.58
KOG2397|consensus480 91.49
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 90.92
KOG0286|consensus343 90.9
PTZ00421493 coronin; Provisional 90.68
COG4247364 Phy 3-phytase (myo-inositol-hexaphosphate 3-phosph 90.67
KOG4289|consensus 2531 90.55
cd0005336 EGF Epidermal growth factor domain, found in epide 90.33
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 90.33
KOG0268|consensus433 90.17
cd0005438 EGF_CA Calcium-binding EGF-like domain, present in 90.13
KOG3509|consensus964 89.15
KOG0994|consensus 1758 88.79
PF1294736 EGF_3: EGF domain; InterPro: IPR024731 This entry 88.76
KOG4441|consensus571 88.47
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 88.2
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 88.1
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 88.07
smart0018135 EGF Epidermal growth factor-like domain. 87.83
TIGR0227642 beta_rpt_yvtn 40-residue YVTN family beta-propelle 87.47
KOG1217|consensus487 86.65
COG5276370 Uncharacterized conserved protein [Function unknow 86.19
PF06247197 Plasmod_Pvs28: Plasmodium ookinete surface protein 86.18
PF0906434 Tme5_EGF_like: Thrombomodulin like fifth domain, E 86.08
PF0000832 EGF: EGF-like domain This is a sub-family of the P 85.89
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 85.62
KOG0994|consensus 1758 85.45
KOG0268|consensus433 85.4
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 85.06
PHA02713557 hypothetical protein; Provisional 84.78
KOG0273|consensus524 84.46
KOG2397|consensus480 84.19
TIGR0227642 beta_rpt_yvtn 40-residue YVTN family beta-propelle 84.17
COG1520370 FOG: WD40-like repeat [Function unknown] 83.46
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 83.21
cd0005438 EGF_CA Calcium-binding EGF-like domain, present in 82.9
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 82.36
KOG0315|consensus311 82.34
PTZ00420568 coronin; Provisional 82.25
PF0906434 Tme5_EGF_like: Thrombomodulin like fifth domain, E 81.44
KOG0285|consensus460 80.43
>KOG1214|consensus Back     alignment and domain information
Probab=100.00  E-value=9.1e-57  Score=488.27  Aligned_cols=386  Identities=35%  Similarity=0.687  Sum_probs=308.8

Q ss_pred             CCCCCCCCCCCCCCC--CCccc---ccccccCCCCCC--CcccCCCCcEEecCCCceecCCCCccccc----cccCC---
Q psy14257        112 KALVCDGEPACFNGE--DEMFC---DEKQCLRSDCHH--DCYNTPEGFMCVCPRDMYLQPDLITCSYL----HPCEA---  177 (841)
Q Consensus       112 ~~~~Cdg~~~C~~g~--de~~C---~eC~~~~~~C~~--~C~~~~g~~~C~C~~Gy~l~~d~~~C~~~----~eC~~---  177 (841)
                      .++.|    .|.+||  |+..|   |||+  ++.|.+  .|.|++++|.|.|.+||+  .||.+|..-    ..|+.   
T Consensus       807 s~y~C----~CLPGfsGDG~~c~dvDeC~--psrChp~A~CyntpgsfsC~C~pGy~--GDGf~CVP~~~~~T~C~~er~  878 (1289)
T KOG1214|consen  807 STYSC----ACLPGFSGDGHQCTDVDECS--PSRCHPAATCYNTPGSFSCRCQPGYY--GDGFQCVPDTSSLTPCEQERF  878 (1289)
T ss_pred             ceEEE----eecCCccCCccccccccccC--ccccCCCceEecCCCcceeecccCcc--CCCceecCCCccCCccccccc
Confidence            37888    999999  45556   8898  668964  899999999999999998  567777532    22210   


Q ss_pred             ----------------------------CC----Ccc----C---ceee-------cCCCCceEEeecCC--eeecC---
Q psy14257        178 ----------------------------WG----TCS----Q---DCEP-------SVSNNSYKCTCHAG--YELEP---  206 (841)
Q Consensus       178 ----------------------------~~----~Cs----~---~C~~-------~~~~g~~~C~C~~G--~~l~~---  206 (841)
                                                  ++    .|.    +   .|..       .+|..++.|+|..+  .....   
T Consensus       879 hpl~chg~t~~~~~~Dp~~~e~p~~~~ppG~~~~~c~~~~~~~vp~Cd~hgh~ap~qchG~~~~CwCvd~dGrev~gtr~  958 (1289)
T KOG1214|consen  879 HPLQCHGSTGFCWCVDPDGHEVPGTQTPPGSTPPHCGPSPEQYVPQCDDHGHFAPLQCHGKSDFCWCVDKDGREVQGTRS  958 (1289)
T ss_pred             cceeeccccceeEeeCCCcccCCCCCCCCCCCCCCCCCcccccCCCccccccccccccCCCcceeEEecCCCcCcccccc
Confidence                                        01    010    1   1110       02455689999763  22110   


Q ss_pred             ---CCCceEeCC---------------CCCCCCeEEeccCcccccccccccc-----EEEEec-cccceeeecccccCCc
Q psy14257        207 ---DMFTCKSKS---------------KNDSSPFVIFSNRHELRGVDLRTFN-----VIALIS-SLKNTIALDFYYTPTA  262 (841)
Q Consensus       207 ---d~~~C~~~~---------------~~~~~p~ll~s~~~~I~~~~~~~~~-----~~~l~~-~~~~~~avd~~~~~~~  262 (841)
                         ....|....               ......+|||++...|.++++++..     .++++. .-+.+++||||.++++
T Consensus       959 ~pg~tp~CiptvApp~v~np~~~~~v~p~~~gt~LL~aqg~~I~~lplng~~~~K~~ak~~l~~p~~IiVGidfDC~e~m 1038 (1289)
T KOG1214|consen  959 QPGTTPACIPTVAPPMVRNPTPRPDVTPPSVGTFLLYAQGQQIGYLPLNGTRLQKDAAKTLLSLPGSIIVGIDFDCRERM 1038 (1289)
T ss_pred             CCCCCCCccCCCCCCcccCCCCCCCCcCCCCcceEEEeccceEEEeecCcchhchhhhhceEecccceeeeeecccccce
Confidence               011232211               0122348999999999999998732     233332 2356899999998855


Q ss_pred             ceeEEEecCCCeEEEEEecCCcccceEEEEeCCCCCccceEEeeecCceeEEEeeecCCCCCCCCCCEEEEccCCCcccc
Q psy14257        263 NMVFWTDVIDDKIYNATLIGNSLSNIDVVVQTGLSTAEGLAVDWIGKNLYMFWAFWSLSPSNSSDGGIEKAGMHGENRSP  342 (841)
Q Consensus       263 ~~lyw~d~~~~~I~~~~~~~~~~~~~~~~~~~~l~~p~giavD~~~~~~y~~~td~~~~~~~~~~~~I~~~~~dG~~~~~  342 (841)
                        |||+|.....|.|++|.|+   +.++++..+|.+|+||||||.+                                  
T Consensus      1039 --vyWtDv~g~SI~rasL~G~---Ep~ti~n~~L~SPEGiAVDh~~---------------------------------- 1079 (1289)
T KOG1214|consen 1039 --VYWTDVAGRSISRASLEGA---EPETIVNSGLISPEGIAVDHIR---------------------------------- 1079 (1289)
T ss_pred             --EEEeecCCCccccccccCC---CCceeecccCCCccceeeeecc----------------------------------
Confidence              9999999999999999854   7899999999999999999876                                  


Q ss_pred             ccccCcCCCceEEEEccCCEEEEEeCCCCeEEEEEecCCccEEEEeeeeecCCCccccCCCCCCccccccceEEEEecCC
Q psy14257        343 LVTKNIQWPSSLVIDYNQDILYWCDSHLNTVESVRVDGSERTVSFNLEVLGSDSRVGIPNCRPEDNLWIGKNLYWVESNL  422 (841)
Q Consensus       343 l~~~~~~~P~glavD~~~~~lYwaD~~~~~I~~~~ldG~~~~~~~~~~~~~~~~~~~i~~~~~~avdw~~~~LY~tD~~~  422 (841)
                                                                                            +++||||+..
T Consensus      1080 ----------------------------------------------------------------------Rn~ywtDS~l 1089 (1289)
T KOG1214|consen 1080 ----------------------------------------------------------------------RNMYWTDSVL 1089 (1289)
T ss_pred             ----------------------------------------------------------------------ceeeeecccc
Confidence                                                                                  8899999999


Q ss_pred             CcEEEEccCCceEEEEecCCCCCceeEEEcCCCCeEEEEecCCCCCeEEEecCCCCCcEEEEEecccCCCCCCceeEEEe
Q psy14257        423 DQIEVAKLSGQFRRTLIAGDMESPRAIALDPRFGLLFWTDWDSKAPRIERCSMSGEHRSVIVRVDLLTSRGAWPNGLTLD  502 (841)
Q Consensus       423 ~~I~v~~~~G~~~~~l~~~~l~~P~giavd~~~g~Ly~td~~~~~~~I~r~~ldG~~~~~i~~~~~~~~~~~~P~glalD  502 (841)
                      ++|+|+.|||+.+++|+.++|.+||+|++|+.+|.||||||++++++|++++|||+++++++.     ..+..||||++|
T Consensus      1090 D~IevA~LdG~~rkvLf~tdLVNPR~iv~D~~rgnLYwtDWnRenPkIets~mDG~NrRilin-----~DigLPNGLtfd 1164 (1289)
T KOG1214|consen 1090 DKIEVALLDGSERKVLFYTDLVNPRAIVVDPIRGNLYWTDWNRENPKIETSSMDGENRRILIN-----TDIGLPNGLTFD 1164 (1289)
T ss_pred             chhheeecCCceeeEEEeecccCcceEEeecccCceeeccccccCCcceeeccCCccceEEee-----cccCCCCCceeC
Confidence            999999999999999999999999999999999999999999999999999999999999999     799999999999


Q ss_pred             ccCCEEEEEeCCCCeEEEEEcCCCeeEEEEcCCCCCCcceEEEEecCeEEEEeCCCCeEEEEeccCCcceEE-EecccCC
Q psy14257        503 YQLTRIYWIDAKSDSIHTVTYDGKDHHVVLSNHDSLTHPFAIALFENHVYWTDWRTNSVIRANKWNGSDVTL-IQRTLTQ  581 (841)
Q Consensus       503 ~~~~~LYw~d~~~~~I~~~~~dG~~~~~i~~~~~~l~~P~gla~~~~~lY~td~~~~~i~~~~~~~g~~~~~-i~~~~~~  581 (841)
                      +..+.|-|+|+++++++.+.++|..|+++..+   |+.||+|+-+++.+|||||..++|..+++..++.... +...-..
T Consensus      1165 pfs~~LCWvDAGt~rleC~~p~g~gRR~i~~~---LqYPF~itsy~~~fY~TDWk~n~vvsv~~~~~~~td~~~p~~~s~ 1241 (1289)
T KOG1214|consen 1165 PFSKLLCWVDAGTKRLECTLPDGTGRRVIQNN---LQYPFSITSYADHFYHTDWKRNGVVSVNKHSGQFTDEYLPEQRSH 1241 (1289)
T ss_pred             cccceeeEEecCCcceeEecCCCCcchhhhhc---ccCceeeeeccccceeeccccCceEEeeccccccccccccccccc
Confidence            99999999999999999999999999998865   8999999999999999999999999999988776543 3222233


Q ss_pred             Cceec----cCCcccCCCCCCCCCCccccccCCCCceeeeCCCCce
Q psy14257        582 PFIYV----NGVVKKSPCEMNNGNCSHLCLIGMNGTYKCQCPHVMK  623 (841)
Q Consensus       582 p~~~h----~qp~~~n~C~~~ng~Cs~lC~~~~~~~~~C~Cp~g~~  623 (841)
                      .+|+.    .-|.+++||+.+||||+||||+.-++ ..|.||+...
T Consensus      1242 lyGItav~~~Cp~gstpCSedNGGCqHLCLpgqng-avcecpdnvk 1286 (1289)
T KOG1214|consen 1242 LYGITAVYPYCPTGSTPCSEDNGGCQHLCLPGQNG-AVCECPDNVK 1286 (1289)
T ss_pred             eEEEEeccccCCCCCCcccccCCcceeecccCcCC-ccccCCccce
Confidence            55522    45899999999999999999987766 6899998643



>KOG1215|consensus Back     alignment and domain information
>KOG1215|consensus Back     alignment and domain information
>KOG1214|consensus Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG4659|consensus Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4659|consensus Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A Back     alignment and domain information
>KOG1520|consensus Back     alignment and domain information
>PF00057 Ldl_recept_a: Low-density lipoprotein receptor domain class A This prints entry is specific to LDL receptor; InterPro: IPR002172 The low-density lipoprotein receptor (LDLR) is the major cholesterol-carrying lipoprotein of plasma, acting to regulate cholesterol homeostasis in mammalian cells Back     alignment and domain information
>cd00112 LDLa Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure Back     alignment and domain information
>PF00058 Ldl_recept_b: Low-density lipoprotein receptor repeat class B; InterPro: IPR000033 The low-density lipoprotein receptor (LDLR) is the major cholesterol-carrying lipoprotein of plasma, acting to regulate cholesterol homeostasis in mammalian cells Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>PF00058 Ldl_recept_b: Low-density lipoprotein receptor repeat class B; InterPro: IPR000033 The low-density lipoprotein receptor (LDLR) is the major cholesterol-carrying lipoprotein of plasma, acting to regulate cholesterol homeostasis in mammalian cells Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>KOG1520|consensus Back     alignment and domain information
>PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12 Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family Back     alignment and domain information
>KOG4260|consensus Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>smart00135 LY Low-density lipoprotein-receptor YWTD domain Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>smart00192 LDLa Low-density lipoprotein receptor domain class A Back     alignment and domain information
>PF00057 Ldl_recept_a: Low-density lipoprotein receptor domain class A This prints entry is specific to LDL receptor; InterPro: IPR002172 The low-density lipoprotein receptor (LDLR) is the major cholesterol-carrying lipoprotein of plasma, acting to regulate cholesterol homeostasis in mammalian cells Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12 Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>smart00135 LY Low-density lipoprotein-receptor YWTD domain Back     alignment and domain information
>PF12662 cEGF: Complement Clr-like EGF-like Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4 Back     alignment and domain information
>cd00112 LDLa Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure Back     alignment and domain information
>TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG2133 Glucose/sorbosone dehydrogenases [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118 Back     alignment and domain information
>PF12999 PRKCSH-like: Glucosidase II beta subunit-like Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4 Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>KOG4260|consensus Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>COG2133 Glucose/sorbosone dehydrogenases [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118 Back     alignment and domain information
>TIGR03032 conserved hypothetical protein TIGR03032 Back     alignment and domain information
>smart00192 LDLa Low-density lipoprotein receptor domain class A Back     alignment and domain information
>PF12999 PRKCSH-like: Glucosidase II beta subunit-like Back     alignment and domain information
>PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF12662 cEGF: Complement Clr-like EGF-like Back     alignment and domain information
>PF01436 NHL: NHL repeat; InterPro: IPR001258 The NHL repeat, named after NCL-1, HT2A and Lin-41, is found largely in a large number of eukaryotic and prokaryotic proteins Back     alignment and domain information
>PF01436 NHL: NHL repeat; InterPro: IPR001258 The NHL repeat, named after NCL-1, HT2A and Lin-41, is found largely in a large number of eukaryotic and prokaryotic proteins Back     alignment and domain information
>PF02333 Phytase: Phytase; InterPro: IPR003431 Phytase (3 Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>KOG4289|consensus Back     alignment and domain information
>COG5276 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3509|consensus Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF02333 Phytase: Phytase; InterPro: IPR003431 Phytase (3 Back     alignment and domain information
>PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins Back     alignment and domain information
>COG3823 Glutamine cyclotransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity Back     alignment and domain information
>cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity Back     alignment and domain information
>smart00179 EGF_CA Calcium-binding EGF-like domain Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR03032 conserved hypothetical protein TIGR03032 Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>PF05787 DUF839: Bacterial protein of unknown function (DUF839); InterPro: IPR008557 This family consists of bacterial proteins of unknown function Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>KOG1225|consensus Back     alignment and domain information
>PF01731 Arylesterase: Arylesterase; InterPro: IPR002640 The serum paraoxonases/arylesterases are enzymes that catalyse the hydrolysis of the toxic metabolites of a variety of organophosphorus insecticides Back     alignment and domain information
>smart00181 EGF Epidermal growth factor-like domain Back     alignment and domain information
>COG3823 Glutamine cyclotransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00179 EGF_CA Calcium-binding EGF-like domain Back     alignment and domain information
>PF05787 DUF839: Bacterial protein of unknown function (DUF839); InterPro: IPR008557 This family consists of bacterial proteins of unknown function Back     alignment and domain information
>KOG1217|consensus Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG1225|consensus Back     alignment and domain information
>PF01731 Arylesterase: Arylesterase; InterPro: IPR002640 The serum paraoxonases/arylesterases are enzymes that catalyse the hydrolysis of the toxic metabolites of a variety of organophosphorus insecticides Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>KOG2397|consensus Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>COG4247 Phy 3-phytase (myo-inositol-hexaphosphate 3-phosphohydrolase) [Lipid metabolism] Back     alignment and domain information
>KOG4289|consensus Back     alignment and domain information
>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>KOG3509|consensus Back     alignment and domain information
>KOG0994|consensus Back     alignment and domain information
>PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins Back     alignment and domain information
>KOG4441|consensus Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>smart00181 EGF Epidermal growth factor-like domain Back     alignment and domain information
>TIGR02276 beta_rpt_yvtn 40-residue YVTN family beta-propeller repeat Back     alignment and domain information
>KOG1217|consensus Back     alignment and domain information
>COG5276 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF06247 Plasmod_Pvs28: Plasmodium ookinete surface protein Pvs28; InterPro: IPR010423 This family consists of several ookinete surface protein (Pvs28) from several species of Plasmodium Back     alignment and domain information
>PF09064 Tme5_EGF_like: Thrombomodulin like fifth domain, EGF-like; InterPro: IPR015149 This domain adopts a fold similar to other EGF domains, with a flat major and a twisted minor beta sheet Back     alignment and domain information
>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>KOG0994|consensus Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG2397|consensus Back     alignment and domain information
>TIGR02276 beta_rpt_yvtn 40-residue YVTN family beta-propeller repeat Back     alignment and domain information
>COG1520 FOG: WD40-like repeat [Function unknown] Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>PF09064 Tme5_EGF_like: Thrombomodulin like fifth domain, EGF-like; InterPro: IPR015149 This domain adopts a fold similar to other EGF domains, with a flat major and a twisted minor beta sheet Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query841
3s94_A 619 Crystal Structure Of Lrp6-E1e2 Length = 619 1e-69
4dg6_A 616 Crystal Structure Of Domains 1 And 2 Of Lrp6 Length 1e-69
3s2k_A 629 Structural Basis Of Wnt Signaling Inhibition By Dic 2e-59
3s2k_A 629 Structural Basis Of Wnt Signaling Inhibition By Dic 3e-12
3s8v_A 623 Crystal Structure Of Lrp6-Dkk1 Complex Length = 623 2e-59
3s8v_A 623 Crystal Structure Of Lrp6-Dkk1 Complex Length = 623 4e-12
4a0p_A 628 Crystal Structure Of Lrp6p3e3p4e4 Length = 628 3e-59
4a0p_A 628 Crystal Structure Of Lrp6p3e3p4e4 Length = 628 4e-12
3sob_B316 The Structure Of The First Ywtd Beta Propeller Doma 4e-52
3soq_A318 The Structure Of The First Ywtd Beta Propeller Doma 5e-51
3m0c_C791 The X-Ray Crystal Structure Of Pcsk9 In Complex Wit 2e-47
3m0c_C 791 The X-Ray Crystal Structure Of Pcsk9 In Complex Wit 4e-11
1n7d_A699 Extracellular Domain Of The Ldl Receptor Length = 6 1e-46
1n7d_A 699 Extracellular Domain Of The Ldl Receptor Length = 6 2e-11
3v65_B386 Crystal Structure Of Agrin And Lrp4 Complex Length 2e-45
3v65_B 386 Crystal Structure Of Agrin And Lrp4 Complex Length 3e-12
3v64_C349 Crystal Structure Of Agrin And Lrp4 Length = 349 5e-45
3v64_C 349 Crystal Structure Of Agrin And Lrp4 Length = 349 4e-12
3p5c_L440 The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE 1e-44
3p5c_L 440 The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE 5e-11
3p5b_L400 The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE 7e-42
3p5b_L 400 The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE 6e-11
1ijq_A316 Crystal Structure Of The Ldl Receptor Ywtd-Egf Doma 8e-37
1ijq_A 316 Crystal Structure Of The Ldl Receptor Ywtd-Egf Doma 6e-04
1npe_A267 Crystal Structure Of Nidogen/laminin Complex Length 4e-26
1npe_A267 Crystal Structure Of Nidogen/laminin Complex Length 1e-05
1f5y_A85 Nmr Structure Of A Concatemer Of The First And Seco 1e-07
1f5y_A85 Nmr Structure Of A Concatemer Of The First And Seco 1e-04
2lgp_A94 Solution Structure Of La45 From Ldlr Length = 94 2e-06
2fcw_B80 Structure Of A Complex Between The Pair Of The Ldl 4e-05
2fyj_A82 Nmr Solution Structure Of Calcium-Loaded Lrp Double 4e-04
2gtl_O215 Lumbricus Erythrocruorin At 3.5a Resolution Length 5e-04
1hz8_A82 Solution Structure And Backbone Dynamics Of A Conca 6e-04
3bps_E83 Pcsk9:egf-a Complex Length = 83 6e-04
>pdb|3S94|A Chain A, Crystal Structure Of Lrp6-E1e2 Length = 619 Back     alignment and structure

Iteration: 1

Score = 261 bits (667), Expect = 1e-69, Method: Compositional matrix adjust. Identities = 153/501 (30%), Positives = 262/501 (52%), Gaps = 58/501 (11%) Query: 336 HGENRSPLVTKNIQWPSSLVIDYNQDILYWCDSHLNTVESVRVDGSERTVSFNLEVLGSD 395 +G+ + +V ++ +++ ++ ++YW D ++ + +E N+ V G Sbjct: 27 NGKENATIVVGGLEDAAAVDFVFSHGLIYWSDVSEEAIKRTEFNKTESVQ--NVVVSGLL 84 Query: 396 SRVGIPNCRPEDNLWIGKNLYWVESNLDQIEVAKLSGQFRRTLIAGDMESPRAIALDPRF 455 S G+ C W+G+ LYW +S ++IEV+ L G R+ L +++ PRAIALDP Sbjct: 85 SPDGLA-CD-----WLGEKLYWTDSETNRIEVSNLDGSLRKVLFWQELDQPRAIALDPSS 138 Query: 456 GLLFWTDWDSKAPRIERCSMSGEHRSVIVRVDLLTSRGAWPNGLTLDYQLTRIYWIDAKS 515 G ++WTDW + P+IER M G R +I+ ++ WPNGLTLDY+ ++YW DAK Sbjct: 139 GFMYWTDW-GEVPKIERAGMDGSSRFIIINSEIY-----WPNGLTLDYEEQKLYWADAKL 192 Query: 516 DSIHTVTYDGKDHHVVLSNHDSLTHPFAIALFENHVYWTDWRTNSVIRANKWNGSDVTLI 575 + IH DG + V+ SL HPFA+ LFE+ +YWTDW T+S++ NK+ G + I Sbjct: 193 NFIHKSNLDGTNRQAVVKG--SLPHPFALTLFEDILYWTDWSTHSILACNKYTGEGLREI 250 Query: 576 QRTLTQPF-IYVNGVVKK----SPCEMNNGNCSHLCLIG-MNGTYKCQCPHVMKLMSDNK 629 + P I+ ++ +PC ++NG CSHLCL+ + Y+C CP +KL+ + K Sbjct: 251 HSDIFSPMDIHAFSQQRQPNATNPCGIDNGGCSHLCLMSPVKPFYQCACPTGVKLLENGK 310 Query: 630 TCQVADSQFIIFSRPREIRGVDLEHPYYHTIPTISIPQVFSPNNLNFDAANKKIYWTDQE 689 TC+ ++ ++ +R ++R + L+ P + I + + + +++D IYWTD E Sbjct: 311 TCKDGATELLLLARRTDLRRISLDTPDFTDI-VLQLEDIRHAIAIDYDPVEGYIYWTDDE 369 Query: 690 YNEVKRSSIVGGQIQLVVDAVFEFYLTPLSKRSSIVGGQIQLVVDAGISHPSGLAIDWIA 749 ++ RS I G Q VV A I+HP G+A+DW+A Sbjct: 370 VRAIR--------------------------RSFIDGSGSQFVVTAQIAHPDGIAVDWVA 403 Query: 750 QNMFIAVSSPTQSKIVVCNLEGEYQTTILSNESNDTSTLSKISSIAVWPVKGKMFWSNVT 809 +N++ + +I V L G + ++S + L + +I + P+ G M+W++ Sbjct: 404 RNLYW--TDTGTDRIEVTRLNGTMRKILISED------LEEPRAIVLDPMVGYMYWTD-W 454 Query: 810 KQVVTIEMAFMDGTKRETVVS 830 ++ IE A +DG+ R +V+ Sbjct: 455 GEIPKIERAALDGSDRVVLVN 475
>pdb|4DG6|A Chain A, Crystal Structure Of Domains 1 And 2 Of Lrp6 Length = 616 Back     alignment and structure
>pdb|3S2K|A Chain A, Structural Basis Of Wnt Signaling Inhibition By Dickkopf Binding To Lrp56. Length = 629 Back     alignment and structure
>pdb|3S2K|A Chain A, Structural Basis Of Wnt Signaling Inhibition By Dickkopf Binding To Lrp56. Length = 629 Back     alignment and structure
>pdb|3S8V|A Chain A, Crystal Structure Of Lrp6-Dkk1 Complex Length = 623 Back     alignment and structure
>pdb|3S8V|A Chain A, Crystal Structure Of Lrp6-Dkk1 Complex Length = 623 Back     alignment and structure
>pdb|4A0P|A Chain A, Crystal Structure Of Lrp6p3e3p4e4 Length = 628 Back     alignment and structure
>pdb|4A0P|A Chain A, Crystal Structure Of Lrp6p3e3p4e4 Length = 628 Back     alignment and structure
>pdb|3SOB|B Chain B, The Structure Of The First Ywtd Beta Propeller Domain Of Lrp6 In Complex With A Fab Length = 316 Back     alignment and structure
>pdb|3SOQ|A Chain A, The Structure Of The First Ywtd Beta Propeller Domain Of Lrp6 In Complex With A Dkk1 Peptide Length = 318 Back     alignment and structure
>pdb|3M0C|C Chain C, The X-Ray Crystal Structure Of Pcsk9 In Complex With The Ldl Receptor Length = 791 Back     alignment and structure
>pdb|3M0C|C Chain C, The X-Ray Crystal Structure Of Pcsk9 In Complex With The Ldl Receptor Length = 791 Back     alignment and structure
>pdb|1N7D|A Chain A, Extracellular Domain Of The Ldl Receptor Length = 699 Back     alignment and structure
>pdb|1N7D|A Chain A, Extracellular Domain Of The Ldl Receptor Length = 699 Back     alignment and structure
>pdb|3V65|B Chain B, Crystal Structure Of Agrin And Lrp4 Complex Length = 386 Back     alignment and structure
>pdb|3V65|B Chain B, Crystal Structure Of Agrin And Lrp4 Complex Length = 386 Back     alignment and structure
>pdb|3V64|C Chain C, Crystal Structure Of Agrin And Lrp4 Length = 349 Back     alignment and structure
>pdb|3V64|C Chain C, Crystal Structure Of Agrin And Lrp4 Length = 349 Back     alignment and structure
>pdb|3P5C|L Chain L, The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE RECEPTOR IN AN Extended Conformation Length = 440 Back     alignment and structure
>pdb|3P5C|L Chain L, The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE RECEPTOR IN AN Extended Conformation Length = 440 Back     alignment and structure
>pdb|3P5B|L Chain L, The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE RECEPTOR IN AN Extended Conformation Length = 400 Back     alignment and structure
>pdb|3P5B|L Chain L, The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE RECEPTOR IN AN Extended Conformation Length = 400 Back     alignment and structure
>pdb|1IJQ|A Chain A, Crystal Structure Of The Ldl Receptor Ywtd-Egf Domain Pair Length = 316 Back     alignment and structure
>pdb|1IJQ|A Chain A, Crystal Structure Of The Ldl Receptor Ywtd-Egf Domain Pair Length = 316 Back     alignment and structure
>pdb|1NPE|A Chain A, Crystal Structure Of Nidogen/laminin Complex Length = 267 Back     alignment and structure
>pdb|1NPE|A Chain A, Crystal Structure Of Nidogen/laminin Complex Length = 267 Back     alignment and structure
>pdb|1F5Y|A Chain A, Nmr Structure Of A Concatemer Of The First And Second Ligand-Binding Modules Of The Human Ldl Receptor Length = 85 Back     alignment and structure
>pdb|1F5Y|A Chain A, Nmr Structure Of A Concatemer Of The First And Second Ligand-Binding Modules Of The Human Ldl Receptor Length = 85 Back     alignment and structure
>pdb|2LGP|A Chain A, Solution Structure Of La45 From Ldlr Length = 94 Back     alignment and structure
>pdb|2FCW|B Chain B, Structure Of A Complex Between The Pair Of The Ldl Receptor Ligand-Binding Modules 3-4 And The Receptor Associated Protein (Rap) Length = 80 Back     alignment and structure
>pdb|2FYJ|A Chain A, Nmr Solution Structure Of Calcium-Loaded Lrp Double Module Length = 82 Back     alignment and structure
>pdb|2GTL|O Chain O, Lumbricus Erythrocruorin At 3.5a Resolution Length = 215 Back     alignment and structure
>pdb|1HZ8|A Chain A, Solution Structure And Backbone Dynamics Of A Concatemer Of Egf-Homology Modules Of The Human Low Density Lipoprotein Receptor Length = 82 Back     alignment and structure
>pdb|3BPS|E Chain E, Pcsk9:egf-a Complex Length = 83 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query841
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 1e-104
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 3e-30
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 2e-21
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 3e-17
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 6e-04
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 1e-100
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 1e-31
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 3e-17
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 3e-16
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 8e-05
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 4e-04
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 7e-99
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 1e-69
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 9e-47
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 5e-30
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 5e-24
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 2e-16
3s94_A 619 LRP-6, low-density lipoprotein receptor-related pr 2e-91
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 2e-65
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 5e-26
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 2e-23
3s94_A 619 LRP-6, low-density lipoprotein receptor-related pr 1e-22
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 7e-04
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 4e-81
1ijq_A 316 LDL receptor, low-density lipoprotein receptor; be 3e-25
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 6e-09
3v65_B386 Low-density lipoprotein receptor-related protein; 2e-76
3v65_B386 Low-density lipoprotein receptor-related protein; 4e-41
3v65_B 386 Low-density lipoprotein receptor-related protein; 3e-24
3p5b_L400 Low density lipoprotein receptor variant; B-propel 1e-75
3p5b_L400 Low density lipoprotein receptor variant; B-propel 1e-34
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 1e-22
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 1e-74
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 2e-41
3sov_A 318 LRP-6, low-density lipoprotein receptor-related pr 5e-22
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 7e-13
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 4e-09
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 5e-05
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 4e-72
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 2e-28
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 2e-19
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 1e-66
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 6e-44
3v64_C 349 Agrin; beta propeller, laminin-G, signaling, prote 1e-24
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 1e-25
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 3e-09
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 1e-04
2fyj_A82 Low-density lipoprotein receptor-related protein 1 8e-22
2fyj_A82 Low-density lipoprotein receptor-related protein 1 1e-18
2fyj_A82 Low-density lipoprotein receptor-related protein 1 7e-08
2fcw_B80 LDL receptor, low-density lipoprotein receptor; pr 8e-22
2fcw_B80 LDL receptor, low-density lipoprotein receptor; pr 1e-20
2fcw_B80 LDL receptor, low-density lipoprotein receptor; pr 3e-08
2fcw_B80 LDL receptor, low-density lipoprotein receptor; pr 2e-07
2gtl_O215 Extracellular hemoglobin linker L3 subunit; anneli 6e-16
2gtl_O215 Extracellular hemoglobin linker L3 subunit; anneli 6e-11
2gtl_O215 Extracellular hemoglobin linker L3 subunit; anneli 1e-09
2kny_A80 LRP-1, linker, APO-E; lipoprotein receptor, ligand 1e-15
2kny_A80 LRP-1, linker, APO-E; lipoprotein receptor, ligand 9e-10
2kny_A80 LRP-1, linker, APO-E; lipoprotein receptor, ligand 9e-08
2xrc_A565 Human complement factor I; immune system, hydrolas 2e-15
2xrc_A565 Human complement factor I; immune system, hydrolas 4e-12
2xrc_A565 Human complement factor I; immune system, hydrolas 5e-09
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 3e-15
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 9e-11
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 1e-04
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 5e-04
2gtl_M217 Hemoglobin linker chain L1; annelid erythrocruorin 3e-14
2gtl_M217 Hemoglobin linker chain L1; annelid erythrocruorin 3e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-08
2gtl_N220 Extracellular hemoglobin linker L2 subunit; anneli 1e-12
2gtl_N220 Extracellular hemoglobin linker L2 subunit; anneli 5e-09
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 6e-12
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 2e-04
2knx_A50 Prolow-density lipoprotein receptor-related prote; 6e-12
2knx_A50 Prolow-density lipoprotein receptor-related prote; 3e-07
2knx_A50 Prolow-density lipoprotein receptor-related prote; 7e-06
2i1p_A48 Low-density lipoprotein receptor-related protein 2 7e-11
2i1p_A48 Low-density lipoprotein receptor-related protein 2 5e-07
2i1p_A48 Low-density lipoprotein receptor-related protein 2 1e-06
1cr8_A42 Protein (LOW density lipoprotein receptor related 8e-11
1cr8_A42 Protein (LOW density lipoprotein receptor related 3e-07
1cr8_A42 Protein (LOW density lipoprotein receptor related 3e-06
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 1e-10
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 1e-07
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 2e-05
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 1e-10
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 6e-07
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 3e-05
2jm4_A43 Relaxin receptor 1; LDL-A module, RXFP1 receptor, 2e-10
2jm4_A43 Relaxin receptor 1; LDL-A module, RXFP1 receptor, 2e-06
2jm4_A43 Relaxin receptor 1; LDL-A module, RXFP1 receptor, 9e-05
3a7q_B44 Low-density lipoprotein receptor-related protein; 3e-10
3a7q_B44 Low-density lipoprotein receptor-related protein; 3e-07
3a7q_B44 Low-density lipoprotein receptor-related protein; 7e-06
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 4e-10
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 7e-10
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 7e-09
1k7b_A47 Subgroup A ROUS sarcoma virus receptor PG800 and P 9e-10
1k7b_A47 Subgroup A ROUS sarcoma virus receptor PG800 and P 5e-08
1k7b_A47 Subgroup A ROUS sarcoma virus receptor PG800 and P 1e-05
1d2l_A45 Lipoprotein receptor related protein; ligand bindi 1e-09
1d2l_A45 Lipoprotein receptor related protein; ligand bindi 3e-07
1d2l_A45 Lipoprotein receptor related protein; ligand bindi 1e-06
1kli_L69 Factor VIIA; extrinsic coagulation pathway, serine 1e-09
1kli_L69 Factor VIIA; extrinsic coagulation pathway, serine 2e-05
1j8e_A44 Low-density lipoprotein receptor-related protein 1 2e-09
1j8e_A44 Low-density lipoprotein receptor-related protein 1 1e-07
1j8e_A44 Low-density lipoprotein receptor-related protein 1 2e-06
3dpr_E39 LDL-receptor class A 3; human rhinovirus, VLDL-rec 3e-09
3dpr_E39 LDL-receptor class A 3; human rhinovirus, VLDL-rec 1e-08
3dpr_E39 LDL-receptor class A 3; human rhinovirus, VLDL-rec 1e-05
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 3e-09
2wph_E59 Coagulation factor IXA light chain; serine proteas 4e-09
2wph_E59 Coagulation factor IXA light chain; serine proteas 2e-05
1ajj_A37 LR5, low-density lipoprotein receptor; LDL recepto 6e-09
1ajj_A37 LR5, low-density lipoprotein receptor; LDL recepto 1e-06
1ajj_A37 LR5, low-density lipoprotein receptor; LDL recepto 2e-06
1jrf_A47 TVA LDL-A module, subgroup A ROUS sarcoma virus re 7e-09
1jrf_A47 TVA LDL-A module, subgroup A ROUS sarcoma virus re 2e-07
1jrf_A47 TVA LDL-A module, subgroup A ROUS sarcoma virus re 2e-05
2bz6_L53 Blood coagulation factor VIIA; serine protease, en 8e-09
2bz6_L53 Blood coagulation factor VIIA; serine protease, en 4e-05
1kig_L51 Factor XA; glycoprotein, serine protease, plasma, 4e-08
1kig_L51 Factor XA; glycoprotein, serine protease, plasma, 4e-05
1kig_L51 Factor XA; glycoprotein, serine protease, plasma, 7e-04
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 1e-07
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 2e-07
2jkh_L55 Factor X light chain; plasma, calcium, zymogen, se 4e-07
2jkh_L55 Factor X light chain; plasma, calcium, zymogen, se 3e-05
2jkh_L55 Factor X light chain; plasma, calcium, zymogen, se 8e-04
2vh0_B134 Activated factor XA light chain; serine protease, 6e-07
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 7e-07
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 2e-05
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 7e-04
2p4o_A306 Hypothetical protein; putative lactonase, structur 8e-07
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 2e-06
1aut_L114 Activated protein C; serine proteinase, plasma cal 2e-06
2bou_A143 EGF-like module containing mucin-like hormone rece 3e-06
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 5e-06
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 6e-06
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 2e-04
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 9e-06
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 1e-05
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 7e-04
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 7e-04
3ojy_A554 Complement component C8 alpha chain; macpf, lipoca 3e-04
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 8e-04
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 Back     alignment and structure
 Score =  339 bits (871), Expect = e-104
 Identities = 158/709 (22%), Positives = 273/709 (38%), Gaps = 90/709 (12%)

Query: 3   CIIAYWKCDGDEDCKDGSDELAEHCQDRKCDESHFTCNETLRCIPLAWACDGQPDCGLND 62
           CI  +W+CDG  DC +GSDE  + C  + C +  F C++  +CI   + CD         
Sbjct: 79  CIPQFWRCDGQVDCDNGSDE--QGCPPKTCSQDEFRCHDG-KCISRQFVCDS-------- 127

Query: 63  TSDEDHCVNDCTDWSDETNCTHSGNRTISAPACEPHEFDCQDVLRTCIPKALVCDGEPAC 122
                    DC D SDE +C            C P  F C     TCIP+   CD +P C
Sbjct: 128 -------DRDCLDGSDEASC--------PVLTCGPASFQCNS--STCIPQLWACDNDPDC 170

Query: 123 FNGEDEMF----------------------CDEKQCLRS----DCHHDCYNTPEGFMCVC 156
            +G DE                        C   +C+ S    D   DC +  +   C  
Sbjct: 171 EDGSDEWPQRCRGLYVFQGDSSPCSAFEFHCLSGECIHSSWRCDGGPDCKDKSDEENCAV 230

Query: 157 PRDMYLQPDLITCSYLHPCEAWGTCS--QDCEPSVSNNSYKC--TCHAGYELEPDMFTCK 212
                 +PD   CS  +       C    DC+             C    + +     C 
Sbjct: 231 AT---CRPDEFQCSDGNCIHGSRQCDREYDCKDMSDEVGCVNVTLCEGPNKFKCHSGECI 287

Query: 213 SKSK--NDSSPFVIFSNRHELRGVDLRTFNVIALISSLKNTIALDFYYTPTANMVFWTDV 270
           +  K  N +     +S+            +     S + N + + +              
Sbjct: 288 TLDKVCNMARDCRDWSDEPIKECGTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQR 347

Query: 271 IDDKIYNATLIGNSLSNIDVVVQTGLSTAEGLAVDWIGKNLYMFWAFWSLSPSNSSDGGI 330
             + I           +   V   G    +      +  +     A  S++    ++   
Sbjct: 348 RCEDIDECQ--DPDTCSQLCVNLEGGYKCQCEEGFQLDPHTKACKAVGSIAYLFFTNRHE 405

Query: 331 EKAGMHGENRSPLVTKNIQWPSSLVIDYNQDILYWCDSHLNTVESVRVDGSERTVSFNLE 390
            +      +    +  N++   +L  +   + +YW D     + S ++D +      +  
Sbjct: 406 VRKMTLDRSEYTSLIPNLRNVVALDTEVASNRIYWSDLSQRMICSTQLDRAHGV---SSY 462

Query: 391 VLGSDSRVGIPNCRPEDNLWIGKNLYWVESNLDQIEVAKLSGQFRRTLIAGDMESPRAIA 450
                  +  P+    D  WI  N+YW +S L  + VA   G  R+TL   +   PRAI 
Sbjct: 463 DTVISRDIQAPDGLAVD--WIHSNIYWTDSVLGTVSVADTKGVKRKTLFRENGSKPRAIV 520

Query: 451 LDPRFGLLFWTDWDSKAPRIERCSMSGEHRSVIVRVDLLTSRGAWPNGLTLDYQLTRIYW 510
           +DP  G ++WTDW +   +I++  ++G     +V  ++      WPNG+TLD    R+YW
Sbjct: 521 VDPVHGFMYWTDWGTP-AKIKKGGLNGVDIYSLVTENI-----QWPNGITLDLLSGRLYW 574

Query: 511 IDAKSDSIHTVTYDGKDHHVVLSNHDSLTHPFAIALFENHVYWTDWRTNSVIRANKWNGS 570
           +D+K  SI ++  +G +   +L +   L HPF++A+FE+ V+WTD    ++  AN+  GS
Sbjct: 575 VDSKLHSISSIDVNGGNRKTILEDEKRLAHPFSLAVFEDKVFWTDIINEAIFSANRLTGS 634

Query: 571 DVTLIQRTLTQPF-IYVNGVVKK----SPCE---MNNGNCSHLCLI-----GMNGTYKCQ 617
           DV L+   L  P  + +   + +    + CE   ++NG C +LCL        +  + C 
Sbjct: 635 DVNLLAENLLSPEDMVLFHNLTQPRGVNWCERTTLSNGGCQYLCLPAPQINPHSPKFTCA 694

Query: 618 CPHVMKLMSDNKTCQVADSQFIIFSRPREIRGVDLEHPYYHTIPTISIP 666
           CP  M L  D ++C + +++  + ++      + +      T  T + P
Sbjct: 695 CPDGMLLARDMRSC-LTEAEAAVATQETSTVRLKVSSTAVRTQHTTTRP 742


>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Length = 628 Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Length = 628 Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Length = 628 Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Length = 628 Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Length = 628 Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Length = 628 Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} Length = 619 Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} Length = 619 Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} Length = 619 Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} Length = 619 Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} Length = 619 Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} Length = 619 Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Length = 316 Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Length = 316 Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Length = 316 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Length = 318 Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Length = 318 Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Length = 318 Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Length = 318 Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Length = 318 Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Length = 318 Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Length = 267 Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Length = 267 Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Length = 267 Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Length = 349 Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Length = 349 Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Length = 349 Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Length = 302 Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Length = 302 Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Length = 302 Back     alignment and structure
>2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B Length = 82 Back     alignment and structure
>2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B Length = 82 Back     alignment and structure
>2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B Length = 82 Back     alignment and structure
>2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B Length = 80 Back     alignment and structure
>2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B Length = 80 Back     alignment and structure
>2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B Length = 80 Back     alignment and structure
>2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B Length = 80 Back     alignment and structure
>2gtl_O Extracellular hemoglobin linker L3 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 215 Back     alignment and structure
>2gtl_O Extracellular hemoglobin linker L3 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 215 Back     alignment and structure
>2gtl_O Extracellular hemoglobin linker L3 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 215 Back     alignment and structure
>2kny_A LRP-1, linker, APO-E; lipoprotein receptor, ligand binding module, COMP repeat, calcium, cell membrane, coated PIT, cytoplasm, DEVE protein; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2kny_A LRP-1, linker, APO-E; lipoprotein receptor, ligand binding module, COMP repeat, calcium, cell membrane, coated PIT, cytoplasm, DEVE protein; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2kny_A LRP-1, linker, APO-E; lipoprotein receptor, ligand binding module, COMP repeat, calcium, cell membrane, coated PIT, cytoplasm, DEVE protein; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Length = 565 Back     alignment and structure
>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Length = 565 Back     alignment and structure
>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Length = 565 Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 Back     alignment and structure
>2gtl_M Hemoglobin linker chain L1; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 217 Back     alignment and structure
>2gtl_M Hemoglobin linker chain L1; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 217 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2gtl_N Extracellular hemoglobin linker L2 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 220 Back     alignment and structure
>2gtl_N Extracellular hemoglobin linker L2 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 220 Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Length = 87 Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Length = 87 Back     alignment and structure
>2knx_A Prolow-density lipoprotein receptor-related prote; LDLR, ligand binding module, ligand binding repeat, compleme repeat, protein binding; NMR {Homo sapiens} Length = 50 Back     alignment and structure
>2knx_A Prolow-density lipoprotein receptor-related prote; LDLR, ligand binding module, ligand binding repeat, compleme repeat, protein binding; NMR {Homo sapiens} Length = 50 Back     alignment and structure
>2knx_A Prolow-density lipoprotein receptor-related prote; LDLR, ligand binding module, ligand binding repeat, compleme repeat, protein binding; NMR {Homo sapiens} Length = 50 Back     alignment and structure
>2i1p_A Low-density lipoprotein receptor-related protein 2; cysteine-rich repeat, ligand binding domain, calcium CAGE, ligand binding protein; NMR {Rattus norvegicus} Length = 48 Back     alignment and structure
>2i1p_A Low-density lipoprotein receptor-related protein 2; cysteine-rich repeat, ligand binding domain, calcium CAGE, ligand binding protein; NMR {Rattus norvegicus} Length = 48 Back     alignment and structure
>2i1p_A Low-density lipoprotein receptor-related protein 2; cysteine-rich repeat, ligand binding domain, calcium CAGE, ligand binding protein; NMR {Rattus norvegicus} Length = 48 Back     alignment and structure
>1cr8_A Protein (LOW density lipoprotein receptor related protein); ligand binding, calcium binding, LDLR, LRP, lipid binding protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 42 Back     alignment and structure
>1cr8_A Protein (LOW density lipoprotein receptor related protein); ligand binding, calcium binding, LDLR, LRP, lipid binding protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 42 Back     alignment and structure
>1cr8_A Protein (LOW density lipoprotein receptor related protein); ligand binding, calcium binding, LDLR, LRP, lipid binding protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 42 Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Length = 299 Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Length = 299 Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Length = 299 Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Length = 300 Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Length = 300 Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Length = 300 Back     alignment and structure
>2jm4_A Relaxin receptor 1; LDL-A module, RXFP1 receptor, LGR7, signaling protein; NMR {Homo sapiens} Length = 43 Back     alignment and structure
>2jm4_A Relaxin receptor 1; LDL-A module, RXFP1 receptor, LGR7, signaling protein; NMR {Homo sapiens} Length = 43 Back     alignment and structure
>2jm4_A Relaxin receptor 1; LDL-A module, RXFP1 receptor, LGR7, signaling protein; NMR {Homo sapiens} Length = 43 Back     alignment and structure
>3a7q_B Low-density lipoprotein receptor-related protein; signaling protein; HET: NAG; 2.60A {Homo sapiens} Length = 44 Back     alignment and structure
>3a7q_B Low-density lipoprotein receptor-related protein; signaling protein; HET: NAG; 2.60A {Homo sapiens} Length = 44 Back     alignment and structure
>3a7q_B Low-density lipoprotein receptor-related protein; signaling protein; HET: NAG; 2.60A {Homo sapiens} Length = 44 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>1k7b_A Subgroup A ROUS sarcoma virus receptor PG800 and PG950; beta hairpin, 3-10 helix, calcium binding, membrane protein; NMR {Coturnix coturnix} SCOP: g.12.1.1 Length = 47 Back     alignment and structure
>1k7b_A Subgroup A ROUS sarcoma virus receptor PG800 and PG950; beta hairpin, 3-10 helix, calcium binding, membrane protein; NMR {Coturnix coturnix} SCOP: g.12.1.1 Length = 47 Back     alignment and structure
>1k7b_A Subgroup A ROUS sarcoma virus receptor PG800 and PG950; beta hairpin, 3-10 helix, calcium binding, membrane protein; NMR {Coturnix coturnix} SCOP: g.12.1.1 Length = 47 Back     alignment and structure
>1d2l_A Lipoprotein receptor related protein; ligand binding, calcium binding, complement-like repeat, signaling protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 45 Back     alignment and structure
>1d2l_A Lipoprotein receptor related protein; ligand binding, calcium binding, complement-like repeat, signaling protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 45 Back     alignment and structure
>1d2l_A Lipoprotein receptor related protein; ligand binding, calcium binding, complement-like repeat, signaling protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 45 Back     alignment and structure
>1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* Length = 69 Back     alignment and structure
>1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* Length = 69 Back     alignment and structure
>1j8e_A Low-density lipoprotein receptor-related protein 1; ligand binding, calcium binding, complement-like repeat, LRP receptor, signaling protein; 1.85A {Homo sapiens} SCOP: g.12.1.1 Length = 44 Back     alignment and structure
>1j8e_A Low-density lipoprotein receptor-related protein 1; ligand binding, calcium binding, complement-like repeat, LRP receptor, signaling protein; 1.85A {Homo sapiens} SCOP: g.12.1.1 Length = 44 Back     alignment and structure
>1j8e_A Low-density lipoprotein receptor-related protein 1; ligand binding, calcium binding, complement-like repeat, LRP receptor, signaling protein; 1.85A {Homo sapiens} SCOP: g.12.1.1 Length = 44 Back     alignment and structure
>3dpr_E LDL-receptor class A 3; human rhinovirus, VLDL-receptor, virus-protein complex, icosahedral virus, ATP-binding, capsid protein; HET: DAO; 3.50A {Homo sapiens} PDB: 1v9u_5* Length = 39 Back     alignment and structure
>3dpr_E LDL-receptor class A 3; human rhinovirus, VLDL-receptor, virus-protein complex, icosahedral virus, ATP-binding, capsid protein; HET: DAO; 3.50A {Homo sapiens} PDB: 1v9u_5* Length = 39 Back     alignment and structure
>3dpr_E LDL-receptor class A 3; human rhinovirus, VLDL-receptor, virus-protein complex, icosahedral virus, ATP-binding, capsid protein; HET: DAO; 3.50A {Homo sapiens} PDB: 1v9u_5* Length = 39 Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Length = 118 Back     alignment and structure
>2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* Length = 59 Back     alignment and structure
>2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* Length = 59 Back     alignment and structure
>1ajj_A LR5, low-density lipoprotein receptor; LDL receptor, cysteine-rich module, calcium; 1.70A {Homo sapiens} SCOP: g.12.1.1 Length = 37 Back     alignment and structure
>1ajj_A LR5, low-density lipoprotein receptor; LDL receptor, cysteine-rich module, calcium; 1.70A {Homo sapiens} SCOP: g.12.1.1 Length = 37 Back     alignment and structure
>1ajj_A LR5, low-density lipoprotein receptor; LDL receptor, cysteine-rich module, calcium; 1.70A {Homo sapiens} SCOP: g.12.1.1 Length = 37 Back     alignment and structure
>1jrf_A TVA LDL-A module, subgroup A ROUS sarcoma virus receptors PG800 and PG950; disulfide bond, alpha helix, calcium CAGE, signaling protein; NMR {Coturnix japonica} SCOP: g.12.1.1 Length = 47 Back     alignment and structure
>1jrf_A TVA LDL-A module, subgroup A ROUS sarcoma virus receptors PG800 and PG950; disulfide bond, alpha helix, calcium CAGE, signaling protein; NMR {Coturnix japonica} SCOP: g.12.1.1 Length = 47 Back     alignment and structure
>1jrf_A TVA LDL-A module, subgroup A ROUS sarcoma virus receptors PG800 and PG950; disulfide bond, alpha helix, calcium CAGE, signaling protein; NMR {Coturnix japonica} SCOP: g.12.1.1 Length = 47 Back     alignment and structure
>2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* Length = 53 Back     alignment and structure
>2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* Length = 53 Back     alignment and structure
>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 Length = 51 Back     alignment and structure
>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 Length = 51 Back     alignment and structure
>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 Length = 51 Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86 Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 Back     alignment and structure
>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Length = 55 Back     alignment and structure
>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Length = 55 Back     alignment and structure
>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Length = 55 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Length = 306 Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Length = 409 Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Length = 186 Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Length = 186 Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Length = 53 Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Length = 53 Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Length = 53 Back     alignment and structure
>3ojy_A Complement component C8 alpha chain; macpf, lipocalin, immune system; HET: TPO BMA; 2.51A {Homo sapiens} Length = 554 Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query841
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 100.0
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 100.0
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 100.0
3s94_A 619 LRP-6, low-density lipoprotein receptor-related pr 100.0
3p5b_L400 Low density lipoprotein receptor variant; B-propel 100.0
3v65_B386 Low-density lipoprotein receptor-related protein; 100.0
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 100.0
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 100.0
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 100.0
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 100.0
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 100.0
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 100.0
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 100.0
3p5b_L400 Low density lipoprotein receptor variant; B-propel 100.0
3v65_B386 Low-density lipoprotein receptor-related protein; 100.0
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 100.0
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 99.96
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 99.94
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 99.94
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 99.94
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 99.91
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 99.85
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 99.84
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 99.83
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 99.82
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 99.82
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.81
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.81
3kya_A496 Putative phosphatase; structural genomics, joint c 99.81
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.77
3kya_A496 Putative phosphatase; structural genomics, joint c 99.77
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.77
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.76
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.76
2fp8_A322 Strictosidine synthase; six bladed beta propeller 99.75
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.74
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.74
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.73
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.7
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.69
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.64
2fyj_A82 Low-density lipoprotein receptor-related protein 1 99.63
2p4o_A306 Hypothetical protein; putative lactonase, structur 99.63
2fp8_A322 Strictosidine synthase; six bladed beta propeller 99.61
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.6
2fcw_B80 LDL receptor, low-density lipoprotein receptor; pr 99.59
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.58
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.58
2p4o_A306 Hypothetical protein; putative lactonase, structur 99.56
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 99.56
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 99.55
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.55
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.55
2fyj_A82 Low-density lipoprotein receptor-related protein 1 99.55
2fcw_B80 LDL receptor, low-density lipoprotein receptor; pr 99.52
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 99.51
2qe8_A343 Uncharacterized protein; structural genomics, join 99.5
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.49
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.49
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 99.45
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 99.44
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.43
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 99.43
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.42
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.42
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.41
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.4
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 99.4
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.39
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 99.39
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 99.38
2qe8_A343 Uncharacterized protein; structural genomics, join 99.37
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.37
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.35
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.33
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.31
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.3
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.3
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 99.29
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.29
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.27
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 99.27
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 99.26
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 99.26
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 99.26
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 99.25
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 99.22
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 99.22
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 99.21
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 99.21
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.18
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.18
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.17
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 99.16
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 99.15
1cru_A454 Protein (soluble quinoprotein glucose dehydrogena; 99.12
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 99.12
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 99.12
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 99.11
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.1
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 99.1
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 99.09
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 99.09
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 99.09
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.07
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 99.06
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.05
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.05
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.02
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 99.02
2bou_A143 EGF-like module containing mucin-like hormone rece 99.01
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.01
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 98.99
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 98.99
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 98.99
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 98.98
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 98.97
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 98.94
2xrc_A565 Human complement factor I; immune system, hydrolas 98.93
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 98.92
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 98.89
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.89
2kny_A80 LRP-1, linker, APO-E; lipoprotein receptor, ligand 98.88
1cr8_A42 Protein (LOW density lipoprotein receptor related 98.84
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 98.83
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.81
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.81
2ymu_A577 WD-40 repeat protein; unknown function, two domain 98.79
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 98.78
1ajj_A37 LR5, low-density lipoprotein receptor; LDL recepto 98.78
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 98.78
3dpr_E39 LDL-receptor class A 3; human rhinovirus, VLDL-rec 98.77
2gtl_O215 Extracellular hemoglobin linker L3 subunit; anneli 98.77
2jm4_A43 Relaxin receptor 1; LDL-A module, RXFP1 receptor, 98.77
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 98.76
1d2l_A45 Lipoprotein receptor related protein; ligand bindi 98.75
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 98.75
3a7q_B44 Low-density lipoprotein receptor-related protein; 98.74
2m0p_A52 Low-density lipoprotein receptor-related protein; 98.74
1k7b_A47 Subgroup A ROUS sarcoma virus receptor PG800 and P 98.73
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 98.73
2knx_A50 Prolow-density lipoprotein receptor-related prote; 98.72
2xrc_A565 Human complement factor I; immune system, hydrolas 98.72
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 98.68
2i1p_A48 Low-density lipoprotein receptor-related protein 2 98.68
2ece_A462 462AA long hypothetical selenium-binding protein; 98.68
1cru_A454 Protein (soluble quinoprotein glucose dehydrogena; 98.67
1jrf_A47 TVA LDL-A module, subgroup A ROUS sarcoma virus re 98.66
2jkh_L55 Factor X light chain; plasma, calcium, zymogen, se 98.66
1yo8_A634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 98.66
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 98.64
2ymu_A577 WD-40 repeat protein; unknown function, two domain 98.64
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 98.63
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 98.6
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.6
1aut_L114 Activated protein C; serine proteinase, plasma cal 98.59
1j8e_A44 Low-density lipoprotein receptor-related protein 1 98.57
2wph_E59 Coagulation factor IXA light chain; serine proteas 98.56
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 98.55
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 98.55
1k32_A 1045 Tricorn protease; protein degradation, substrate g 98.53
1kig_L51 Factor XA; glycoprotein, serine protease, plasma, 98.52
1kli_L69 Factor VIIA; extrinsic coagulation pathway, serine 98.5
3q6k_A381 43.2 kDa salivary protein; beta propeller, binding 98.5
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 98.49
2vh0_B134 Activated factor XA light chain; serine protease, 98.48
2bz6_L53 Blood coagulation factor VIIA; serine protease, en 98.47
1k32_A 1045 Tricorn protease; protein degradation, substrate g 98.44
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 98.42
2ece_A462 462AA long hypothetical selenium-binding protein; 98.42
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 98.39
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 98.38
1aut_L114 Activated protein C; serine proteinase, plasma cal 98.37
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 98.37
3q6k_A381 43.2 kDa salivary protein; beta propeller, binding 98.35
2kny_A80 LRP-1, linker, APO-E; lipoprotein receptor, ligand 98.34
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 98.34
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 98.33
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 98.32
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 98.29
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 98.27
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 98.26
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 98.25
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 98.23
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 98.22
1kli_L69 Factor VIIA; extrinsic coagulation pathway, serine 98.22
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 98.22
1cr8_A42 Protein (LOW density lipoprotein receptor related 98.22
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 98.21
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 98.2
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 98.19
1ajj_A37 LR5, low-density lipoprotein receptor; LDL recepto 98.19
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 98.18
2knx_A50 Prolow-density lipoprotein receptor-related prote; 98.15
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 98.14
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 98.13
2gtl_O215 Extracellular hemoglobin linker L3 subunit; anneli 98.13
1d2l_A45 Lipoprotein receptor related protein; ligand bindi 98.12
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 98.12
2wph_E59 Coagulation factor IXA light chain; serine proteas 98.12
2i1p_A48 Low-density lipoprotein receptor-related protein 2 98.12
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 98.12
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 98.11
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 98.11
2m0p_A52 Low-density lipoprotein receptor-related protein; 98.1
3dpr_E39 LDL-receptor class A 3; human rhinovirus, VLDL-rec 98.1
2jm4_A43 Relaxin receptor 1; LDL-A module, RXFP1 receptor, 98.09
2bz6_L53 Blood coagulation factor VIIA; serine protease, en 98.08
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 98.08
2gtl_M217 Hemoglobin linker chain L1; annelid erythrocruorin 98.07
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 98.06
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 98.06
1k7b_A47 Subgroup A ROUS sarcoma virus receptor PG800 and P 98.05
2vh0_B134 Activated factor XA light chain; serine protease, 98.05
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 98.05
3a7q_B44 Low-density lipoprotein receptor-related protein; 98.04
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 98.03
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 98.01
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 98.01
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 97.99
1yo8_A634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 97.98
2bou_A143 EGF-like module containing mucin-like hormone rece 97.97
2gtl_N220 Extracellular hemoglobin linker L2 subunit; anneli 97.95
1jrf_A47 TVA LDL-A module, subgroup A ROUS sarcoma virus re 97.93
2gtl_N220 Extracellular hemoglobin linker L2 subunit; anneli 97.92
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 97.9
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 97.9
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 97.9
1j8e_A44 Low-density lipoprotein receptor-related protein 1 97.9
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 97.89
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 97.89
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 97.88
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 97.88
2jkh_L55 Factor X light chain; plasma, calcium, zymogen, se 97.88
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 97.86
1kig_L51 Factor XA; glycoprotein, serine protease, plasma, 97.83
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 97.81
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 97.81
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 97.81
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 97.77
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 97.77
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 97.75
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 97.73
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 97.71
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 97.7
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 97.68
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 97.65
3ojy_B537 Complement component C8 beta chain; macpf, lipocal 97.63
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 97.59
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 97.55
2gtl_M217 Hemoglobin linker chain L1; annelid erythrocruorin 97.53
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 97.51
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 97.47
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 97.44
3ojy_A554 Complement component C8 alpha chain; macpf, lipoca 97.43
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 97.4
3ow8_A321 WD repeat-containing protein 61; structural genomi 97.38
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 97.36
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 97.36
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 97.33
4g56_B357 MGC81050 protein; protein arginine methyltransfera 97.33
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 97.29
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 97.26
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 97.24
2xyi_A430 Probable histone-binding protein CAF1; transcripti 97.23
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 97.23
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 97.22
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 97.17
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 97.15
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 97.12
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 97.1
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 97.09
3f1s_B283 Vitamin K-dependent protein Z; PZ, ZPI, complex, s 97.09
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 97.09
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 97.09
2xyi_A430 Probable histone-binding protein CAF1; transcripti 97.08
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 96.98
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 96.96
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 96.87
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 96.86
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 96.85
4g56_B357 MGC81050 protein; protein arginine methyltransfera 96.85
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 96.85
4a2l_A795 BT_4663, two-component system sensor histidine kin 96.83
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 96.8
4a9v_A592 PHOX; hydrolase, beta-propeller; 1.10A {Pseudomona 96.8
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 96.78
1szb_A170 Mannose binding lectin-associated serine protease- 96.78
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 96.76
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 96.76
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 96.75
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 96.72
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 96.71
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 96.71
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 96.7
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 96.64
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 96.63
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 96.61
3ojy_A554 Complement component C8 alpha chain; macpf, lipoca 96.6
1szb_A170 Mannose binding lectin-associated serine protease- 96.6
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 96.58
4a9v_A592 PHOX; hydrolase, beta-propeller; 1.10A {Pseudomona 96.51
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 96.51
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 96.5
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 96.49
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 96.46
3ojy_B537 Complement component C8 beta chain; macpf, lipocal 96.44
3ow8_A321 WD repeat-containing protein 61; structural genomi 96.39
3jrp_A379 Fusion protein of protein transport protein SEC13 96.35
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 96.3
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 96.28
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 96.2
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 96.17
2kl7_A71 Fibulin-4; secreted, calcium, disease mutation, di 96.16
3jrp_A379 Fusion protein of protein transport protein SEC13 96.15
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 96.09
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 96.08
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 96.05
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 96.04
3t5o_A913 Complement component C6; macpf, MAC, membrane atta 96.0
1nzi_A159 Complement C1S component; calcium, innate immunity 95.94
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 95.93
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 95.92
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 95.91
1gl4_A285 Nidogen-1, entactin; immunoglobulin-like domain, e 95.88
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 95.84
3v9f_A781 Two-component system sensor histidine kinase/RESP 95.84
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 95.84
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 95.77
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 95.72
1nzi_A159 Complement C1S component; calcium, innate immunity 95.69
4e54_B435 DNA damage-binding protein 2; beta barrel, double 95.62
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 95.6
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 95.53
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 95.49
3f1s_B283 Vitamin K-dependent protein Z; PZ, ZPI, complex, s 95.46
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 95.43
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 95.41
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 95.29
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 95.22
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 95.15
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 95.12
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 95.09
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 95.03
4e54_B435 DNA damage-binding protein 2; beta barrel, double 94.95
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 94.95
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 94.76
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 94.74
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 94.71
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 94.7
2kl7_A71 Fibulin-4; secreted, calcium, disease mutation, di 94.68
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 94.66
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 94.63
3jro_A 753 Fusion protein of protein transport protein SEC13 94.44
2k2s_B61 Micronemal protein 6; microneme protein complex, c 94.32
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 94.18
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 94.16
4a2l_A 795 BT_4663, two-component system sensor histidine kin 93.78
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 93.65
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 93.64
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 93.49
3jro_A 753 Fusion protein of protein transport protein SEC13 93.46
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 93.44
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 93.43
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 93.35
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 93.2
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 93.13
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 92.91
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 92.91
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 92.9
1gl4_A285 Nidogen-1, entactin; immunoglobulin-like domain, e 92.25
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 92.11
1kv9_A668 Type II quinohemoprotein alcohol dehydrogenase; el 92.08
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 91.86
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 91.81
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 91.71
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 91.4
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 91.21
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 91.18
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 91.16
1a3p_A45 Epidermal growth factor; disulfide connectivities, 90.8
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 90.69
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 90.45
3v9f_A 781 Two-component system sensor histidine kinase/RESP 90.42
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 90.41
1kv9_A668 Type II quinohemoprotein alcohol dehydrogenase; el 90.36
3zwu_A592 Alkaline phosphatase PHOX; hydrolase, beta-propell 90.29
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 90.04
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 89.83
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 89.77
1n1i_A105 Merozoite surface protein-1; MSP1, malaria, surfac 89.42
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 89.38
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 89.2
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 89.15
3zwu_A592 Alkaline phosphatase PHOX; hydrolase, beta-propell 89.13
3t5o_A913 Complement component C6; macpf, MAC, membrane atta 89.08
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 88.54
2pm7_B297 Protein transport protein SEC13, protein transport 88.41
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 88.1
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 87.85
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 87.42
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 86.94
1ob1_C99 Major merozoite surface protein; immune system, im 86.9
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 86.77
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 86.6
2k2s_B61 Micronemal protein 6; microneme protein complex, c 86.58
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 86.36
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 85.99
2pm7_B297 Protein transport protein SEC13, protein transport 85.81
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 85.71
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 85.68
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 85.57
3ca7_A52 Protein spitz; argos, EGF, developmental protein, 85.39
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 85.32
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 84.59
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 84.26
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 84.26
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 83.66
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 83.27
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 83.05
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 82.12
1nt0_A286 MAsp2, mannose-binding protein associated serine p 82.01
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 81.91
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 81.82
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 81.62
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 81.54
3dem_A278 Complement factor MAsp-3; complement system, innat 80.58
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=3.6e-83  Score=767.17  Aligned_cols=505  Identities=36%  Similarity=0.771  Sum_probs=375.4

Q ss_pred             eeccCccCcCCcCCCCCCCCCCCCCCC--------CCCCCCCCcccCCCCeEecCCCCCCCCCCcccCCCCCCCcc----
Q psy14257          2 TCIIAYWKCDGDEDCKDGSDELAEHCQ--------DRKCDESHFTCNETLRCIPLAWACDGQPDCGLNDTSDEDHC----   69 (841)
Q Consensus         2 ~Ci~~~~~Cdg~~dC~dgsde~~~~C~--------~~~C~~~~~~C~~~~~Ci~~~~~Cdg~~dC~~~d~sde~~C----   69 (841)
                      +|||..|+|||+.||.|||||.+++|.        ...|...+|+|. +++||+..|+|||..||.  |+|||.+|    
T Consensus       156 ~Ci~~~~~Cdg~~dC~dgsDE~~~~C~~~~~~~~~~~~C~~~~f~C~-~g~Ci~~~~~CDg~~dC~--dgsDE~~C~~~~  232 (791)
T 3m0c_C          156 TCIPQLWACDNDPDCEDGSDEWPQRCRGLYVFQGDSSPCSAFEFHCL-SGECIHSSWRCDGGPDCK--DKSDEENCAVAT  232 (791)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             ccccccccCCCCCcCCCCCCcccccCCCccccCCCCCCCCCCccccc-CCceeccccccCCCCCCC--CCCCCCCccccc
Confidence            599999999999999999999877783        357999999998 889999999999999999  99999887    


Q ss_pred             ----------------------ccCCCCCCCCCCccCCCCCCCCCCCC-CCCCcccCCCCCeEecCCCCCCCCCCCCCCC
Q psy14257         70 ----------------------VNDCTDWSDETNCTHSGNRTISAPAC-EPHEFDCQDVLRTCIPKALVCDGEPACFNGE  126 (841)
Q Consensus        70 ----------------------~~dC~~~~de~~C~~c~~~~~c~~~C-~~~~~~C~~~~~~Ci~~~~~Cdg~~~C~~g~  126 (841)
                                            ..||.|++||.+|..       ...| .+.+|+|.+  +.||+...+|++..+|.+|+
T Consensus       233 C~~~~f~C~~g~Ci~~~~~Cdg~~dC~dgsDE~~C~~-------~~~C~~~~~~~C~~--G~Ci~~~~~Cd~~~dC~dgs  303 (791)
T 3m0c_C          233 CRPDEFQCSDGNCIHGSRQCDREYDCKDMSDEVGCVN-------VTLCEGPNKFKCHS--GECITLDKVCNMARDCRDWS  303 (791)
T ss_dssp             -----------------------------------------------CCSTTCCCCTT--SCCCCSSCCSCSSCCSSSSC
T ss_pred             cCCCcceecCCceEecceecCChhccccccccCcccc-------cccccCCCccccCC--CcccccccccCCcccccccc
Confidence                                  347888888888764       2335 467899998  89999999999999999999


Q ss_pred             CCcc--c--ccccccCCCCCCCcccCCCCcEEecCCCceecCCCCccccccccCCCCCccCceeecCCCCceEEeecCCe
Q psy14257        127 DEMF--C--DEKQCLRSDCHHDCYNTPEGFMCVCPRDMYLQPDLITCSYLHPCEAWGTCSQDCEPSVSNNSYKCTCHAGY  202 (841)
Q Consensus       127 de~~--C--~eC~~~~~~C~~~C~~~~g~~~C~C~~Gy~l~~d~~~C~~~~eC~~~~~Cs~~C~~~~~~g~~~C~C~~G~  202 (841)
                      ||..  |  +||...++.|++.|.+++++|.|.|++||.+ .+++.|++++||..++.|++.|.|+  .|+|+|.|.+||
T Consensus       304 De~~~~C~~~~C~~~~~~C~~~C~~~~~~y~C~C~~Gy~l-~~g~~C~dideC~~~~~C~~~C~n~--~gsy~C~C~~Gy  380 (791)
T 3m0c_C          304 DEPIKECGTNECLDNNGGCSHVCNDLKIGYECLCPDGFQL-VAQRRCEDIDECQDPDTCSQLCVNL--EGGYKCQCEEGF  380 (791)
T ss_dssp             SCCCTTBSCCSTTTGGGGCSSEEEECSBSEEEECCTTCEE-ETTTEEECCCCCSSSSSCTTTCCBC--SSCBCCCCCSSE
T ss_pred             CccccccccccccccccCccccccCCCCCcccCCCCCCcc-CCCCccccCcccCCCCCCCCeeecC--CCCceeecCCCC
Confidence            9965  7  7898777899999999999999999999998 6899999999998778999999999  999999999999


Q ss_pred             eecCCCCceEeCCCCCCCCeEEeccCccccccccccccEEEEeccccceeeecccccCCcceeEEEecCCCeEEEEEecC
Q psy14257        203 ELEPDMFTCKSKSKNDSSPFVIFSNRHELRGVDLRTFNVIALISSLKNTIALDFYYTPTANMVFWTDVIDDKIYNATLIG  282 (841)
Q Consensus       203 ~l~~d~~~C~~~~~~~~~p~ll~s~~~~I~~~~~~~~~~~~l~~~~~~~~avd~~~~~~~~~lyw~d~~~~~I~~~~~~~  282 (841)
                      .+..++++|+++   ...++|++++.++|++++++...+..++.+++.++||+|+...++  |||+|...++|+++++++
T Consensus       381 ~l~~~~~~C~~~---~~~p~Ll~an~~~Ir~i~l~~~~~~~l~~~~~~~~gl~~d~~~~~--lY~sD~~~~~I~~~~l~g  455 (791)
T 3m0c_C          381 QLDPHTKACKAV---GSIAYLFFTNRHEVRKMTLDRSEYTSLIPNLRNVVALDTEVASNR--IYWSDLSQRMICSTQLDR  455 (791)
T ss_dssp             ECCSSCCCCEET---TSCCEEEEECBSSEEEECTTSCCCEEEECSCSSEEEEEEETTTTE--EEEEETTTTEEEEEEC--
T ss_pred             EeCCCCceeeec---ccccccccccccceeEeeccCCcceeeecCCCceEEEeecccCCe--eEEeeccceeEEEEeccC
Confidence            999999999998   467899999999999999999888889999999999999997766  999999999999999876


Q ss_pred             Ccc-cceEEEEeCCCCCccceEEeeecCceeEEEeeecCCCCCCCCCCEEEEccCCCccccccccCcCCCceEEEEccCC
Q psy14257        283 NSL-SNIDVVVQTGLSTAEGLAVDWIGKNLYMFWAFWSLSPSNSSDGGIEKAGMHGENRSPLVTKNIQWPSSLVIDYNQD  361 (841)
Q Consensus       283 ~~~-~~~~~~~~~~l~~p~giavD~~~~~~y~~~td~~~~~~~~~~~~I~~~~~dG~~~~~l~~~~~~~P~glavD~~~~  361 (841)
                      ... ....+++..++..|.||||||.+                                                     
T Consensus       456 ~~~~~~~~~vi~~~l~~P~GLAvD~~~-----------------------------------------------------  482 (791)
T 3m0c_C          456 AHGVSSYDTVISRDIQAPDGLAVDWIH-----------------------------------------------------  482 (791)
T ss_dssp             ------CEEEECSSCSCCCEEEEETTT-----------------------------------------------------
T ss_pred             CCCCcceeEEEecCCCCcceeeeeecC-----------------------------------------------------
Confidence            321 13445555567777777777654                                                     


Q ss_pred             EEEEEeCCCCeEEEEEecCCccEEEEeeeeecCCCccccCCCCCCccccccceEEEEecCCCcEEEEccCCceEEEEecC
Q psy14257        362 ILYWCDSHLNTVESVRVDGSERTVSFNLEVLGSDSRVGIPNCRPEDNLWIGKNLYWVESNLDQIEVAKLSGQFRRTLIAG  441 (841)
Q Consensus       362 ~lYwaD~~~~~I~~~~ldG~~~~~~~~~~~~~~~~~~~i~~~~~~avdw~~~~LY~tD~~~~~I~v~~~~G~~~~~l~~~  441 (841)
                                                                         ++|||+|...++|++++++|+.+++++..
T Consensus       483 ---------------------------------------------------~~LY~tD~~~~~I~v~~ldG~~~~~l~~~  511 (791)
T 3m0c_C          483 ---------------------------------------------------SNIYWTDSVLGTVSVADTKGVKRKTLFRE  511 (791)
T ss_dssp             ---------------------------------------------------TEEEEEETTTTEEEEEETTSSSEEEEEEC
T ss_pred             ---------------------------------------------------CcEEEEecCCCeEEEEeCCCCeEEEEEeC
Confidence                                                               77888888888999999999999888888


Q ss_pred             CCCCceeEEEcCCCCeEEEEecCCCCCeEEEecCCCCCcEEEEEecccCCCCCCceeEEEeccCCEEEEEeCCCCeEEEE
Q psy14257        442 DMESPRAIALDPRFGLLFWTDWDSKAPRIERCSMSGEHRSVIVRVDLLTSRGAWPNGLTLDYQLTRIYWIDAKSDSIHTV  521 (841)
Q Consensus       442 ~l~~P~giavd~~~g~Ly~td~~~~~~~I~r~~ldG~~~~~i~~~~~~~~~~~~P~glalD~~~~~LYw~d~~~~~I~~~  521 (841)
                      .+..|+||||||.+|+||||||+. .++|+|++|||+.+++++.     ..+.+|+|||||+.+++|||+|.+.++|+++
T Consensus       512 ~l~~P~gIaVDp~~g~LYwtD~g~-~~~I~~~~~dG~~~~~lv~-----~~l~~P~GLavD~~~~~LYwaD~~~~~I~~~  585 (791)
T 3m0c_C          512 NGSKPRAIVVDPVHGFMYWTDWGT-PAKIKKGGLNGVDIYSLVT-----ENIQWPNGITLDLLSGRLYWVDSKLHSISSI  585 (791)
T ss_dssp             TTCCEEEEEEETTTTEEEEEECSS-SCEEEEEETTSCCEEEEEC-----SSCSCEEEEEEETTTTEEEEEETTTTEEEEE
T ss_pred             CCCCcceEEEecCCCCEEEecCCC-CCeEEEEecCCCceEEEEe-----CCCCCceEEEEecCCCeEEEEeCCCCcEEEE
Confidence            899999999999999999999983 4899999999999999987     6889999999999999999999999999999


Q ss_pred             EcCCCeeEEEEcCCCCCCcceEEEEecCeEEEEeCCCCeEEEEeccCCcceEEEecccCCCce---ec--cCCcccCCCC
Q psy14257        522 TYDGKDHHVVLSNHDSLTHPFAIALFENHVYWTDWRTNSVIRANKWNGSDVTLIQRTLTQPFI---YV--NGVVKKSPCE  596 (841)
Q Consensus       522 ~~dG~~~~~i~~~~~~l~~P~gla~~~~~lY~td~~~~~i~~~~~~~g~~~~~i~~~~~~p~~---~h--~qp~~~n~C~  596 (841)
                      +++|..+++++.....+.+|+||++++++|||+||.+++|++++|.+|+.+.++...+..|++   +|  +||.+.|||.
T Consensus       586 d~dG~~~~~v~~~~~~l~~P~glav~~~~lYwtD~~~~~I~~~dk~tG~~~~~l~~~l~~P~~i~v~h~~~Qp~~~N~C~  665 (791)
T 3m0c_C          586 DVNGGNRKTILEDEKRLAHPFSLAVFEDKVFWTDIINEAIFSANRLTGSDVNLLAENLLSPEDMVLFHNLTQPRGVNWCE  665 (791)
T ss_dssp             ETTSCSCEEEEECTTTTSSEEEEEEETTEEEEEETTTTEEEEEETTTCCCCEEEECSCSCCCCEEEESGGGSCCCCCTTT
T ss_pred             ecCCCceEEEecCCCccCCCCEEEEeCCEEEEEECCCCEEEEEeCCCCcceEEeecCCCCceeEeeeccccCCCCCCccc
Confidence            999999999987766789999999999999999999999999999999999999888889988   66  8999999999


Q ss_pred             C---CCCCCccccccCCC-----CceeeeCCCCceeecCCCcccccCc
Q psy14257        597 M---NNGNCSHLCLIGMN-----GTYKCQCPHVMKLMSDNKTCQVADS  636 (841)
Q Consensus       597 ~---~ng~Cs~lC~~~~~-----~~~~C~Cp~g~~l~~d~~tC~~~~~  636 (841)
                      .   +||+|+||||+.+.     .+|+|+||+||.|.+|+++|...++
T Consensus       666 ~~~~~ng~CshlCl~~p~~~~~~~~~~C~Cp~g~~L~~d~~tC~~~~~  713 (791)
T 3m0c_C          666 RTTLSNGGCQYLCLPAPQINPHSPKFTCACPDGMLLARDMRSCLTEAE  713 (791)
T ss_dssp             SSSSGGGGCSSEEEECCCCSTTCCSEEEECCTTCEECTTSSCEEC---
T ss_pred             ccCCCCcCcCeeecCCCCcCCCCCCceeECCCCCEECCCCCcCCCCCC
Confidence            7   79999999999874     2599999999999999999985443



>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B Back     alignment and structure
>2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2kny_A LRP-1, linker, APO-E; lipoprotein receptor, ligand binding module, COMP repeat, calcium, cell membrane, coated PIT, cytoplasm, DEVE protein; NMR {Homo sapiens} Back     alignment and structure
>1cr8_A Protein (LOW density lipoprotein receptor related protein); ligand binding, calcium binding, LDLR, LRP, lipid binding protein; NMR {Homo sapiens} SCOP: g.12.1.1 Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>1ajj_A LR5, low-density lipoprotein receptor; LDL receptor, cysteine-rich module, calcium; 1.70A {Homo sapiens} SCOP: g.12.1.1 Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3dpr_E LDL-receptor class A 3; human rhinovirus, VLDL-receptor, virus-protein complex, icosahedral virus, ATP-binding, capsid protein; HET: DAO; 3.50A {Homo sapiens} PDB: 1v9u_5* Back     alignment and structure
>2gtl_O Extracellular hemoglobin linker L3 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Back     alignment and structure
>2jm4_A Relaxin receptor 1; LDL-A module, RXFP1 receptor, LGR7, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>1d2l_A Lipoprotein receptor related protein; ligand binding, calcium binding, complement-like repeat, signaling protein; NMR {Homo sapiens} SCOP: g.12.1.1 Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3a7q_B Low-density lipoprotein receptor-related protein; signaling protein; HET: NAG; 2.60A {Homo sapiens} Back     alignment and structure
>2m0p_A Low-density lipoprotein receptor-related protein; complement type repeat, megalin, LDL receptor FAMI lipid binding protein; NMR {Homo sapiens} Back     alignment and structure
>1k7b_A Subgroup A ROUS sarcoma virus receptor PG800 and PG950; beta hairpin, 3-10 helix, calcium binding, membrane protein; NMR {Coturnix coturnix} SCOP: g.12.1.1 Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>2knx_A Prolow-density lipoprotein receptor-related prote; LDLR, ligand binding module, ligand binding repeat, compleme repeat, protein binding; NMR {Homo sapiens} Back     alignment and structure
>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>2i1p_A Low-density lipoprotein receptor-related protein 2; cysteine-rich repeat, ligand binding domain, calcium CAGE, ligand binding protein; NMR {Rattus norvegicus} Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>1jrf_A TVA LDL-A module, subgroup A ROUS sarcoma virus receptors PG800 and PG950; disulfide bond, alpha helix, calcium CAGE, signaling protein; NMR {Coturnix japonica} SCOP: g.12.1.1 Back     alignment and structure
>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>1j8e_A Low-density lipoprotein receptor-related protein 1; ligand binding, calcium binding, complement-like repeat, LRP receptor, signaling protein; 1.85A {Homo sapiens} SCOP: g.12.1.1 Back     alignment and structure
>2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 Back     alignment and structure
>1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* Back     alignment and structure
>3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A* Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A* Back     alignment and structure
>2kny_A LRP-1, linker, APO-E; lipoprotein receptor, ligand binding module, COMP repeat, calcium, cell membrane, coated PIT, cytoplasm, DEVE protein; NMR {Homo sapiens} Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>1cr8_A Protein (LOW density lipoprotein receptor related protein); ligand binding, calcium binding, LDLR, LRP, lipid binding protein; NMR {Homo sapiens} SCOP: g.12.1.1 Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>1ajj_A LR5, low-density lipoprotein receptor; LDL receptor, cysteine-rich module, calcium; 1.70A {Homo sapiens} SCOP: g.12.1.1 Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>2knx_A Prolow-density lipoprotein receptor-related prote; LDLR, ligand binding module, ligand binding repeat, compleme repeat, protein binding; NMR {Homo sapiens} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>2gtl_O Extracellular hemoglobin linker L3 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Back     alignment and structure
>1d2l_A Lipoprotein receptor related protein; ligand binding, calcium binding, complement-like repeat, signaling protein; NMR {Homo sapiens} SCOP: g.12.1.1 Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* Back     alignment and structure
>2i1p_A Low-density lipoprotein receptor-related protein 2; cysteine-rich repeat, ligand binding domain, calcium CAGE, ligand binding protein; NMR {Rattus norvegicus} Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>2m0p_A Low-density lipoprotein receptor-related protein; complement type repeat, megalin, LDL receptor FAMI lipid binding protein; NMR {Homo sapiens} Back     alignment and structure
>3dpr_E LDL-receptor class A 3; human rhinovirus, VLDL-receptor, virus-protein complex, icosahedral virus, ATP-binding, capsid protein; HET: DAO; 3.50A {Homo sapiens} PDB: 1v9u_5* Back     alignment and structure
>2jm4_A Relaxin receptor 1; LDL-A module, RXFP1 receptor, LGR7, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2gtl_M Hemoglobin linker chain L1; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>1k7b_A Subgroup A ROUS sarcoma virus receptor PG800 and PG950; beta hairpin, 3-10 helix, calcium binding, membrane protein; NMR {Coturnix coturnix} SCOP: g.12.1.1 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>3a7q_B Low-density lipoprotein receptor-related protein; signaling protein; HET: NAG; 2.60A {Homo sapiens} Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>2gtl_N Extracellular hemoglobin linker L2 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Back     alignment and structure
>1jrf_A TVA LDL-A module, subgroup A ROUS sarcoma virus receptors PG800 and PG950; disulfide bond, alpha helix, calcium CAGE, signaling protein; NMR {Coturnix japonica} SCOP: g.12.1.1 Back     alignment and structure
>2gtl_N Extracellular hemoglobin linker L2 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1j8e_A Low-density lipoprotein receptor-related protein 1; ligand binding, calcium binding, complement-like repeat, LRP receptor, signaling protein; 1.85A {Homo sapiens} SCOP: g.12.1.1 Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>3ojy_B Complement component C8 beta chain; macpf, lipocalin, immune system; HET: TPO BMA; 2.51A {Homo sapiens} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2gtl_M Hemoglobin linker chain L1; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>3ojy_A Complement component C8 alpha chain; macpf, lipocalin, immune system; HET: TPO BMA; 2.51A {Homo sapiens} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>4a9v_A PHOX; hydrolase, beta-propeller; 1.10A {Pseudomonas fluorescens} PDB: 3zwu_A 4a9x_A* Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3ojy_A Complement component C8 alpha chain; macpf, lipocalin, immune system; HET: TPO BMA; 2.51A {Homo sapiens} Back     alignment and structure
>1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>4a9v_A PHOX; hydrolase, beta-propeller; 1.10A {Pseudomonas fluorescens} PDB: 3zwu_A 4a9x_A* Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Back     alignment and structure
>3ojy_B Complement component C8 beta chain; macpf, lipocalin, immune system; HET: TPO BMA; 2.51A {Homo sapiens} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3t5o_A Complement component C6; macpf, MAC, membrane attack complex, innate IMMU system, blood, membrane, cytolysin, immune SYST; HET: NAG FUL FUC BGC MAN; 2.87A {Homo sapiens} PDB: 4a5w_B* 4e0s_B* Back     alignment and structure
>1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Back     alignment and structure
>3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3zwu_A Alkaline phosphatase PHOX; hydrolase, beta-propeller, iron; 1.39A {Pseudomonas fluorescens} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>1n1i_A Merozoite surface protein-1; MSP1, malaria, surface antigen, glycoprotein, EGF domain, cell adhesion; HET: HIS; 2.40A {Plasmodium knowlesi strain H} SCOP: g.3.11.4 g.3.11.4 Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Back     alignment and structure
>3zwu_A Alkaline phosphatase PHOX; hydrolase, beta-propeller, iron; 1.39A {Pseudomonas fluorescens} Back     alignment and structure
>3t5o_A Complement component C6; macpf, MAC, membrane attack complex, innate IMMU system, blood, membrane, cytolysin, immune SYST; HET: NAG FUL FUC BGC MAN; 2.87A {Homo sapiens} PDB: 4a5w_B* 4e0s_B* Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1ob1_C Major merozoite surface protein; immune system, immunoglobulin/complex, immunoglobulin, antib fragment, MSP1-19, EGF-like domain; 2.90A {Plasmodium falciparum} SCOP: g.3.11.4 g.3.11.4 PDB: 1cej_A 2flg_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>1nt0_A MAsp2, mannose-binding protein associated serine proteas; CUB domain, EGF like domain., hydrolase, sugar binding protein; HET: NAG EDO; 2.70A {Rattus norvegicus} SCOP: b.23.1.1 b.23.1.1 g.3.11.1 Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>3dem_A Complement factor MAsp-3; complement system, innate immunity, calcium binding sites, C pathway, EGF-like domain, glycoprotein, hydrolase; HET: NAG; 2.30A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 841
d1npea_263 b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId 1e-46
d1npea_263 b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId 4e-32
d1npea_263 b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId 3e-15
d1npea_263 b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId 4e-12
d1ijqa1266 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) 2e-43
d1ijqa1266 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) 2e-35
d1ijqa1266 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) 3e-12
d1ijqa1266 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) 7e-11
d1ijqa1266 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) 6e-09
d2bz6l153 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human 2e-10
d2bz6l153 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human 1e-05
d2bz6l153 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human 0.001
d1rfnb_57 g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens 2e-10
d1rfnb_57 g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens 2e-05
d1rfnb_57 g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens 0.004
d1cr8a_42 g.12.1.1 (A:) Ligand-binding domain of low-density 3e-09
d1cr8a_42 g.12.1.1 (A:) Ligand-binding domain of low-density 1e-06
d1cr8a_42 g.12.1.1 (A:) Ligand-binding domain of low-density 8e-05
d1kigl_51 g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bo 5e-09
d1kigl_51 g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bo 2e-05
d1kigl_51 g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bo 4e-05
d1f8za_39 g.12.1.1 (A:) Ligand-binding domain of low-density 6e-09
d1f8za_39 g.12.1.1 (A:) Ligand-binding domain of low-density 7e-07
d1f8za_39 g.12.1.1 (A:) Ligand-binding domain of low-density 7e-05
d1autl250 g.3.11.1 (L:97-146) Activated protein c (autoproth 7e-09
d1autl250 g.3.11.1 (L:97-146) Activated protein c (autoproth 3e-05
d1autl250 g.3.11.1 (L:97-146) Activated protein c (autoproth 1e-04
d2p3ua151 g.3.11.1 (A:87-137) Factor X, N-terminal module {H 9e-09
d2p3ua151 g.3.11.1 (A:87-137) Factor X, N-terminal module {H 2e-05
d2p3ua151 g.3.11.1 (A:87-137) Factor X, N-terminal module {H 7e-05
d2fcwb139 g.12.1.1 (B:86-124) Ligand-binding domain of low-d 1e-08
d2fcwb139 g.12.1.1 (B:86-124) Ligand-binding domain of low-d 5e-07
d2fcwb139 g.12.1.1 (B:86-124) Ligand-binding domain of low-d 8e-05
d1v9u5_39 g.12.1.1 (5:) Very low-density lipoprotein recepto 1e-08
d1v9u5_39 g.12.1.1 (5:) Very low-density lipoprotein recepto 4e-08
d1v9u5_39 g.12.1.1 (5:) Very low-density lipoprotein recepto 7e-05
d1ijqa250 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) 2e-08
d1ijqa250 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) 1e-04
d1ijqa250 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) 0.001
d1d2la_45 g.12.1.1 (A:) Ligand-binding domain of low-density 2e-08
d1d2la_45 g.12.1.1 (A:) Ligand-binding domain of low-density 6e-07
d1d2la_45 g.12.1.1 (A:) Ligand-binding domain of low-density 3e-06
d1j8ea_44 g.12.1.1 (A:) Ligand-binding domain of low-density 2e-08
d1j8ea_44 g.12.1.1 (A:) Ligand-binding domain of low-density 5e-07
d1j8ea_44 g.12.1.1 (A:) Ligand-binding domain of low-density 9e-07
d2gtlo241 g.12.1.1 (O:60-100) Extracellular hemoglobin linke 4e-08
d2gtlo241 g.12.1.1 (O:60-100) Extracellular hemoglobin linke 4e-08
d2gtlo241 g.12.1.1 (O:60-100) Extracellular hemoglobin linke 2e-04
d1k7ba_42 g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quai 8e-08
d1k7ba_42 g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quai 5e-07
d1k7ba_42 g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quai 8e-05
d1f5ya144 g.12.1.1 (A:1-44) Ligand-binding domain of low-den 8e-08
d1f5ya144 g.12.1.1 (A:1-44) Ligand-binding domain of low-den 1e-06
d1f5ya144 g.12.1.1 (A:1-44) Ligand-binding domain of low-den 1e-05
d3bpse140 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) 8e-08
d3bpse140 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) 0.002
d1ajja_37 g.12.1.1 (A:) Ligand-binding domain of low-density 9e-08
d1ajja_37 g.12.1.1 (A:) Ligand-binding domain of low-density 5e-07
d1ajja_37 g.12.1.1 (A:) Ligand-binding domain of low-density 1e-04
d1f5ya241 g.12.1.1 (A:45-85) Ligand-binding domain of low-de 9e-08
d1f5ya241 g.12.1.1 (A:45-85) Ligand-binding domain of low-de 1e-07
d1f5ya241 g.12.1.1 (A:45-85) Ligand-binding domain of low-de 1e-04
d2gtln241 g.12.1.1 (N:61-101) Extracellular hemoglobin linke 2e-07
d2gtln241 g.12.1.1 (N:61-101) Extracellular hemoglobin linke 7e-07
d2gtln241 g.12.1.1 (N:61-101) Extracellular hemoglobin linke 9e-06
d2gtlm242 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Co 2e-07
d2gtlm242 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Co 4e-07
d2gtlm242 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Co 7e-06
d2fcwb239 g.12.1.1 (B:125-163) Ligand-binding domain of low- 2e-07
d2fcwb239 g.12.1.1 (B:125-163) Ligand-binding domain of low- 2e-06
d2fcwb239 g.12.1.1 (B:125-163) Ligand-binding domain of low- 3e-06
d1i0ua241 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) r 4e-07
d1i0ua241 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) r 7e-07
d1i0ua241 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) r 7e-05
d1xfea244 g.12.1.1 (A:1-44) Ligand-binding domain of low-den 1e-06
d1xfea244 g.12.1.1 (A:1-44) Ligand-binding domain of low-den 1e-05
d1xfea244 g.12.1.1 (A:1-44) Ligand-binding domain of low-den 3e-05
d1szba245 g.3.11.1 (A:124-168) Mannose-binding protein assoc 2e-06
d1szba245 g.3.11.1 (A:124-168) Mannose-binding protein assoc 1e-05
d1szba245 g.3.11.1 (A:124-168) Mannose-binding protein assoc 6e-05
d1nzia242 g.3.11.1 (A:118-159) Complement C1S component {Hum 2e-06
d1nzia242 g.3.11.1 (A:118-159) Complement C1S component {Hum 9e-05
d1nzia242 g.3.11.1 (A:118-159) Complement C1S component {Hum 3e-04
d1nt0a345 g.3.11.1 (A:120-164) Mannose-binding protein assoc 3e-06
d1nt0a345 g.3.11.1 (A:120-164) Mannose-binding protein assoc 2e-05
d1nt0a345 g.3.11.1 (A:120-164) Mannose-binding protein assoc 2e-04
d1uzka143 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sa 2e-05
d1uzka143 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sa 7e-04
d1uzka243 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sa 2e-05
d1uzka243 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sa 9e-04
d1uzka243 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sa 0.002
d1lmja242 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapien 3e-05
d1lmja242 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapien 0.002
d1apqa_53 g.3.11.1 (A:) Complement protease C1R {Human (Homo 2e-04
d1apqa_53 g.3.11.1 (A:) Complement protease C1R {Human (Homo 2e-04
d1apqa_53 g.3.11.1 (A:) Complement protease C1R {Human (Homo 5e-04
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Length = 263 Back     information, alignment and structure

class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: YWTD domain
family: YWTD domain
domain: Nidogen
species: Mouse (Mus musculus) [TaxId: 10090]
 Score =  165 bits (418), Expect = 1e-46
 Identities = 70/256 (27%), Positives = 112/256 (43%), Gaps = 18/256 (7%)

Query: 330 IEKAGMHGENRSPLVTKNIQWPSSLVIDYNQDILYWCDSHLNTVESVRVDGSERTVSFNL 389
           +E+  M        +    +    L  D    ++YW D    ++    + G E T     
Sbjct: 17  LERNTMKKTEAKAFLHIPAKVIIGLAFDCVDKVVYWTDISEPSIGRASLHGGEPTTII-- 74

Query: 390 EVLGSDSRVGIPNCRPEDNLWIGKNLYWVESNLDQIEVAKLSGQFRRTLIAGDMESPRAI 449
                   +G P     D   +G+ ++W +S LD+IEVAK+ G  RR L    + +PR I
Sbjct: 75  -----RQDLGSPEGIALD--HLGRTIFWTDSQLDRIEVAKMDGTQRRVLFDTGLVNPRGI 127

Query: 450 ALDPRFGLLFWTDWDSKAPRIERCSMSGEHRSVIVRVDLLTSRGAWPNGLTLDYQLTRIY 509
             DP  G L+WTDW+   P+IE   M G +R ++            PNGLT D   +++ 
Sbjct: 128 VTDPVRGNLYWTDWNRDNPKIETSHMDGTNRRILA-----QDNLGLPNGLTFDAFSSQLC 182

Query: 510 WIDAKSDSIHTVTYDGKDHHVVLSNHDSLTHPFAIALFENHVYWTDWRTNSVIRANKWNG 569
           W+DA +     +         VL     L +PFA+  +  ++Y+TDW+TNSVI  +    
Sbjct: 183 WVDAGTHRAECLNPAQPGRRKVLEG---LQYPFAVTSYGKNLYYTDWKTNSVIAMDLAIS 239

Query: 570 SDVTLIQRTLTQPFIY 585
            ++        Q  +Y
Sbjct: 240 KEMDTFHP-HKQTRLY 254


>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Length = 263 Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Length = 263 Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Length = 263 Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1cr8a_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1cr8a_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1cr8a_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Length = 51 Back     information, alignment and structure
>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Length = 51 Back     information, alignment and structure
>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Length = 51 Back     information, alignment and structure
>d1f8za_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1f8za_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1f8za_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 50 Back     information, alignment and structure
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 50 Back     information, alignment and structure
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 50 Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 51 Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 51 Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 51 Back     information, alignment and structure
>d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1v9u5_ g.12.1.1 (5:) Very low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1v9u5_ g.12.1.1 (5:) Very low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1v9u5_ g.12.1.1 (5:) Very low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Length = 50 Back     information, alignment and structure
>d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Length = 50 Back     information, alignment and structure
>d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Length = 50 Back     information, alignment and structure
>d1d2la_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 45 Back     information, alignment and structure
>d1d2la_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 45 Back     information, alignment and structure
>d1d2la_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 45 Back     information, alignment and structure
>d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d2gtlo2 g.12.1.1 (O:60-100) Extracellular hemoglobin linker l3 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 Back     information, alignment and structure
>d2gtlo2 g.12.1.1 (O:60-100) Extracellular hemoglobin linker l3 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 Back     information, alignment and structure
>d2gtlo2 g.12.1.1 (O:60-100) Extracellular hemoglobin linker l3 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 Back     information, alignment and structure
>d1k7ba_ g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quail (Coturnix coturnix) [TaxId: 9091]} Length = 42 Back     information, alignment and structure
>d1k7ba_ g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quail (Coturnix coturnix) [TaxId: 9091]} Length = 42 Back     information, alignment and structure
>d1k7ba_ g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quail (Coturnix coturnix) [TaxId: 9091]} Length = 42 Back     information, alignment and structure
>d1f5ya1 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1f5ya1 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1f5ya1 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Length = 40 Back     information, alignment and structure
>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Length = 40 Back     information, alignment and structure
>d1ajja_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 37 Back     information, alignment and structure
>d1ajja_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 37 Back     information, alignment and structure
>d1ajja_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 37 Back     information, alignment and structure
>d1f5ya2 g.12.1.1 (A:45-85) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1f5ya2 g.12.1.1 (A:45-85) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1f5ya2 g.12.1.1 (A:45-85) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d2gtln2 g.12.1.1 (N:61-101) Extracellular hemoglobin linker l2 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 Back     information, alignment and structure
>d2gtln2 g.12.1.1 (N:61-101) Extracellular hemoglobin linker l2 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 Back     information, alignment and structure
>d2gtln2 g.12.1.1 (N:61-101) Extracellular hemoglobin linker l2 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 Back     information, alignment and structure
>d2gtlm2 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 42 Back     information, alignment and structure
>d2gtlm2 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 42 Back     information, alignment and structure
>d2gtlm2 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 42 Back     information, alignment and structure
>d2fcwb2 g.12.1.1 (B:125-163) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2fcwb2 g.12.1.1 (B:125-163) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2fcwb2 g.12.1.1 (B:125-163) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1xfea2 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1xfea2 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1xfea2 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 45 Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 45 Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 45 Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 45 Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 45 Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 45 Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query841
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 100.0
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 100.0
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 99.96
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 99.95
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 99.88
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 99.82
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 99.8
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 99.76
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 99.71
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 99.7
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 99.68
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 99.67
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 99.51
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.47
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 99.46
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 99.46
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 99.43
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.41
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.35
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.32
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 99.13
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 99.11
d1cr8a_42 Ligand-binding domain of low-density lipoprotein r 98.93
d1f5ya241 Ligand-binding domain of low-density lipoprotein r 98.92
d2fcwb139 Ligand-binding domain of low-density lipoprotein r 98.92
d1f8za_39 Ligand-binding domain of low-density lipoprotein r 98.89
d1ijqa250 Low density lipoprotein (LDL) receptor, different 98.85
d1ajja_37 Ligand-binding domain of low-density lipoprotein r 98.85
d2gtlo241 Extracellular hemoglobin linker l3 subunit {Common 98.81
d1i0ua241 Low density lipoprotein (LDL) receptor, different 98.81
d1v9u5_39 Very low-density lipoprotein receptor {Human (Homo 98.8
d2bz6l153 Coagulation factor VIIa {Human (Homo sapiens) [Tax 98.78
d1f5ya144 Ligand-binding domain of low-density lipoprotein r 98.78
d1k7ba_42 soluble Tva ectodomain, sTva47 {Quail (Coturnix co 98.73
d1d2la_45 Ligand-binding domain of low-density lipoprotein r 98.73
d1rfnb_57 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 98.73
d1i0ua241 Low density lipoprotein (LDL) receptor, different 98.72
d2fcwb239 Ligand-binding domain of low-density lipoprotein r 98.68
d1j8ea_44 Ligand-binding domain of low-density lipoprotein r 98.67
d1nzia242 Complement C1S component {Human (Homo sapiens) [Ta 98.66
d1crua_450 Soluble quinoprotein glucose dehydrogenase {Acinet 98.65
d1nt0a345 Mannose-binding protein associated serine protease 98.64
d2gtln241 Extracellular hemoglobin linker l2 subunit {Common 98.62
d3bpse140 Low density lipoprotein (LDL) receptor, different 98.62
d1autl250 Activated protein c (autoprothrombin IIa) {Human ( 98.61
d1szba245 Mannose-binding protein associated serine protease 98.61
d3bpse140 Low density lipoprotein (LDL) receptor, different 98.59
d1uzka143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.58
d2gtlm242 Hemoglobin linker chain l1 {Common earthworm (Lumb 98.56
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 98.55
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 98.54
d1kigl_51 Factor X, N-terminal module {Cow (Bos taurus) [Tax 98.52
d1kigl_51 Factor X, N-terminal module {Cow (Bos taurus) [Tax 98.51
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 98.51
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 98.5
d2p3ua151 Factor X, N-terminal module {Human (Homo sapiens) 98.5
d1autl250 Activated protein c (autoprothrombin IIa) {Human ( 98.47
d1crua_450 Soluble quinoprotein glucose dehydrogenase {Acinet 98.46
d1xfea244 Ligand-binding domain of low-density lipoprotein r 98.44
d2p3ua151 Factor X, N-terminal module {Human (Homo sapiens) 98.43
d1ijqa250 Low density lipoprotein (LDL) receptor, different 98.4
d1f5ya241 Ligand-binding domain of low-density lipoprotein r 98.38
d1f8za_39 Ligand-binding domain of low-density lipoprotein r 98.38
d1nzia242 Complement C1S component {Human (Homo sapiens) [Ta 98.37
d1lmja242 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.36
d1cr8a_42 Ligand-binding domain of low-density lipoprotein r 98.35
d1uzka243 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.34
d1nt0a345 Mannose-binding protein associated serine protease 98.34
d2fcwb139 Ligand-binding domain of low-density lipoprotein r 98.33
d1v9u5_39 Very low-density lipoprotein receptor {Human (Homo 98.32
d1ajja_37 Ligand-binding domain of low-density lipoprotein r 98.31
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 98.31
d1apqa_53 Complement protease C1R {Human (Homo sapiens) [Tax 98.29
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 98.29
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 98.28
d1szba245 Mannose-binding protein associated serine protease 98.28
d2gtlo241 Extracellular hemoglobin linker l3 subunit {Common 98.28
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 98.27
d1uzka143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.27
d1f5ya144 Ligand-binding domain of low-density lipoprotein r 98.24
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 98.23
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 98.21
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 98.2
d1emoa143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.19
d1dx5i340 Thrombomodulin, different EGF-like domains {Human 98.18
d1rfnb_57 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 98.17
d2gtln241 Extracellular hemoglobin linker l2 subunit {Common 98.16
d1d2la_45 Ligand-binding domain of low-density lipoprotein r 98.15
d2fcwb239 Ligand-binding domain of low-density lipoprotein r 98.15
d1dx5i340 Thrombomodulin, different EGF-like domains {Human 98.14
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 98.14
d1apqa_53 Complement protease C1R {Human (Homo sapiens) [Tax 98.13
d2gtlm242 Hemoglobin linker chain l1 {Common earthworm (Lumb 98.11
d1k7ba_42 soluble Tva ectodomain, sTva47 {Quail (Coturnix co 98.11
d1lmja144 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.1
d1emoa143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.1
d1j8ea_44 Ligand-binding domain of low-density lipoprotein r 98.09
d1xfea244 Ligand-binding domain of low-density lipoprotein r 98.09
d1uzka243 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.07
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 98.07
d1lmja242 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.04
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 98.03
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 98.02
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 97.98
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 97.96
d2bz6l153 Coagulation factor VIIa {Human (Homo sapiens) [Tax 97.92
d1lmja144 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.83
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 97.78
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 97.24
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 97.22
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 97.13
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 97.05
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 97.05
d1gl4a240 EGF-like domain of nidogen-1 {Mouse (Mus musculus) 96.98
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 96.96
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 96.86
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 96.66
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 96.56
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 96.52
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 96.43
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 96.35
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 96.16
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 95.88
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 95.86
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 95.77
d1emoa239 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 95.75
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 95.61
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 95.58
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 95.44
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 95.27
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 95.25
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 94.65
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 94.39
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 94.24
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 94.19
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 94.19
d1gl4a240 EGF-like domain of nidogen-1 {Mouse (Mus musculus) 94.05
d1tbga_340 beta1-subunit of the signal-transducing G protein 93.81
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 93.52
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 93.51
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 93.19
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 93.08
d1tbga_340 beta1-subunit of the signal-transducing G protein 93.05
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 92.96
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 92.54
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 92.18
d1emoa239 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 91.99
d1dx5i143 Thrombomodulin, different EGF-like domains {Human 91.93
d1dx5i143 Thrombomodulin, different EGF-like domains {Human 90.23
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 89.12
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 88.64
d1haea_63 Heregulin-alpha, EGF-like domain {Human (Homo sapi 88.33
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 88.09
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 87.94
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 87.11
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 87.04
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 86.12
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 85.01
d1cvua241 Prostaglandin H2 synthase-1, EGF-like module {Mous 84.94
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 84.75
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 83.66
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 83.54
d3egfa_53 Epidermal growth factor, EGF {Mouse (Mus musculus) 83.34
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 83.17
d1nqlb_48 Epidermal growth factor, EGF {Human (Homo sapiens) 82.96
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: YWTD domain
family: YWTD domain
domain: Low density lipoprotein (LDL) receptor
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=3.5e-40  Score=345.42  Aligned_cols=259  Identities=34%  Similarity=0.703  Sum_probs=228.5

Q ss_pred             CeEEeccCccccccccccccEEEEeccccceeeecccccCCcceeEEEecCCCeEEEEEecCCc-ccceEEEEeCCCCCc
Q psy14257        221 PFVIFSNRHELRGVDLRTFNVIALISSLKNTIALDFYYTPTANMVFWTDVIDDKIYNATLIGNS-LSNIDVVVQTGLSTA  299 (841)
Q Consensus       221 p~ll~s~~~~I~~~~~~~~~~~~l~~~~~~~~avd~~~~~~~~~lyw~d~~~~~I~~~~~~~~~-~~~~~~~~~~~l~~p  299 (841)
                      |||+|++.++|+++++++.+...+++++++++|||||+..++  |||+|...+.|+++.+++.. ....++++..++..|
T Consensus         2 ~fLl~s~~~~I~~~~l~~~~~~~~~~~~~~~~~id~d~~~~~--lYw~D~~~~~I~~~~l~~~~~~~~~~~~~~~~~~~p   79 (266)
T d1ijqa1           2 AYLFFTNRHEVRKMTLDRSEYTSLIPNLRNVVALDTEVASNR--IYWSDLSQRMICSTQLDRAHGVSSYDTVISRDIQAP   79 (266)
T ss_dssp             CEEEEECBSSEEEEETTSCCCEEEECSCSSEEEEEEETTTTE--EEEEETTTTEEEEEEC--------CEEEECSSCSCC
T ss_pred             CEEEEECCCeEEEEECCCCcceeeeCCCCceEEEEEEeCCCE--EEEEECCCCEEEEEEecCCCCCcceEEEEeCCCCCc
Confidence            799999999999999999999999999999999999998776  99999999999999987532 113456666777778


Q ss_pred             cceEEeeecCceeEEEeeecCCCCCCCCCCEEEEccCCCccccccccCcCCCceEEEEccCCEEEEEeCCCCeEEEEEec
Q psy14257        300 EGLAVDWIGKNLYMFWAFWSLSPSNSSDGGIEKAGMHGENRSPLVTKNIQWPSSLVIDYNQDILYWCDSHLNTVESVRVD  379 (841)
Q Consensus       300 ~giavD~~~~~~y~~~td~~~~~~~~~~~~I~~~~~dG~~~~~l~~~~~~~P~glavD~~~~~lYwaD~~~~~I~~~~ld  379 (841)
                      .||||||.+                                                                       
T Consensus        80 ~glAvD~~~-----------------------------------------------------------------------   88 (266)
T d1ijqa1          80 DGLAVDWIH-----------------------------------------------------------------------   88 (266)
T ss_dssp             CEEEEETTT-----------------------------------------------------------------------
T ss_pred             ceEEEeecc-----------------------------------------------------------------------
Confidence            888877765                                                                       


Q ss_pred             CCccEEEEeeeeecCCCccccCCCCCCccccccceEEEEecCCCcEEEEccCCceEEEEecCCCCCceeEEEcCCCCeEE
Q psy14257        380 GSERTVSFNLEVLGSDSRVGIPNCRPEDNLWIGKNLYWVESNLDQIEVAKLSGQFRRTLIAGDMESPRAIALDPRFGLLF  459 (841)
Q Consensus       380 G~~~~~~~~~~~~~~~~~~~i~~~~~~avdw~~~~LY~tD~~~~~I~v~~~~G~~~~~l~~~~l~~P~giavd~~~g~Ly  459 (841)
                                                       ++|||+|...++|++++++|...++++...+.+|++|++||.+|+||
T Consensus        89 ---------------------------------~~lY~~d~~~~~I~v~~~~g~~~~~~~~~~~~~P~~l~vd~~~g~ly  135 (266)
T d1ijqa1          89 ---------------------------------SNIYWTDSVLGTVSVADTKGVKRKTLFRENGSKPRAIVVDPVHGFMY  135 (266)
T ss_dssp             ---------------------------------TEEEEEETTTTEEEEEETTSSSEEEEEECTTCCEEEEEEETTTTEEE
T ss_pred             ---------------------------------ceEEEEecCCCEEEeEecCCceEEEEEcCCCCCcceEEEEcccCeEE
Confidence                                             78888888888999999999988888888889999999999999999


Q ss_pred             EEecCCCCCeEEEecCCCCCcEEEEEecccCCCCCCceeEEEeccCCEEEEEeCCCCeEEEEEcCCCeeEEEEcCCCCCC
Q psy14257        460 WTDWDSKAPRIERCSMSGEHRSVIVRVDLLTSRGAWPNGLTLDYQLTRIYWIDAKSDSIHTVTYDGKDHHVVLSNHDSLT  539 (841)
Q Consensus       460 ~td~~~~~~~I~r~~ldG~~~~~i~~~~~~~~~~~~P~glalD~~~~~LYw~d~~~~~I~~~~~dG~~~~~i~~~~~~l~  539 (841)
                      |++++. .++|+|++|||+.++.++.     ..+..|+||++|+.+++|||+|...++|++++++|++++++......+.
T Consensus       136 ~~~~~~-~~~I~r~~~dGs~~~~l~~-----~~~~~p~gl~iD~~~~~lYw~d~~~~~I~~~~~dG~~~~~~~~~~~~~~  209 (266)
T d1ijqa1         136 WTDWGT-PAKIKKGGLNGVDIYSLVT-----ENIQWPNGITLDLLSGRLYWVDSKLHSISSIDVNGGNRKTILEDEKRLA  209 (266)
T ss_dssp             EEECSS-SCEEEEEETTSCCEEEEEC-----SSCSCEEEEEEETTTTEEEEEETTTTEEEEEETTSCSCEEEEECTTTTS
T ss_pred             EeccCC-CcceeEeccCCCceecccc-----cccceeeEEEeeccccEEEEecCCcCEEEEEECCCCCEEEEEeCCCccc
Confidence            999983 5799999999999999987     6789999999999999999999999999999999999998888776788


Q ss_pred             cceEEEEecCeEEEEeCCCCeEEEEeccCCcceEEEecccCCCce---ec--cCCcc
Q psy14257        540 HPFAIALFENHVYWTDWRTNSVIRANKWNGSDVTLIQRTLTQPFI---YV--NGVVK  591 (841)
Q Consensus       540 ~P~gla~~~~~lY~td~~~~~i~~~~~~~g~~~~~i~~~~~~p~~---~h--~qp~~  591 (841)
                      +|++|++++++|||+|+.+++|++++|.+|+..+.+...+..|.+   ||  +||.+
T Consensus       210 ~p~~lav~~~~ly~td~~~~~I~~~~~~~g~~~~~~~~~~~~p~~i~v~~~~~QP~g  266 (266)
T d1ijqa1         210 HPFSLAVFEDKVFWTDIINEAIFSANRLTGSDVNLLAENLLSPEDMVLFHNLTQPRG  266 (266)
T ss_dssp             SEEEEEEETTEEEEEETTTTEEEEEETTTCCCCEEEECSCSCCCCEEEESGGGSCCC
T ss_pred             ccEEEEEECCEEEEEECCCCeEEEEECCCCcceEEEEcCCCCceEEEEECCccCCCC
Confidence            999999999999999999999999999999999988888888887   66  78854



>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1cr8a_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f5ya2 g.12.1.1 (A:45-85) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f8za_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ajja_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gtlo2 g.12.1.1 (O:60-100) Extracellular hemoglobin linker l3 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v9u5_ g.12.1.1 (5:) Very low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f5ya1 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k7ba_ g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quail (Coturnix coturnix) [TaxId: 9091]} Back     information, alignment and structure
>d1d2la_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcwb2 g.12.1.1 (B:125-163) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2gtln2 g.12.1.1 (N:61-101) Extracellular hemoglobin linker l2 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Back     information, alignment and structure
>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gtlm2 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1xfea2 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f5ya2 g.12.1.1 (A:45-85) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f8za_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cr8a_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v9u5_ g.12.1.1 (5:) Very low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ajja_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gtlo2 g.12.1.1 (O:60-100) Extracellular hemoglobin linker l3 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f5ya1 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gtln2 g.12.1.1 (N:61-101) Extracellular hemoglobin linker l2 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Back     information, alignment and structure
>d1d2la_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcwb2 g.12.1.1 (B:125-163) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gtlm2 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Back     information, alignment and structure
>d1k7ba_ g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quail (Coturnix coturnix) [TaxId: 9091]} Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xfea2 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dx5i1 g.3.11.1 (I:345-387) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dx5i1 g.3.11.1 (I:345-387) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure