Psyllid ID: psy14262
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 482 | ||||||
| 328702065 | 2150 | PREDICTED: low-density lipoprotein recep | 0.483 | 0.108 | 0.407 | 3e-47 | |
| 270010181 | 4576 | hypothetical protein TcasGA2_TC009548 [T | 0.475 | 0.050 | 0.425 | 6e-43 | |
| 427796811 | 4696 | Putative prolow-density lipoprotein rece | 0.477 | 0.048 | 0.418 | 3e-41 | |
| 432117303 | 1645 | Low-density lipoprotein receptor-related | 0.605 | 0.177 | 0.377 | 3e-40 | |
| 157115039 | 4649 | low-density lipoprotein receptor (ldl) [ | 0.475 | 0.049 | 0.381 | 3e-39 | |
| 156407458 | 629 | predicted protein [Nematostella vectensi | 0.614 | 0.470 | 0.360 | 2e-38 | |
| 158300186 | 4718 | AGAP012372-PA [Anopheles gambiae str. PE | 0.468 | 0.047 | 0.402 | 3e-38 | |
| 297471646 | 4680 | PREDICTED: low-density lipoprotein recep | 0.624 | 0.064 | 0.345 | 3e-38 | |
| 170035892 | 4695 | very low-density lipoprotein receptor [C | 0.452 | 0.046 | 0.426 | 5e-38 | |
| 427788305 | 4586 | Putative megalin [Rhipicephalus pulchell | 0.614 | 0.064 | 0.390 | 6e-38 |
| >gi|328702065|ref|XP_001946912.2| PREDICTED: low-density lipoprotein receptor-related protein 1-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Score = 195 bits (496), Expect = 3e-47, Method: Compositional matrix adjust.
Identities = 115/282 (40%), Positives = 144/282 (51%), Gaps = 49/282 (17%)
Query: 203 AECTPGQFSCGMGKCIPESWKCDGFVDCLEDGSDEPNTC-IHQCFNGQVQCALSKKCIPH 261
+ C QF CG G+CIP WKCD DC DGSDE ++C + C Q QCALSKKCIP
Sbjct: 33 SSCNSNQFFCGSGECIPLKWKCDFNPDC-ADGSDEFDSCGLPTCKYSQFQCALSKKCIPR 91
Query: 262 NWLCDEEMDCSTDDIVDNTDEDWDKFHQCFNGQVQCALSKKCIPHNWLCDEEMDCSTDDI 321
W+CD E+DC L E D S +D
Sbjct: 92 EWICDGELDCGAS----------------------------------LNSTEQDASDEDS 117
Query: 322 VDNTDEDWDKYFSHNAVLCHPNELRCGSSNQCVALSKFCDGKPDCSNGEDEGPFCNNKAD 381
+ C PN RCG+S QC + FCDG C N DEG FC N
Sbjct: 118 LQ----------CQKPSSCPPNMARCGNSTQCKYIESFCDGTSHCENSTDEGRFCENMVP 167
Query: 382 CENLKCSHKCSPTPRGAMCFCPAGQNPNKTQCVDADEC-LIDGSCDQTCTNTHLSYVCSC 440
C L C+H C PT +G CFCP G P+ +C+D DEC +++ +CDQ CTN S+ CSC
Sbjct: 168 CHGLNCAHGCKPTGKGPACFCPEGMQPHNNECIDMDECEVLNYTCDQICTNKKGSFSCSC 227
Query: 441 TEGYTLRPDGKSCTAVNVPQDEPASIIFSSTVDIRRIHLNGS 482
GY +C A+NVP++E ASI+ S++ DIRRI+LNGS
Sbjct: 228 VPGYI--QTNSTCKAINVPENEDASILVSTSKDIRRIYLNGS 267
|
Source: Acyrthosiphon pisum Species: Acyrthosiphon pisum Genus: Acyrthosiphon Family: Aphididae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|270010181|gb|EFA06629.1| hypothetical protein TcasGA2_TC009548 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|427796811|gb|JAA63857.1| Putative prolow-density lipoprotein receptor-related protein 1, partial [Rhipicephalus pulchellus] | Back alignment and taxonomy information |
|---|
| >gi|432117303|gb|ELK37690.1| Low-density lipoprotein receptor-related protein 2 [Myotis davidii] | Back alignment and taxonomy information |
|---|
| >gi|157115039|ref|XP_001652530.1| low-density lipoprotein receptor (ldl) [Aedes aegypti] gi|108877064|gb|EAT41289.1| AAEL007041-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|156407458|ref|XP_001641561.1| predicted protein [Nematostella vectensis] gi|156228700|gb|EDO49498.1| predicted protein [Nematostella vectensis] | Back alignment and taxonomy information |
|---|
| >gi|158300186|ref|XP_320185.4| AGAP012372-PA [Anopheles gambiae str. PEST] gi|157013036|gb|EAA00393.5| AGAP012372-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|297471646|ref|XP_002685354.1| PREDICTED: low-density lipoprotein receptor-related protein 2 [Bos taurus] gi|296490675|tpg|DAA32788.1| TPA: low-density lipoprotein receptor-related protein 2-like [Bos taurus] | Back alignment and taxonomy information |
|---|
| >gi|170035892|ref|XP_001845800.1| very low-density lipoprotein receptor [Culex quinquefasciatus] gi|167878399|gb|EDS41782.1| very low-density lipoprotein receptor [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|427788305|gb|JAA59604.1| Putative megalin [Rhipicephalus pulchellus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 482 | ||||||
| UNIPROTKB|P98164 | 4655 | LRP2 "Low-density lipoprotein | 0.597 | 0.061 | 0.377 | 2.2e-64 | |
| ZFIN|ZDB-GENE-050208-608 | 4616 | lrp1ba "low density lipoprotei | 0.655 | 0.068 | 0.338 | 6e-64 | |
| MGI|MGI:95794 | 4660 | Lrp2 "low density lipoprotein | 0.639 | 0.066 | 0.349 | 1.9e-63 | |
| UNIPROTKB|E2R4Q1 | 4528 | LRP1 "Uncharacterized protein" | 0.609 | 0.064 | 0.364 | 2.2e-62 | |
| UNIPROTKB|J9P315 | 4544 | LRP1 "Uncharacterized protein" | 0.609 | 0.064 | 0.364 | 2.3e-62 | |
| UNIPROTKB|G3V928 | 4545 | Lrp1 "Protein Lrp1" [Rattus no | 0.609 | 0.064 | 0.364 | 3.7e-62 | |
| UNIPROTKB|F1NJS9 | 4644 | LRP2 "Uncharacterized protein" | 0.562 | 0.058 | 0.352 | 4.4e-62 | |
| UNIPROTKB|F1NCT2 | 4645 | LRP2 "Uncharacterized protein" | 0.562 | 0.058 | 0.352 | 4.4e-62 | |
| FB|FBgn0053087 | 4699 | LRP1 "LDL receptor protein 1" | 0.435 | 0.044 | 0.414 | 2.3e-42 | |
| ZFIN|ZDB-GENE-070912-401 | 4456 | lrp1bb "low density lipoprotei | 0.605 | 0.065 | 0.351 | 1.7e-61 |
| UNIPROTKB|P98164 LRP2 "Low-density lipoprotein receptor-related protein 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Score = 499 (180.7 bits), Expect = 2.2e-64, Sum P(4) = 2.2e-64
Identities = 123/326 (37%), Positives = 154/326 (47%)
Query: 143 W-CDSHLNTVESVRVDGSHNAVLCHPNELRCGSSNQCVALSKFCDGKPDCSNGEDEGPFC 201
W CD+ + + ++ C P++ C +++C+ LS CDG DC +G DE C
Sbjct: 1126 WVCDTDNDCGDGSDEKNCNSTETCQPSQFNC-PNHRCIDLSFVCDGDKDCVDGSDEVG-C 1183
Query: 202 NAECTPGQFSCGMG-KCIPESWKCDGFVDCLEDGSDE---PNTCIHQCFNGQVQCALSKK 257
CT QF C G KCI + +CDG DC D SDE P C + + QC
Sbjct: 1184 VLNCTASQFKCASGDKCIGVTNRCDGVFDC-SDNSDEAGCPTRPPGMCHSDEFQCQEDGI 1242
Query: 258 CIPHNWLCDEEMDC--STDD---IVDNTDEDWDKFHQCFNGQVQCALSKKCIPHNWLCDE 312
CIP+ W CD DC +D+ V T FH C NG CI WLCD
Sbjct: 1243 CIPNFWECDGHPDCLYGSDEHNACVPKTCPS-SYFH-CDNGN--------CIHRAWLCDR 1292
Query: 313 EMDCSTDDIVDNTDEDWDKYFSHNAVLCHPNELRCGSSNQCVALSKFCDGKPDCSNGEDE 372
+ DC D +DE K C + +C N CV LS CDG DC NG DE
Sbjct: 1293 DNDCG-----DMSDE---KDCPTQPFRCPSWQWQCLGHNICVNLSVVCDGIFDCPNGTDE 1344
Query: 373 GPFCNNKADCENLK--CSHKCSPTPRGAMCFCPAG---QNPNKTQCVDADECLIDGSCDQ 427
P CN + C + C+H+C P GA C CP G N +KT C D DEC I GSC Q
Sbjct: 1345 SPLCNGNS-CSDFNGGCTHECVQEPFGAKCLCPLGFLLANDSKT-CEDIDECDILGSCSQ 1402
Query: 428 TCTNTHLSYVCSCTEGYTLRPDGKSC 453
C N S+ CSC GY L DG++C
Sbjct: 1403 HCYNMRGSFRCSCDTGYMLESDGRTC 1428
|
|
| ZFIN|ZDB-GENE-050208-608 lrp1ba "low density lipoprotein receptor-related protein 1Ba" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:95794 Lrp2 "low density lipoprotein receptor-related protein 2" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R4Q1 LRP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9P315 LRP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3V928 Lrp1 "Protein Lrp1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NJS9 LRP2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NCT2 LRP2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0053087 LRP1 "LDL receptor protein 1" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-070912-401 lrp1bb "low density lipoprotein receptor-related protein 1Bb" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 482 | |||
| cd00112 | 35 | cd00112, LDLa, Low Density Lipoprotein Receptor Cl | 1e-08 | |
| smart00135 | 43 | smart00135, LY, Low-density lipoprotein-receptor Y | 8e-08 | |
| smart00192 | 33 | smart00192, LDLa, Low-density lipoprotein receptor | 2e-07 | |
| pfam00057 | 37 | pfam00057, Ldl_recept_a, Low-density lipoprotein r | 9e-07 | |
| cd01475 | 224 | cd01475, vWA_Matrilin, VWA_Matrilin: In cartilagin | 8e-06 | |
| cd00112 | 35 | cd00112, LDLa, Low Density Lipoprotein Receptor Cl | 1e-04 | |
| cd00112 | 35 | cd00112, LDLa, Low Density Lipoprotein Receptor Cl | 1e-04 | |
| smart00192 | 33 | smart00192, LDLa, Low-density lipoprotein receptor | 3e-04 | |
| smart00192 | 33 | smart00192, LDLa, Low-density lipoprotein receptor | 3e-04 | |
| pfam00057 | 37 | pfam00057, Ldl_recept_a, Low-density lipoprotein r | 4e-04 | |
| pfam00057 | 37 | pfam00057, Ldl_recept_a, Low-density lipoprotein r | 4e-04 | |
| pfam00058 | 42 | pfam00058, Ldl_recept_b, Low-density lipoprotein r | 0.001 | |
| pfam12662 | 24 | pfam12662, cEGF, Complement Clr-like EGF-like | 0.001 | |
| smart00179 | 39 | smart00179, EGF_CA, Calcium-binding EGF-like domai | 0.002 |
| >gnl|CDD|238060 cd00112, LDLa, Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure | Back alignment and domain information |
|---|
Score = 50.3 bits (121), Expect = 1e-08
Identities = 21/35 (60%), Positives = 23/35 (65%), Gaps = 1/35 (2%)
Query: 205 CTPGQFSCGMGKCIPESWKCDGFVDCLEDGSDEPN 239
C P +F C G+CIP SW CDG DC DGSDE N
Sbjct: 1 CPPNEFRCANGRCIPSSWVCDGEDDC-GDGSDEEN 34
|
Length = 35 |
| >gnl|CDD|214531 smart00135, LY, Low-density lipoprotein-receptor YWTD domain | Back alignment and domain information |
|---|
| >gnl|CDD|197566 smart00192, LDLa, Low-density lipoprotein receptor domain class A | Back alignment and domain information |
|---|
| >gnl|CDD|200964 pfam00057, Ldl_recept_a, Low-density lipoprotein receptor domain class A | Back alignment and domain information |
|---|
| >gnl|CDD|238752 cd01475, vWA_Matrilin, VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity | Back alignment and domain information |
|---|
| >gnl|CDD|238060 cd00112, LDLa, Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure | Back alignment and domain information |
|---|
| >gnl|CDD|238060 cd00112, LDLa, Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure | Back alignment and domain information |
|---|
| >gnl|CDD|197566 smart00192, LDLa, Low-density lipoprotein receptor domain class A | Back alignment and domain information |
|---|
| >gnl|CDD|197566 smart00192, LDLa, Low-density lipoprotein receptor domain class A | Back alignment and domain information |
|---|
| >gnl|CDD|200964 pfam00057, Ldl_recept_a, Low-density lipoprotein receptor domain class A | Back alignment and domain information |
|---|
| >gnl|CDD|200964 pfam00057, Ldl_recept_a, Low-density lipoprotein receptor domain class A | Back alignment and domain information |
|---|
| >gnl|CDD|215683 pfam00058, Ldl_recept_b, Low-density lipoprotein receptor repeat class B | Back alignment and domain information |
|---|
| >gnl|CDD|221695 pfam12662, cEGF, Complement Clr-like EGF-like | Back alignment and domain information |
|---|
| >gnl|CDD|214542 smart00179, EGF_CA, Calcium-binding EGF-like domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 482 | |||
| KOG1215|consensus | 877 | 99.84 | ||
| KOG1215|consensus | 877 | 99.24 | ||
| PF00057 | 37 | Ldl_recept_a: Low-density lipoprotein receptor dom | 98.91 | |
| cd00112 | 35 | LDLa Low Density Lipoprotein Receptor Class A doma | 98.89 | |
| PF00057 | 37 | Ldl_recept_a: Low-density lipoprotein receptor dom | 98.81 | |
| cd00112 | 35 | LDLa Low Density Lipoprotein Receptor Class A doma | 98.74 | |
| smart00192 | 33 | LDLa Low-density lipoprotein receptor domain class | 98.65 | |
| smart00192 | 33 | LDLa Low-density lipoprotein receptor domain class | 98.47 | |
| KOG1214|consensus | 1289 | 98.43 | ||
| PF12999 | 176 | PRKCSH-like: Glucosidase II beta subunit-like | 98.43 | |
| PF14670 | 36 | FXa_inhibition: Coagulation Factor Xa inhibitory s | 98.4 | |
| KOG1219|consensus | 4289 | 98.18 | ||
| PF12999 | 176 | PRKCSH-like: Glucosidase II beta subunit-like | 98.09 | |
| PF07645 | 42 | EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 | 98.06 | |
| PF12662 | 24 | cEGF: Complement Clr-like EGF-like | 98.0 | |
| KOG1219|consensus | 4289 | 97.38 | ||
| KOG1214|consensus | 1289 | 97.28 | ||
| KOG4260|consensus | 350 | 97.17 | ||
| PF14670 | 36 | FXa_inhibition: Coagulation Factor Xa inhibitory s | 96.98 | |
| PF12662 | 24 | cEGF: Complement Clr-like EGF-like | 96.78 | |
| cd01475 | 224 | vWA_Matrilin VWA_Matrilin: In cartilaginous plate, | 96.2 | |
| KOG2397|consensus | 480 | 96.13 | ||
| smart00179 | 39 | EGF_CA Calcium-binding EGF-like domain. | 95.94 | |
| KOG1217|consensus | 487 | 95.88 | ||
| KOG4289|consensus | 2531 | 95.4 | ||
| KOG1217|consensus | 487 | 95.27 | ||
| PF07645 | 42 | EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 | 95.01 | |
| KOG4260|consensus | 350 | 94.84 | ||
| KOG3509|consensus | 964 | 94.3 | ||
| KOG2397|consensus | 480 | 93.84 | ||
| cd00054 | 38 | EGF_CA Calcium-binding EGF-like domain, present in | 93.42 | |
| smart00181 | 35 | EGF Epidermal growth factor-like domain. | 93.42 | |
| KOG4289|consensus | 2531 | 92.95 | ||
| PF12947 | 36 | EGF_3: EGF domain; InterPro: IPR024731 This entry | 92.94 | |
| KOG3509|consensus | 964 | 92.91 | ||
| smart00179 | 39 | EGF_CA Calcium-binding EGF-like domain. | 91.45 | |
| cd00053 | 36 | EGF Epidermal growth factor domain, found in epide | 89.25 | |
| PF12947 | 36 | EGF_3: EGF domain; InterPro: IPR024731 This entry | 89.23 | |
| smart00181 | 35 | EGF Epidermal growth factor-like domain. | 88.69 | |
| PF00008 | 32 | EGF: EGF-like domain This is a sub-family of the P | 84.59 | |
| PF00008 | 32 | EGF: EGF-like domain This is a sub-family of the P | 84.16 | |
| cd00054 | 38 | EGF_CA Calcium-binding EGF-like domain, present in | 81.98 | |
| cd00053 | 36 | EGF Epidermal growth factor domain, found in epide | 81.26 | |
| KOG1225|consensus | 525 | 80.21 |
| >KOG1215|consensus | Back alignment and domain information |
|---|
Probab=99.84 E-value=3.5e-20 Score=211.54 Aligned_cols=324 Identities=32% Similarity=0.614 Sum_probs=250.1
Q ss_pred CCCCcceeeCCceecCceeeCCCCCCCcccCCCCCCccccccCCCC----------------------------------
Q psy14262 115 GENRSPLVTKNIQWPSSLVIDYNQDILYWCDSHLNTVESVRVDGSH---------------------------------- 160 (482)
Q Consensus 115 ~~~~~~~~~~~~ci~~~~~cdg~~dc~dw~d~~~~sdE~~~~~~~c---------------------------------- 160 (482)
|+.+..++-...-||+++..|....+.+|.|++...+|..++++.-
T Consensus 25 g~~~~~~~~~~~~~~ng~~id~~~~~~y~~d~~~~~i~~~~~dg~~r~~l~~~~~~~y~~d~~v~~~~~~sg~~~~~~~~ 104 (877)
T KOG1215|consen 25 GGERKILEKEEFEWPNGLTIDLAWQRIYWADAKNDLIESANYDGSGRRALTLFEDGLYWTDKSVSAANKKTGKDVTRLSQ 104 (877)
T ss_pred CcceEEeeccceeCCCcceecchhheeeeccccCCceEEeccCCccceeeeeeccceeeccchhhhhccCCCCcceeehh
Confidence 3444455555677888888888899999999999888887776631
Q ss_pred -----------------------------CCccCCCCCeecC--CCCceecCCcccCCCCCCCCCCCCCCCCC---CCCC
Q psy14262 161 -----------------------------NAVLCHPNELRCG--SSNQCVALSKFCDGKPDCSNGEDEGPFCN---AECT 206 (482)
Q Consensus 161 -----------------------------~~~~C~~~~f~C~--~~~~Ci~~~~~CDg~~dC~dgsDE~~~C~---~~C~ 206 (482)
+...|...+|+|. +. +||+..|+|||..+|.+|+||.+ |. ....
T Consensus 105 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~c~~~~~-~Cip~~~~cd~~~~C~dg~de~~-~~~~~~~~~ 182 (877)
T KOG1215|consen 105 DSHFPLDIHAYHPSSQPLAPDPCAESGNGPCSHCCLDKFSCRTGSC-KCIPGDWLCDGEADCPDGSDELN-CAVRRCEPR 182 (877)
T ss_pred cCCCCcceeEEecCCCCCCCCcccccCCCCCccccCCCCCCcCccc-cCCCCceeCCCCCccccchhhhc-ccccccCcc
Confidence 0123566789998 44 89999999999999999999998 64 1222
Q ss_pred CCceecCCCCeeccCCCCCCCcCCCCCCCCCCCccccccc---CCccccCCCCceecCCCccCccCCCCCCCCCCCCCCC
Q psy14262 207 PGQFSCGMGKCIPESWKCDGFVDCLEDGSDEPNTCIHQCF---NGQVQCALSKKCIPHNWLCDEEMDCSTDDIVDNTDED 283 (482)
Q Consensus 207 ~~~f~C~~g~Ci~~~~~CDg~~dC~~dgsDE~~C~~~~C~---~~~f~C~~~g~Ci~~~~~CDg~~dC~~~~~~dgsDE~ 283 (482)
...|+| |...++||+..+| .+++|+.......+. ...++|.+.++||...+.|||..+|. +++||.
T Consensus 183 ~~~~~~-----~~~~~~~d~~~~~-~~~~d~~~~~~~~~~~~~~~~~~c~g~~~~i~~~~~~Dg~~dc~-----~~~de~ 251 (877)
T KOG1215|consen 183 GASLDC-----IVAIKVCDIQHDC-ADDYDESEGRIYWTDDSRIEVTRCDGSSRCILISEVCDGPRDCV-----DGPDEG 251 (877)
T ss_pred cccccc-----ceeeeecCccccc-ccccccccCcccccCCcceeEEEecCCCcEEeehhccCCCcccc-----cCCcCc
Confidence 344555 9999999999999 999999887544443 46788985569999999999999999 999994
Q ss_pred --CCCCccccCcccccCCCCccCCCCCCCCCCCCCCCCCcCCCCCCCcCCcCccCcccccCCCcccCCCCcccccccccC
Q psy14262 284 --WDKFHQCFNGQVQCALSKKCIPHNWLCDEEMDCSTDDIVDNTDEDWDKYFSHNAVLCHPNELRCGSSNQCVALSKFCD 361 (482)
Q Consensus 284 --~C~~~~C~~~~f~C~~g~~Ci~~~~~CDg~~DC~~g~~~dgsDE~~~~~C~~~~~~C~~~~f~C~~g~~Ci~~~~~CD 361 (482)
++....|...++.|.++ .|++...+|+|..||+ +|+||.. |.. ..+.+..|.|..+ + |...++|+
T Consensus 252 ~~~~~~~~~~~~e~~~~~~-~~~~~~~~~~g~~d~p-----dg~de~~---~~~--~~~~~~~~d~~~~-~-i~~~~~~~ 318 (877)
T KOG1215|consen 252 VMNCSDATCEAPEIECADG-DCSDRQKLCDGDLDCP-----DGLDEDY---CKK--KLYWSMNVDGSGR-R-ILLSKLCH 318 (877)
T ss_pred eeEeeccccCCcceeecCC-CCccceEEecCccCCC-----Ccccccc---ccc--ceeeeeecccCCc-e-eeecccCc
Confidence 66667788889999876 9999999999999999 9999987 754 2233667888877 8 99999998
Q ss_pred CCCCCCCCCCCCCCCCCCCCcc--CCCCcCCCCCCCCCccccCCCCc--cCCCCCccccccccCCCCCCceee-ecCCce
Q psy14262 362 GKPDCSNGEDEGPFCNNKADCE--NLKCSHKCSPTPRGAMCFCPAGQ--NPNKTQCVDADECLIDGSCDQTCT-NTHLSY 436 (482)
Q Consensus 362 g~~dC~dgsDE~~~C~~~~~C~--~~~C~~~C~~~~~~~~C~C~~G~--~~~~~~C~di~eC~~~~~Cs~~C~-n~~gsy 436 (482)
+ ...+..+ ++. ...+.+.+.+......+.|..++ .....+ ....++..++.|+|.|. +.++.|
T Consensus 319 ~-----~~~~~~~------~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~~~-~~~~~~~~~g~Csq~C~~~~p~~~ 386 (877)
T KOG1215|consen 319 G-----YWTDGLN------ECAERVLKCSHKCPDVSVGPRCDCMGAKVLPLGART-DSNPCESDNGGCSQLCVPNSPGTF 386 (877)
T ss_pred c-----ccccccc------cchhhcccccCCCCccccCCcccCCccceecccccc-cCCcccccCCccceeccCCCCCce
Confidence 8 1233322 443 45666778888888999999988 222322 12233336799999999 569999
Q ss_pred EEecCCCeEECCCCCccccCCCCCCCCcEEEeccCCceEEEeccC
Q psy14262 437 VCSCTEGYTLRPDGKSCTAVNVPQDEPASIIFSSTVDIRRIHLNG 481 (482)
Q Consensus 437 ~C~C~~Gy~l~~d~~tC~didec~~~p~~l~~~~~~~ir~~~l~~ 481 (482)
+|.|..||.+..++ |...+ ...++|+|+++++||++.|..
T Consensus 387 ~c~c~~g~~~~~~~--c~~~~---~~~~~l~~s~~~~ir~~~~~~ 426 (877)
T KOG1215|consen 387 KCACSPGYELRLDK--CEASD---QPEAFLLFSNRHDIRRISLDC 426 (877)
T ss_pred eEecCCCcEeccCC--ceecC---CCCcEEEEecCccceecccCC
Confidence 99999999998766 66554 334599999999999999875
|
|
| >KOG1215|consensus | Back alignment and domain information |
|---|
| >PF00057 Ldl_recept_a: Low-density lipoprotein receptor domain class A This prints entry is specific to LDL receptor; InterPro: IPR002172 The low-density lipoprotein receptor (LDLR) is the major cholesterol-carrying lipoprotein of plasma, acting to regulate cholesterol homeostasis in mammalian cells | Back alignment and domain information |
|---|
| >cd00112 LDLa Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure | Back alignment and domain information |
|---|
| >PF00057 Ldl_recept_a: Low-density lipoprotein receptor domain class A This prints entry is specific to LDL receptor; InterPro: IPR002172 The low-density lipoprotein receptor (LDLR) is the major cholesterol-carrying lipoprotein of plasma, acting to regulate cholesterol homeostasis in mammalian cells | Back alignment and domain information |
|---|
| >cd00112 LDLa Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure | Back alignment and domain information |
|---|
| >smart00192 LDLa Low-density lipoprotein receptor domain class A | Back alignment and domain information |
|---|
| >smart00192 LDLa Low-density lipoprotein receptor domain class A | Back alignment and domain information |
|---|
| >KOG1214|consensus | Back alignment and domain information |
|---|
| >PF12999 PRKCSH-like: Glucosidase II beta subunit-like | Back alignment and domain information |
|---|
| >PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A | Back alignment and domain information |
|---|
| >KOG1219|consensus | Back alignment and domain information |
|---|
| >PF12999 PRKCSH-like: Glucosidase II beta subunit-like | Back alignment and domain information |
|---|
| >PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins | Back alignment and domain information |
|---|
| >PF12662 cEGF: Complement Clr-like EGF-like | Back alignment and domain information |
|---|
| >KOG1219|consensus | Back alignment and domain information |
|---|
| >KOG1214|consensus | Back alignment and domain information |
|---|
| >KOG4260|consensus | Back alignment and domain information |
|---|
| >PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A | Back alignment and domain information |
|---|
| >PF12662 cEGF: Complement Clr-like EGF-like | Back alignment and domain information |
|---|
| >cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity | Back alignment and domain information |
|---|
| >KOG2397|consensus | Back alignment and domain information |
|---|
| >smart00179 EGF_CA Calcium-binding EGF-like domain | Back alignment and domain information |
|---|
| >KOG1217|consensus | Back alignment and domain information |
|---|
| >KOG4289|consensus | Back alignment and domain information |
|---|
| >KOG1217|consensus | Back alignment and domain information |
|---|
| >PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins | Back alignment and domain information |
|---|
| >KOG4260|consensus | Back alignment and domain information |
|---|
| >KOG3509|consensus | Back alignment and domain information |
|---|
| >KOG2397|consensus | Back alignment and domain information |
|---|
| >cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins | Back alignment and domain information |
|---|
| >smart00181 EGF Epidermal growth factor-like domain | Back alignment and domain information |
|---|
| >KOG4289|consensus | Back alignment and domain information |
|---|
| >PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins | Back alignment and domain information |
|---|
| >KOG3509|consensus | Back alignment and domain information |
|---|
| >smart00179 EGF_CA Calcium-binding EGF-like domain | Back alignment and domain information |
|---|
| >cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium | Back alignment and domain information |
|---|
| >PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins | Back alignment and domain information |
|---|
| >smart00181 EGF Epidermal growth factor-like domain | Back alignment and domain information |
|---|
| >PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins | Back alignment and domain information |
|---|
| >PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins | Back alignment and domain information |
|---|
| >cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins | Back alignment and domain information |
|---|
| >cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium | Back alignment and domain information |
|---|
| >KOG1225|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 482 | ||||
| 3m0c_C | 791 | The X-Ray Crystal Structure Of Pcsk9 In Complex Wit | 1e-28 | ||
| 1n7d_A | 699 | Extracellular Domain Of The Ldl Receptor Length = 6 | 1e-28 | ||
| 3p5c_L | 440 | The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE | 1e-12 | ||
| 3v65_B | 386 | Crystal Structure Of Agrin And Lrp4 Complex Length | 2e-09 | ||
| 3p5b_L | 400 | The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE | 8e-09 | ||
| 3soq_A | 318 | The Structure Of The First Ywtd Beta Propeller Doma | 7e-08 | ||
| 3sob_B | 316 | The Structure Of The First Ywtd Beta Propeller Doma | 7e-08 | ||
| 4dg6_A | 616 | Crystal Structure Of Domains 1 And 2 Of Lrp6 Length | 7e-08 | ||
| 3s94_A | 619 | Crystal Structure Of Lrp6-E1e2 Length = 619 | 7e-08 | ||
| 1ijq_A | 316 | Crystal Structure Of The Ldl Receptor Ywtd-Egf Doma | 3e-07 | ||
| 1hz8_A | 82 | Solution Structure And Backbone Dynamics Of A Conca | 3e-07 | ||
| 1f5y_A | 85 | Nmr Structure Of A Concatemer Of The First And Seco | 4e-07 | ||
| 1f5y_A | 85 | Nmr Structure Of A Concatemer Of The First And Seco | 1e-05 | ||
| 3v64_C | 349 | Crystal Structure Of Agrin And Lrp4 Length = 349 | 8e-07 | ||
| 2fyj_A | 82 | Nmr Solution Structure Of Calcium-Loaded Lrp Double | 1e-06 | ||
| 2w2m_E | 107 | Wt Pcsk9-Deltac Bound To Wt Egf-A Of Ldlr Length = | 3e-06 | ||
| 1hj7_A | 80 | Nmr Study Of A Pair Of Ldl Receptor Ca2+ Binding Ep | 3e-06 | ||
| 3bps_E | 83 | Pcsk9:egf-a Complex Length = 83 | 4e-06 | ||
| 2fcw_B | 80 | Structure Of A Complex Between The Pair Of The Ldl | 1e-05 | ||
| 2fcw_B | 80 | Structure Of A Complex Between The Pair Of The Ldl | 4e-05 | ||
| 2w2n_E | 107 | Wt Pcsk9-Deltac Bound To Egf-A H306y Mutant Of Ldlr | 1e-05 | ||
| 3gcw_E | 83 | Pcsk9:egfa(H306y) Length = 83 | 1e-05 | ||
| 2lgp_A | 94 | Solution Structure Of La45 From Ldlr Length = 94 | 4e-05 | ||
| 1d2l_A | 45 | Nmr Solution Structure Of Complement-Like Repeat Cr | 1e-04 |
| >pdb|3M0C|C Chain C, The X-Ray Crystal Structure Of Pcsk9 In Complex With The Ldl Receptor Length = 791 | Back alignment and structure |
|
| >pdb|1N7D|A Chain A, Extracellular Domain Of The Ldl Receptor Length = 699 | Back alignment and structure |
| >pdb|3P5C|L Chain L, The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE RECEPTOR IN AN Extended Conformation Length = 440 | Back alignment and structure |
| >pdb|3V65|B Chain B, Crystal Structure Of Agrin And Lrp4 Complex Length = 386 | Back alignment and structure |
| >pdb|3P5B|L Chain L, The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE RECEPTOR IN AN Extended Conformation Length = 400 | Back alignment and structure |
| >pdb|3SOQ|A Chain A, The Structure Of The First Ywtd Beta Propeller Domain Of Lrp6 In Complex With A Dkk1 Peptide Length = 318 | Back alignment and structure |
| >pdb|3SOB|B Chain B, The Structure Of The First Ywtd Beta Propeller Domain Of Lrp6 In Complex With A Fab Length = 316 | Back alignment and structure |
| >pdb|4DG6|A Chain A, Crystal Structure Of Domains 1 And 2 Of Lrp6 Length = 616 | Back alignment and structure |
| >pdb|3S94|A Chain A, Crystal Structure Of Lrp6-E1e2 Length = 619 | Back alignment and structure |
| >pdb|1IJQ|A Chain A, Crystal Structure Of The Ldl Receptor Ywtd-Egf Domain Pair Length = 316 | Back alignment and structure |
| >pdb|1HZ8|A Chain A, Solution Structure And Backbone Dynamics Of A Concatemer Of Egf-Homology Modules Of The Human Low Density Lipoprotein Receptor Length = 82 | Back alignment and structure |
| >pdb|1F5Y|A Chain A, Nmr Structure Of A Concatemer Of The First And Second Ligand-Binding Modules Of The Human Ldl Receptor Length = 85 | Back alignment and structure |
| >pdb|1F5Y|A Chain A, Nmr Structure Of A Concatemer Of The First And Second Ligand-Binding Modules Of The Human Ldl Receptor Length = 85 | Back alignment and structure |
| >pdb|3V64|C Chain C, Crystal Structure Of Agrin And Lrp4 Length = 349 | Back alignment and structure |
| >pdb|2FYJ|A Chain A, Nmr Solution Structure Of Calcium-Loaded Lrp Double Module Length = 82 | Back alignment and structure |
| >pdb|2W2M|E Chain E, Wt Pcsk9-Deltac Bound To Wt Egf-A Of Ldlr Length = 107 | Back alignment and structure |
| >pdb|1HJ7|A Chain A, Nmr Study Of A Pair Of Ldl Receptor Ca2+ Binding Epidermal Growth Factor-Like Domains, 20 Structures Length = 80 | Back alignment and structure |
| >pdb|3BPS|E Chain E, Pcsk9:egf-a Complex Length = 83 | Back alignment and structure |
| >pdb|2FCW|B Chain B, Structure Of A Complex Between The Pair Of The Ldl Receptor Ligand-Binding Modules 3-4 And The Receptor Associated Protein (Rap) Length = 80 | Back alignment and structure |
| >pdb|2FCW|B Chain B, Structure Of A Complex Between The Pair Of The Ldl Receptor Ligand-Binding Modules 3-4 And The Receptor Associated Protein (Rap) Length = 80 | Back alignment and structure |
| >pdb|2W2N|E Chain E, Wt Pcsk9-Deltac Bound To Egf-A H306y Mutant Of Ldlr Length = 107 | Back alignment and structure |
| >pdb|3GCW|E Chain E, Pcsk9:egfa(H306y) Length = 83 | Back alignment and structure |
| >pdb|2LGP|A Chain A, Solution Structure Of La45 From Ldlr Length = 94 | Back alignment and structure |
| >pdb|1D2L|A Chain A, Nmr Solution Structure Of Complement-Like Repeat Cr3 From The Low Density Lipoprotein Receptor-Related Protein (Lrp) . Evidence For Specific Binding To The Receptor Binding Domain Of Human Alpha-2 Macroglobulin Length = 45 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 482 | |||
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 5e-37 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 6e-28 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 1e-22 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 3e-17 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 8e-08 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 2e-34 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 3e-29 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 6e-23 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 3e-18 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 4e-08 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 2e-06 | |
| 2fcw_B | 80 | LDL receptor, low-density lipoprotein receptor; pr | 1e-17 | |
| 2fcw_B | 80 | LDL receptor, low-density lipoprotein receptor; pr | 1e-16 | |
| 2fcw_B | 80 | LDL receptor, low-density lipoprotein receptor; pr | 2e-10 | |
| 2w2n_E | 107 | LDL receptor, low-density lipoprotein receptor; hy | 1e-16 | |
| 2w2n_E | 107 | LDL receptor, low-density lipoprotein receptor; hy | 2e-08 | |
| 2fyj_A | 82 | Low-density lipoprotein receptor-related protein 1 | 7e-16 | |
| 2fyj_A | 82 | Low-density lipoprotein receptor-related protein 1 | 1e-15 | |
| 2fyj_A | 82 | Low-density lipoprotein receptor-related protein 1 | 1e-09 | |
| 2fyj_A | 82 | Low-density lipoprotein receptor-related protein 1 | 5e-04 | |
| 1npe_A | 267 | Nidogen, entactin; glycoprotein, basement membrane | 3e-14 | |
| 1npe_A | 267 | Nidogen, entactin; glycoprotein, basement membrane | 5e-10 | |
| 1npe_A | 267 | Nidogen, entactin; glycoprotein, basement membrane | 3e-06 | |
| 1npe_A | 267 | Nidogen, entactin; glycoprotein, basement membrane | 6e-05 | |
| 1npe_A | 267 | Nidogen, entactin; glycoprotein, basement membrane | 5e-04 | |
| 1z6c_A | 87 | Vitamin K-dependent protein S; EGF module, blood c | 5e-14 | |
| 1z6c_A | 87 | Vitamin K-dependent protein S; EGF module, blood c | 2e-07 | |
| 3p5b_L | 400 | Low density lipoprotein receptor variant; B-propel | 2e-12 | |
| 3p5b_L | 400 | Low density lipoprotein receptor variant; B-propel | 3e-10 | |
| 2xrc_A | 565 | Human complement factor I; immune system, hydrolas | 2e-12 | |
| 2xrc_A | 565 | Human complement factor I; immune system, hydrolas | 2e-05 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 3e-12 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 5e-10 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 1e-05 | |
| 1dx5_I | 118 | Thrombomodulin; serine proteinase, EGF-like domain | 8e-12 | |
| 1lmj_A | 86 | Fibrillin 1; EGF, calcium, microfibril, neonatal, | 2e-11 | |
| 3sov_A | 318 | LRP-6, low-density lipoprotein receptor-related pr | 4e-11 | |
| 3sov_A | 318 | LRP-6, low-density lipoprotein receptor-related pr | 3e-05 | |
| 3sov_A | 318 | LRP-6, low-density lipoprotein receptor-related pr | 6e-05 | |
| 3sov_A | 318 | LRP-6, low-density lipoprotein receptor-related pr | 9e-04 | |
| 2w86_A | 147 | Fibrillin-1, fibrillin1; phosphoprotein, EGF-like | 2e-10 | |
| 2w86_A | 147 | Fibrillin-1, fibrillin1; phosphoprotein, EGF-like | 3e-06 | |
| 1emn_A | 82 | Fibrillin; extracellular matrix, calcium-binding, | 9e-10 | |
| 1emn_A | 82 | Fibrillin; extracellular matrix, calcium-binding, | 8e-06 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 1e-09 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 5e-09 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 7e-09 | |
| 1d2l_A | 45 | Lipoprotein receptor related protein; ligand bindi | 1e-09 | |
| 1ijq_A | 316 | LDL receptor, low-density lipoprotein receptor; be | 2e-09 | |
| 1ijq_A | 316 | LDL receptor, low-density lipoprotein receptor; be | 2e-04 | |
| 1ijq_A | 316 | LDL receptor, low-density lipoprotein receptor; be | 3e-04 | |
| 1ijq_A | 316 | LDL receptor, low-density lipoprotein receptor; be | 5e-04 | |
| 1apq_A | 53 | Complement protease C1R; EGF, calcium binding, ser | 3e-09 | |
| 4a0p_A | 628 | LRP6, LRP-6, low-density lipoprotein receptor-rela | 4e-09 | |
| 4a0p_A | 628 | LRP6, LRP-6, low-density lipoprotein receptor-rela | 1e-08 | |
| 4a0p_A | 628 | LRP6, LRP-6, low-density lipoprotein receptor-rela | 3e-07 | |
| 4a0p_A | 628 | LRP6, LRP-6, low-density lipoprotein receptor-rela | 2e-04 | |
| 4a0p_A | 628 | LRP6, LRP-6, low-density lipoprotein receptor-rela | 4e-04 | |
| 1ajj_A | 37 | LR5, low-density lipoprotein receptor; LDL recepto | 7e-09 | |
| 3s94_A | 619 | LRP-6, low-density lipoprotein receptor-related pr | 1e-08 | |
| 3s94_A | 619 | LRP-6, low-density lipoprotein receptor-related pr | 6e-08 | |
| 3s94_A | 619 | LRP-6, low-density lipoprotein receptor-related pr | 8e-08 | |
| 3s94_A | 619 | LRP-6, low-density lipoprotein receptor-related pr | 3e-05 | |
| 3s94_A | 619 | LRP-6, low-density lipoprotein receptor-related pr | 2e-04 | |
| 3a7q_B | 44 | Low-density lipoprotein receptor-related protein; | 2e-08 | |
| 2kny_A | 80 | LRP-1, linker, APO-E; lipoprotein receptor, ligand | 2e-08 | |
| 2kny_A | 80 | LRP-1, linker, APO-E; lipoprotein receptor, ligand | 2e-07 | |
| 2kny_A | 80 | LRP-1, linker, APO-E; lipoprotein receptor, ligand | 1e-04 | |
| 2kny_A | 80 | LRP-1, linker, APO-E; lipoprotein receptor, ligand | 8e-04 | |
| 2gtl_O | 215 | Extracellular hemoglobin linker L3 subunit; anneli | 4e-08 | |
| 2gtl_O | 215 | Extracellular hemoglobin linker L3 subunit; anneli | 2e-05 | |
| 2gtl_O | 215 | Extracellular hemoglobin linker L3 subunit; anneli | 6e-04 | |
| 1j8e_A | 44 | Low-density lipoprotein receptor-related protein 1 | 6e-08 | |
| 2jkh_L | 55 | Factor X light chain; plasma, calcium, zymogen, se | 7e-08 | |
| 1aut_L | 114 | Activated protein C; serine proteinase, plasma cal | 8e-08 | |
| 2i1p_A | 48 | Low-density lipoprotein receptor-related protein 2 | 1e-07 | |
| 2i1p_A | 48 | Low-density lipoprotein receptor-related protein 2 | 3e-05 | |
| 2i1p_A | 48 | Low-density lipoprotein receptor-related protein 2 | 3e-05 | |
| 3dpr_E | 39 | LDL-receptor class A 3; human rhinovirus, VLDL-rec | 3e-07 | |
| 3dpr_E | 39 | LDL-receptor class A 3; human rhinovirus, VLDL-rec | 6e-04 | |
| 3dpr_E | 39 | LDL-receptor class A 3; human rhinovirus, VLDL-rec | 6e-04 | |
| 1cr8_A | 42 | Protein (LOW density lipoprotein receptor related | 3e-07 | |
| 1cr8_A | 42 | Protein (LOW density lipoprotein receptor related | 2e-05 | |
| 1cr8_A | 42 | Protein (LOW density lipoprotein receptor related | 2e-05 | |
| 1jrf_A | 47 | TVA LDL-A module, subgroup A ROUS sarcoma virus re | 4e-07 | |
| 3v64_C | 349 | Agrin; beta propeller, laminin-G, signaling, prote | 4e-07 | |
| 3v64_C | 349 | Agrin; beta propeller, laminin-G, signaling, prote | 9e-07 | |
| 3v64_C | 349 | Agrin; beta propeller, laminin-G, signaling, prote | 5e-05 | |
| 1kig_L | 51 | Factor XA; glycoprotein, serine protease, plasma, | 4e-07 | |
| 2knx_A | 50 | Prolow-density lipoprotein receptor-related prote; | 5e-07 | |
| 2knx_A | 50 | Prolow-density lipoprotein receptor-related prote; | 2e-05 | |
| 2knx_A | 50 | Prolow-density lipoprotein receptor-related prote; | 5e-05 | |
| 1k7b_A | 47 | Subgroup A ROUS sarcoma virus receptor PG800 and P | 5e-07 | |
| 2bou_A | 143 | EGF-like module containing mucin-like hormone rece | 6e-07 | |
| 1kli_L | 69 | Factor VIIA; extrinsic coagulation pathway, serine | 2e-06 | |
| 2jm4_A | 43 | Relaxin receptor 1; LDL-A module, RXFP1 receptor, | 3e-06 | |
| 2jm4_A | 43 | Relaxin receptor 1; LDL-A module, RXFP1 receptor, | 2e-05 | |
| 2jm4_A | 43 | Relaxin receptor 1; LDL-A module, RXFP1 receptor, | 2e-05 | |
| 2wph_E | 59 | Coagulation factor IXA light chain; serine proteas | 9e-06 | |
| 2gtl_N | 220 | Extracellular hemoglobin linker L2 subunit; anneli | 1e-05 | |
| 2gtl_N | 220 | Extracellular hemoglobin linker L2 subunit; anneli | 3e-05 | |
| 3h5c_B | 317 | Vitamin K-dependent protein Z; protein Z-protein Z | 2e-05 | |
| 3f1s_B | 283 | Vitamin K-dependent protein Z; PZ, ZPI, complex, s | 2e-05 | |
| 2bz6_L | 53 | Blood coagulation factor VIIA; serine protease, en | 3e-05 | |
| 1nzi_A | 159 | Complement C1S component; calcium, innate immunity | 4e-05 | |
| 3s25_A | 302 | Hypothetical 7-bladed beta-propeller-like protein; | 6e-05 | |
| 2gtl_M | 217 | Hemoglobin linker chain L1; annelid erythrocruorin | 7e-05 | |
| 1nfu_B | 195 | Coagulation factor XA, light chain; hydrolase; HET | 2e-04 | |
| 1z1y_A | 186 | Ookinete surface protein PVS25; four EGF-like doma | 2e-04 | |
| 1szb_A | 170 | Mannose binding lectin-associated serine protease- | 7e-04 |
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 | Back alignment and structure |
|---|
Score = 143 bits (362), Expect = 5e-37
Identities = 99/304 (32%), Positives = 129/304 (42%), Gaps = 31/304 (10%)
Query: 165 CHPNELRCGSSNQCVALSKFCDGKPDCSNGEDEGPFCNAECTPGQFSCGMGKCIPESWKC 224
C +E RC +C++ CD DC +G DE C P F C CIP+ W C
Sbjct: 88 CSQDEFRC-HDGKCISRQFVCDSDRDCLDGSDEASCPVLTCGPASFQCNSSTCIPQLWAC 146
Query: 225 DGFVDCLEDGSDEPN----------TCIHQCFNGQVQCALSKKCIPHNWLCDEEMDCSTD 274
D DC EDGSDE C + C S +CI +W CD DC
Sbjct: 147 DNDPDC-EDGSDEWPQRCRGLYVFQGDSSPCSAFEFHCL-SGECIHSSWRCDGGPDCK-- 202
Query: 275 DIVDNTDEDWDKFHQCFNGQVQCALSKKCIPHNWLCDEEMDCSTDDIVDNTDEDWDKYFS 334
D +DE+ C + QC+ CI + CD E DC D +DE
Sbjct: 203 ---DKSDEENCAVATCRPDEFQCS-DGNCIHGSRQCDREYDCK-----DMSDEV---GCV 250
Query: 335 HNAVLCHPNELRCGSSNQCVALSKFCDGKPDCSNGEDEGPFC--NNKADCENLKCSHKCS 392
+ + PN+ +C S +C+ L K C+ DC + DE N+ N CSH C+
Sbjct: 251 NVTLCEGPNKFKCH-SGECITLDKVCNMARDCRDWSDEPIKECGTNECLDNNGGCSHVCN 309
Query: 393 PTPRGAMCFCPAG-QNPNKTQCVDADECLIDGSCDQTCTNTHLSYVCSCTEGYTLRPDGK 451
G C CP G Q + +C D DEC +C Q C N Y C C EG+ L P K
Sbjct: 310 DLKIGYECLCPDGFQLVAQRRCEDIDECQDPDTCSQLCVNLEGGYKCQCEEGFQLDPHTK 369
Query: 452 SCTA 455
+C A
Sbjct: 370 ACKA 373
|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 | Back alignment and structure |
|---|
| >2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B Length = 80 | Back alignment and structure |
|---|
| >2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B Length = 80 | Back alignment and structure |
|---|
| >2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B Length = 80 | Back alignment and structure |
|---|
| >2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 | Back alignment and structure |
|---|
| >2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 | Back alignment and structure |
|---|
| >2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B Length = 82 | Back alignment and structure |
|---|
| >2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B Length = 82 | Back alignment and structure |
|---|
| >2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B Length = 82 | Back alignment and structure |
|---|
| >2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B Length = 82 | Back alignment and structure |
|---|
| >1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Length = 267 | Back alignment and structure |
|---|
| >1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Length = 267 | Back alignment and structure |
|---|
| >1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Length = 267 | Back alignment and structure |
|---|
| >1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Length = 267 | Back alignment and structure |
|---|
| >1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Length = 267 | Back alignment and structure |
|---|
| >1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Length = 87 | Back alignment and structure |
|---|
| >1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Length = 87 | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 | Back alignment and structure |
|---|
| >2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Length = 565 | Back alignment and structure |
|---|
| >2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Length = 565 | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 | Back alignment and structure |
|---|
| >1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Length = 118 | Back alignment and structure |
|---|
| >1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86 | Back alignment and structure |
|---|
| >3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Length = 318 | Back alignment and structure |
|---|
| >3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Length = 318 | Back alignment and structure |
|---|
| >3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Length = 318 | Back alignment and structure |
|---|
| >3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Length = 318 | Back alignment and structure |
|---|
| >2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 | Back alignment and structure |
|---|
| >2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 | Back alignment and structure |
|---|
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 | Back alignment and structure |
|---|
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 | Back alignment and structure |
|---|
| >1d2l_A Lipoprotein receptor related protein; ligand binding, calcium binding, complement-like repeat, signaling protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 45 | Back alignment and structure |
|---|
| >1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Length = 316 | Back alignment and structure |
|---|
| >1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Length = 316 | Back alignment and structure |
|---|
| >1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Length = 316 | Back alignment and structure |
|---|
| >1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Length = 316 | Back alignment and structure |
|---|
| >1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Length = 53 | Back alignment and structure |
|---|
| >4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Length = 628 | Back alignment and structure |
|---|
| >4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Length = 628 | Back alignment and structure |
|---|
| >4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Length = 628 | Back alignment and structure |
|---|
| >4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Length = 628 | Back alignment and structure |
|---|
| >4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Length = 628 | Back alignment and structure |
|---|
| >1ajj_A LR5, low-density lipoprotein receptor; LDL receptor, cysteine-rich module, calcium; 1.70A {Homo sapiens} SCOP: g.12.1.1 Length = 37 | Back alignment and structure |
|---|
| >3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} Length = 619 | Back alignment and structure |
|---|
| >3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} Length = 619 | Back alignment and structure |
|---|
| >3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} Length = 619 | Back alignment and structure |
|---|
| >3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} Length = 619 | Back alignment and structure |
|---|
| >3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} Length = 619 | Back alignment and structure |
|---|
| >3a7q_B Low-density lipoprotein receptor-related protein; signaling protein; HET: NAG; 2.60A {Homo sapiens} Length = 44 | Back alignment and structure |
|---|
| >2kny_A LRP-1, linker, APO-E; lipoprotein receptor, ligand binding module, COMP repeat, calcium, cell membrane, coated PIT, cytoplasm, DEVE protein; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >2kny_A LRP-1, linker, APO-E; lipoprotein receptor, ligand binding module, COMP repeat, calcium, cell membrane, coated PIT, cytoplasm, DEVE protein; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >2kny_A LRP-1, linker, APO-E; lipoprotein receptor, ligand binding module, COMP repeat, calcium, cell membrane, coated PIT, cytoplasm, DEVE protein; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >2kny_A LRP-1, linker, APO-E; lipoprotein receptor, ligand binding module, COMP repeat, calcium, cell membrane, coated PIT, cytoplasm, DEVE protein; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >2gtl_O Extracellular hemoglobin linker L3 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 215 | Back alignment and structure |
|---|
| >2gtl_O Extracellular hemoglobin linker L3 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 215 | Back alignment and structure |
|---|
| >2gtl_O Extracellular hemoglobin linker L3 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 215 | Back alignment and structure |
|---|
| >1j8e_A Low-density lipoprotein receptor-related protein 1; ligand binding, calcium binding, complement-like repeat, LRP receptor, signaling protein; 1.85A {Homo sapiens} SCOP: g.12.1.1 Length = 44 | Back alignment and structure |
|---|
| >2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Length = 55 | Back alignment and structure |
|---|
| >1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 | Back alignment and structure |
|---|
| >2i1p_A Low-density lipoprotein receptor-related protein 2; cysteine-rich repeat, ligand binding domain, calcium CAGE, ligand binding protein; NMR {Rattus norvegicus} Length = 48 | Back alignment and structure |
|---|
| >2i1p_A Low-density lipoprotein receptor-related protein 2; cysteine-rich repeat, ligand binding domain, calcium CAGE, ligand binding protein; NMR {Rattus norvegicus} Length = 48 | Back alignment and structure |
|---|
| >2i1p_A Low-density lipoprotein receptor-related protein 2; cysteine-rich repeat, ligand binding domain, calcium CAGE, ligand binding protein; NMR {Rattus norvegicus} Length = 48 | Back alignment and structure |
|---|
| >3dpr_E LDL-receptor class A 3; human rhinovirus, VLDL-receptor, virus-protein complex, icosahedral virus, ATP-binding, capsid protein; HET: DAO; 3.50A {Homo sapiens} PDB: 1v9u_5* Length = 39 | Back alignment and structure |
|---|
| >3dpr_E LDL-receptor class A 3; human rhinovirus, VLDL-receptor, virus-protein complex, icosahedral virus, ATP-binding, capsid protein; HET: DAO; 3.50A {Homo sapiens} PDB: 1v9u_5* Length = 39 | Back alignment and structure |
|---|
| >3dpr_E LDL-receptor class A 3; human rhinovirus, VLDL-receptor, virus-protein complex, icosahedral virus, ATP-binding, capsid protein; HET: DAO; 3.50A {Homo sapiens} PDB: 1v9u_5* Length = 39 | Back alignment and structure |
|---|
| >1cr8_A Protein (LOW density lipoprotein receptor related protein); ligand binding, calcium binding, LDLR, LRP, lipid binding protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 42 | Back alignment and structure |
|---|
| >1cr8_A Protein (LOW density lipoprotein receptor related protein); ligand binding, calcium binding, LDLR, LRP, lipid binding protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 42 | Back alignment and structure |
|---|
| >1cr8_A Protein (LOW density lipoprotein receptor related protein); ligand binding, calcium binding, LDLR, LRP, lipid binding protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 42 | Back alignment and structure |
|---|
| >1jrf_A TVA LDL-A module, subgroup A ROUS sarcoma virus receptors PG800 and PG950; disulfide bond, alpha helix, calcium CAGE, signaling protein; NMR {Coturnix japonica} SCOP: g.12.1.1 Length = 47 | Back alignment and structure |
|---|
| >3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Length = 349 | Back alignment and structure |
|---|
| >3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Length = 349 | Back alignment and structure |
|---|
| >3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Length = 349 | Back alignment and structure |
|---|
| >1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 Length = 51 | Back alignment and structure |
|---|
| >2knx_A Prolow-density lipoprotein receptor-related prote; LDLR, ligand binding module, ligand binding repeat, compleme repeat, protein binding; NMR {Homo sapiens} Length = 50 | Back alignment and structure |
|---|
| >2knx_A Prolow-density lipoprotein receptor-related prote; LDLR, ligand binding module, ligand binding repeat, compleme repeat, protein binding; NMR {Homo sapiens} Length = 50 | Back alignment and structure |
|---|
| >2knx_A Prolow-density lipoprotein receptor-related prote; LDLR, ligand binding module, ligand binding repeat, compleme repeat, protein binding; NMR {Homo sapiens} Length = 50 | Back alignment and structure |
|---|
| >1k7b_A Subgroup A ROUS sarcoma virus receptor PG800 and PG950; beta hairpin, 3-10 helix, calcium binding, membrane protein; NMR {Coturnix coturnix} SCOP: g.12.1.1 Length = 47 | Back alignment and structure |
|---|
| >2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 | Back alignment and structure |
|---|
| >1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* Length = 69 | Back alignment and structure |
|---|
| >2jm4_A Relaxin receptor 1; LDL-A module, RXFP1 receptor, LGR7, signaling protein; NMR {Homo sapiens} Length = 43 | Back alignment and structure |
|---|
| >2jm4_A Relaxin receptor 1; LDL-A module, RXFP1 receptor, LGR7, signaling protein; NMR {Homo sapiens} Length = 43 | Back alignment and structure |
|---|
| >2jm4_A Relaxin receptor 1; LDL-A module, RXFP1 receptor, LGR7, signaling protein; NMR {Homo sapiens} Length = 43 | Back alignment and structure |
|---|
| >2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* Length = 59 | Back alignment and structure |
|---|
| >2gtl_N Extracellular hemoglobin linker L2 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 220 | Back alignment and structure |
|---|
| >2gtl_N Extracellular hemoglobin linker L2 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 220 | Back alignment and structure |
|---|
| >3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 | Back alignment and structure |
|---|
| >3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} Length = 283 | Back alignment and structure |
|---|
| >2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* Length = 53 | Back alignment and structure |
|---|
| >1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Length = 159 | Back alignment and structure |
|---|
| >3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Length = 302 | Back alignment and structure |
|---|
| >2gtl_M Hemoglobin linker chain L1; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 217 | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 | Back alignment and structure |
|---|
| >1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Length = 186 | Back alignment and structure |
|---|
| >1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Length = 170 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 482 | |||
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 100.0 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 100.0 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 100.0 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 100.0 | |
| 2fyj_A | 82 | Low-density lipoprotein receptor-related protein 1 | 99.79 | |
| 2fcw_B | 80 | LDL receptor, low-density lipoprotein receptor; pr | 99.76 | |
| 2fyj_A | 82 | Low-density lipoprotein receptor-related protein 1 | 99.76 | |
| 2fcw_B | 80 | LDL receptor, low-density lipoprotein receptor; pr | 99.74 | |
| 3p5b_L | 400 | Low density lipoprotein receptor variant; B-propel | 99.43 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 99.39 | |
| 2xrc_A | 565 | Human complement factor I; immune system, hydrolas | 99.27 | |
| 2gtl_O | 215 | Extracellular hemoglobin linker L3 subunit; anneli | 99.25 | |
| 2gtl_O | 215 | Extracellular hemoglobin linker L3 subunit; anneli | 99.25 | |
| 2xrc_A | 565 | Human complement factor I; immune system, hydrolas | 99.2 | |
| 2w2n_E | 107 | LDL receptor, low-density lipoprotein receptor; hy | 99.19 | |
| 1z6c_A | 87 | Vitamin K-dependent protein S; EGF module, blood c | 99.13 | |
| 2vj3_A | 135 | Neurogenic locus notch homolog protein 1; transcri | 99.12 | |
| 2bou_A | 143 | EGF-like module containing mucin-like hormone rece | 99.12 | |
| 2kny_A | 80 | LRP-1, linker, APO-E; lipoprotein receptor, ligand | 99.09 | |
| 1x7a_L | 146 | Coagulation factor IX, light chain; inhibition, bl | 99.07 | |
| 1lmj_A | 86 | Fibrillin 1; EGF, calcium, microfibril, neonatal, | 99.06 | |
| 1d2l_A | 45 | Lipoprotein receptor related protein; ligand bindi | 99.04 | |
| 1ajj_A | 37 | LR5, low-density lipoprotein receptor; LDL recepto | 99.03 | |
| 1cr8_A | 42 | Protein (LOW density lipoprotein receptor related | 99.03 | |
| 2jm4_A | 43 | Relaxin receptor 1; LDL-A module, RXFP1 receptor, | 99.02 | |
| 1emn_A | 82 | Fibrillin; extracellular matrix, calcium-binding, | 99.0 | |
| 2m0p_A | 52 | Low-density lipoprotein receptor-related protein; | 98.99 | |
| 3a7q_B | 44 | Low-density lipoprotein receptor-related protein; | 98.99 | |
| 1aut_L | 114 | Activated protein C; serine proteinase, plasma cal | 98.97 | |
| 2knx_A | 50 | Prolow-density lipoprotein receptor-related prote; | 98.95 | |
| 1k7b_A | 47 | Subgroup A ROUS sarcoma virus receptor PG800 and P | 98.95 | |
| 1j8e_A | 44 | Low-density lipoprotein receptor-related protein 1 | 98.93 | |
| 1nfu_B | 195 | Coagulation factor XA, light chain; hydrolase; HET | 98.92 | |
| 1cr8_A | 42 | Protein (LOW density lipoprotein receptor related | 98.91 | |
| 3dpr_E | 39 | LDL-receptor class A 3; human rhinovirus, VLDL-rec | 98.9 | |
| 1jrf_A | 47 | TVA LDL-A module, subgroup A ROUS sarcoma virus re | 98.89 | |
| 2vh0_B | 134 | Activated factor XA light chain; serine protease, | 98.88 | |
| 1ajj_A | 37 | LR5, low-density lipoprotein receptor; LDL recepto | 98.87 | |
| 1dx5_I | 118 | Thrombomodulin; serine proteinase, EGF-like domain | 98.87 | |
| 2c4f_L | 142 | Coagulation factor VII precursor; blood coagulatio | 98.86 | |
| 2i1p_A | 48 | Low-density lipoprotein receptor-related protein 2 | 98.86 | |
| 2i1p_A | 48 | Low-density lipoprotein receptor-related protein 2 | 98.86 | |
| 2kny_A | 80 | LRP-1, linker, APO-E; lipoprotein receptor, ligand | 98.85 | |
| 3dpr_E | 39 | LDL-receptor class A 3; human rhinovirus, VLDL-rec | 98.82 | |
| 1d2l_A | 45 | Lipoprotein receptor related protein; ligand bindi | 98.82 | |
| 1z1y_A | 186 | Ookinete surface protein PVS25; four EGF-like doma | 98.81 | |
| 2knx_A | 50 | Prolow-density lipoprotein receptor-related prote; | 98.81 | |
| 2jm4_A | 43 | Relaxin receptor 1; LDL-A module, RXFP1 receptor, | 98.8 | |
| 3a7q_B | 44 | Low-density lipoprotein receptor-related protein; | 98.8 | |
| 2m0p_A | 52 | Low-density lipoprotein receptor-related protein; | 98.78 | |
| 3h5c_B | 317 | Vitamin K-dependent protein Z; protein Z-protein Z | 98.73 | |
| 1k7b_A | 47 | Subgroup A ROUS sarcoma virus receptor PG800 and P | 98.72 | |
| 4d90_A | 143 | EGF-like repeat and discoidin I-like domain-conta | 98.7 | |
| 1kli_L | 69 | Factor VIIA; extrinsic coagulation pathway, serine | 98.68 | |
| 2jkh_L | 55 | Factor X light chain; plasma, calcium, zymogen, se | 98.68 | |
| 1j8e_A | 44 | Low-density lipoprotein receptor-related protein 1 | 98.63 | |
| 3v64_C | 349 | Agrin; beta propeller, laminin-G, signaling, prote | 98.6 | |
| 2w86_A | 147 | Fibrillin-1, fibrillin1; phosphoprotein, EGF-like | 98.59 | |
| 1jrf_A | 47 | TVA LDL-A module, subgroup A ROUS sarcoma virus re | 98.59 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 98.58 | |
| 1z1y_A | 186 | Ookinete surface protein PVS25; four EGF-like doma | 98.55 | |
| 1yo8_A | 634 | Thrombospondin-2; EGF, Ca(2+)-binding domains, lec | 98.55 | |
| 1dx5_I | 118 | Thrombomodulin; serine proteinase, EGF-like domain | 98.54 | |
| 1kig_L | 51 | Factor XA; glycoprotein, serine protease, plasma, | 98.49 | |
| 1yo8_A | 634 | Thrombospondin-2; EGF, Ca(2+)-binding domains, lec | 98.49 | |
| 2vj3_A | 135 | Neurogenic locus notch homolog protein 1; transcri | 98.47 | |
| 2bz6_L | 53 | Blood coagulation factor VIIA; serine protease, en | 98.46 | |
| 2gtl_N | 220 | Extracellular hemoglobin linker L2 subunit; anneli | 98.37 | |
| 1tpg_A | 91 | T-plasminogen activator F1-G; plasminogen activati | 98.33 | |
| 4d90_A | 143 | EGF-like repeat and discoidin I-like domain-conta | 98.25 | |
| 1apq_A | 53 | Complement protease C1R; EGF, calcium binding, ser | 98.23 | |
| 2gtl_M | 217 | Hemoglobin linker chain L1; annelid erythrocruorin | 98.23 | |
| 2gtl_N | 220 | Extracellular hemoglobin linker L2 subunit; anneli | 98.2 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 98.19 | |
| 2bou_A | 143 | EGF-like module containing mucin-like hormone rece | 98.17 | |
| 2wph_E | 59 | Coagulation factor IXA light chain; serine proteas | 98.13 | |
| 2gtl_M | 217 | Hemoglobin linker chain L1; annelid erythrocruorin | 98.07 | |
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 98.01 | |
| 1emn_A | 82 | Fibrillin; extracellular matrix, calcium-binding, | 97.9 | |
| 4a0p_A | 628 | LRP6, LRP-6, low-density lipoprotein receptor-rela | 97.83 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 97.79 | |
| 1lmj_A | 86 | Fibrillin 1; EGF, calcium, microfibril, neonatal, | 97.76 | |
| 2w2n_E | 107 | LDL receptor, low-density lipoprotein receptor; hy | 97.76 | |
| 3ojy_B | 537 | Complement component C8 beta chain; macpf, lipocal | 97.63 | |
| 3ojy_B | 537 | Complement component C8 beta chain; macpf, lipocal | 97.62 | |
| 1z6c_A | 87 | Vitamin K-dependent protein S; EGF module, blood c | 97.61 | |
| 2jkh_L | 55 | Factor X light chain; plasma, calcium, zymogen, se | 97.56 | |
| 3ojy_A | 554 | Complement component C8 alpha chain; macpf, lipoca | 97.54 | |
| 1x7a_L | 146 | Coagulation factor IX, light chain; inhibition, bl | 97.52 | |
| 2wph_E | 59 | Coagulation factor IXA light chain; serine proteas | 97.45 | |
| 1kig_L | 51 | Factor XA; glycoprotein, serine protease, plasma, | 97.45 | |
| 3ojy_A | 554 | Complement component C8 alpha chain; macpf, lipoca | 97.39 | |
| 3s94_A | 619 | LRP-6, low-density lipoprotein receptor-related pr | 97.32 | |
| 1kli_L | 69 | Factor VIIA; extrinsic coagulation pathway, serine | 97.28 | |
| 1szb_A | 170 | Mannose binding lectin-associated serine protease- | 97.19 | |
| 2bz6_L | 53 | Blood coagulation factor VIIA; serine protease, en | 97.15 | |
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 97.15 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 97.12 | |
| 3h5c_B | 317 | Vitamin K-dependent protein Z; protein Z-protein Z | 97.11 | |
| 3p5b_L | 400 | Low density lipoprotein receptor variant; B-propel | 97.09 | |
| 1aut_L | 114 | Activated protein C; serine proteinase, plasma cal | 97.07 | |
| 3f1s_B | 283 | Vitamin K-dependent protein Z; PZ, ZPI, complex, s | 97.04 | |
| 2kl7_A | 71 | Fibulin-4; secreted, calcium, disease mutation, di | 97.0 | |
| 2c4f_L | 142 | Coagulation factor VII precursor; blood coagulatio | 96.99 | |
| 2vh0_B | 134 | Activated factor XA light chain; serine protease, | 96.85 | |
| 1tpg_A | 91 | T-plasminogen activator F1-G; plasminogen activati | 96.85 | |
| 1nfu_B | 195 | Coagulation factor XA, light chain; hydrolase; HET | 96.8 | |
| 1nzi_A | 159 | Complement C1S component; calcium, innate immunity | 96.6 | |
| 4fbr_A | 267 | Lectin, myxobacterial hemagglutinin; beta-barrel, | 96.31 | |
| 3t5o_A | 913 | Complement component C6; macpf, MAC, membrane atta | 96.19 | |
| 1apq_A | 53 | Complement protease C1R; EGF, calcium binding, ser | 96.07 | |
| 2w86_A | 147 | Fibrillin-1, fibrillin1; phosphoprotein, EGF-like | 96.04 | |
| 1edm_B | 39 | Factor IX; epidermal growth factor, EGF, calcium- | 95.82 | |
| 3fcs_B | 690 | Integrin beta-3; beta propeller, rossmann fold, EG | 95.67 | |
| 2k2s_B | 61 | Micronemal protein 6; microneme protein complex, c | 95.53 | |
| 1gl4_A | 285 | Nidogen-1, entactin; immunoglobulin-like domain, e | 95.48 | |
| 1ijq_A | 316 | LDL receptor, low-density lipoprotein receptor; be | 95.47 | |
| 3t5o_A | 913 | Complement component C6; macpf, MAC, membrane atta | 95.47 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 95.29 | |
| 3sov_A | 318 | LRP-6, low-density lipoprotein receptor-related pr | 94.87 | |
| 4fbr_A | 267 | Lectin, myxobacterial hemagglutinin; beta-barrel, | 94.64 | |
| 3s94_A | 619 | LRP-6, low-density lipoprotein receptor-related pr | 94.43 | |
| 1edm_B | 39 | Factor IX; epidermal growth factor, EGF, calcium- | 94.16 | |
| 3u7u_G | 55 | Neuregulin 1; signaling protein, transferase-trans | 93.97 | |
| 3fcs_B | 690 | Integrin beta-3; beta propeller, rossmann fold, EG | 93.76 | |
| 1egf_A | 53 | Epidermal growth factor; NMR {Mus musculus} SCOP: | 93.17 | |
| 3u7u_G | 55 | Neuregulin 1; signaling protein, transferase-trans | 93.17 | |
| 2gy5_A | 423 | Angiopoietin-1 receptor; ligand-binding domain, tr | 92.94 | |
| 2k2s_B | 61 | Micronemal protein 6; microneme protein complex, c | 92.9 | |
| 3v64_C | 349 | Agrin; beta propeller, laminin-G, signaling, prote | 91.77 | |
| 1a3p_A | 45 | Epidermal growth factor; disulfide connectivities, | 91.5 | |
| 1hae_A | 63 | Heregulin-alpha; growth factor; NMR {Homo sapiens} | 91.41 | |
| 1egf_A | 53 | Epidermal growth factor; NMR {Mus musculus} SCOP: | 90.88 | |
| 3f1s_B | 283 | Vitamin K-dependent protein Z; PZ, ZPI, complex, s | 90.87 | |
| 1g1s_A | 162 | P-selectin; selectin, lectin, EGF, sulphated, SLEX | 90.8 | |
| 1a3p_A | 45 | Epidermal growth factor; disulfide connectivities, | 90.32 | |
| 1hae_A | 63 | Heregulin-alpha; growth factor; NMR {Homo sapiens} | 90.24 | |
| 2gy5_A | 423 | Angiopoietin-1 receptor; ligand-binding domain, tr | 90.21 | |
| 1k36_A | 46 | Epiregulin; EGF-like fold, hormone/growth factor c | 89.69 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 89.46 | |
| 1g1s_A | 162 | P-selectin; selectin, lectin, EGF, sulphated, SLEX | 88.56 | |
| 1szb_A | 170 | Mannose binding lectin-associated serine protease- | 87.9 | |
| 2kl7_A | 71 | Fibulin-4; secreted, calcium, disease mutation, di | 87.85 | |
| 1gl4_A | 285 | Nidogen-1, entactin; immunoglobulin-like domain, e | 87.44 | |
| 2wg3_C | 463 | Hedgehog-interacting protein; lipoprotein, develop | 87.4 | |
| 1n1i_A | 105 | Merozoite surface protein-1; MSP1, malaria, surfac | 87.25 | |
| 3ca7_A | 52 | Protein spitz; argos, EGF, developmental protein, | 86.66 | |
| 1k36_A | 46 | Epiregulin; EGF-like fold, hormone/growth factor c | 85.42 | |
| 1ob1_C | 99 | Major merozoite surface protein; immune system, im | 83.77 | |
| 4a0p_A | 628 | LRP6, LRP-6, low-density lipoprotein receptor-rela | 83.07 | |
| 1nzi_A | 159 | Complement C1S component; calcium, innate immunity | 80.37 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 80.27 |
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A | Back alignment and structure |
|---|
Probab=100.00 E-value=2.4e-65 Score=567.09 Aligned_cols=371 Identities=33% Similarity=0.729 Sum_probs=292.5
Q ss_pred cccCCCCeeeCCCCCeecCccccCCCCCCCCCCCCCCCCccc--ccccceeccCcccccceeccCCCceeeecccccccc
Q psy14262 3 HQCFNGQVQCALSKKCIPHNWLCDEEMDCSTDDIVDNTDEDW--DKYFKRILNGTHTLALEFNHRNQSLCFIQQQNVSSV 80 (482)
Q Consensus 3 ~~C~~~~f~C~~~~~Ci~~~~~CDg~~dC~~~~~~d~sDE~~--~~~~~~~~~~~~~~~~~~~c~~~~~c~~~~~~~~~~ 80 (482)
+.|.++||+|. ||+|||..|+|||++||+ |+|||.. |...
T Consensus 4 ~~C~~~~f~C~-~g~ci~~~~~Cdg~~dC~-----d~sDE~~~~C~~~-------------------------------- 45 (699)
T 1n7d_A 4 DRCERNEFQCQ-DGKCISYKWVCDGSAECQ-----DGSDESQETCLSV-------------------------------- 45 (699)
T ss_dssp ----------------------------------------------CC--------------------------------
T ss_pred CCCCccceeCC-CCcEEcHHhcCCCcccCC-----CCCCCCccccCCc--------------------------------
Confidence 57999999998 899999999999999998 9999975 3110
Q ss_pred cccccccccCCCCCCCCCCCCCChhhhhhhccCCCCCCcceeeCC---ceecCceeeCCCCCCCcccCCCCCCccccccC
Q psy14262 81 RLRCAQINDLLNSWDLPAPEIFPLDERLEKAGMHGENRSPLVTKN---IQWPSSLVIDYNQDILYWCDSHLNTVESVRVD 157 (482)
Q Consensus 81 ~~~c~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~ci~~~~~cdg~~dc~dw~d~~~~sdE~~~~~ 157 (482)
.| ....|.|.+ +|||..|+|||..||.| ||||.
T Consensus 46 --~C--------------------------------~~~~f~C~~~~~~Ci~~~~~Cdg~~dC~d------gsDE~---- 81 (699)
T 1n7d_A 46 --TC--------------------------------KSGDFSCGGRVNRCIPQFWRCDGQVDCDN------GSDEQ---- 81 (699)
T ss_dssp --SC--------------------------------SSSSCCCCC--CCCCCSSSTTSSSCCC-C------CCTTT----
T ss_pred --CC--------------------------------CCCccCCCCCCCceeCcceecCCcccCCC------CcccC----
Confidence 01 001244433 79999999999999999 99998
Q ss_pred CCCCCccCCCCCeecCCCCceecCCcccCCCCCCCCCCCCCCCCC-CCCCCCceecCCCCeeccCCCCCCCcCCCCCCCC
Q psy14262 158 GSHNAVLCHPNELRCGSSNQCVALSKFCDGKPDCSNGEDEGPFCN-AECTPGQFSCGMGKCIPESWKCDGFVDCLEDGSD 236 (482)
Q Consensus 158 ~~c~~~~C~~~~f~C~~~~~Ci~~~~~CDg~~dC~dgsDE~~~C~-~~C~~~~f~C~~g~Ci~~~~~CDg~~dC~~dgsD 236 (482)
+|...+|.+.+|+|.++ +||+.+|+|||..||.|||||.+ |. ..|.+.+|+|.+|+||+..|+|||..|| .||||
T Consensus 82 -~C~~~~C~~~~f~C~~g-~Ci~~~~~Cdg~~dC~dgsDE~~-C~~~~C~~~~f~C~~~~Ci~~~~~Cdg~~dC-~dgsD 157 (699)
T 1n7d_A 82 -GCPPKTCSQDEFRCHDG-KCISRQFVCDSDRDCLDGSDEAS-CPVLTCGPASFQCNSSTCIPQLWACDNDPDC-EDGSD 157 (699)
T ss_dssp -SCSSCCCCSSCCCSSCC-----CCCTTCSSCCSSSSCSSSS-CCCCCCCSSCCCCSSSCCCCTTSTTCSSCCS-SSSSS
T ss_pred -cccccccccCcEEcCCC-CEecHHHcCCCcCcCCCCCccCC-cCccccCccccCCCCCcccchhcccCCCCcC-CCCcc
Confidence 89888899999999987 89999999999999999999998 97 5799999999999999999999999999 99999
Q ss_pred C--CCccc--------ccccCCccccCCCCceecCCCccCccCCCCCCCCCCCCCCCCCCCccccCcccccCCCCccCCC
Q psy14262 237 E--PNTCI--------HQCFNGQVQCALSKKCIPHNWLCDEEMDCSTDDIVDNTDEDWDKFHQCFNGQVQCALSKKCIPH 306 (482)
Q Consensus 237 E--~~C~~--------~~C~~~~f~C~~~g~Ci~~~~~CDg~~dC~~~~~~dgsDE~~C~~~~C~~~~f~C~~g~~Ci~~ 306 (482)
| .+|.. ..|...+|+|. +|.||+..|+|||..||. ||+||.+|....|.+.+|+|.++ +||+.
T Consensus 158 E~~~~C~~~~~~~~~~~~C~~~~f~C~-~g~Ci~~~~~CDg~~dC~-----dgsDE~~C~~~~C~~~~f~C~~g-~Ci~~ 230 (699)
T 1n7d_A 158 EWPQRCRGLYVFQGDSSPCSAFEFHCL-SGECIHSSWRCDGGPDCK-----DKSDEENCAVATCRPDEFQCSDG-NCIHG 230 (699)
T ss_dssp SSCSSSSCCCCCSSCCCCSCSSSCCCS-SSCCCSTTCTTSSSCCST-----TSCSSCSCCCCCCCSSEEESSSS-CEEET
T ss_pred cccccCCCcccccCCCCCCCCcceecC-CCceEechhccCCCCCCC-----CCcccccCCCcccCCCcEecCCC-ceeee
Confidence 9 88953 46999999999 889999999999999999 99999999878899999999976 99999
Q ss_pred CCCCCCCCCCCCCCcCCCCCCCcCCcCccCcccc-cCCCcccCCCCcccccccccCCCCCCCCCCCCCC-CCCCCCCcc-
Q psy14262 307 NWLCDEEMDCSTDDIVDNTDEDWDKYFSHNAVLC-HPNELRCGSSNQCVALSKFCDGKPDCSNGEDEGP-FCNNKADCE- 383 (482)
Q Consensus 307 ~~~CDg~~DC~~g~~~dgsDE~~~~~C~~~~~~C-~~~~f~C~~g~~Ci~~~~~CDg~~dC~dgsDE~~-~C~~~~~C~- 383 (482)
+|+|||+.||. ||+||.+ |.. ...| .+.+|+|.++ .||+..++||+..+|.+|+||.. .|.++ +|.
T Consensus 231 ~~~Cdg~~dC~-----dgsde~~---C~~-~~~C~~~~~~~C~~g-~Ci~~~~~Cd~~~dC~dgsDe~~~~C~~~-eC~~ 299 (699)
T 1n7d_A 231 SRQCDREYDCK-----DMSDEVG---CVN-VTLCEGPNKFKCHSG-ECITLDKVCNMARDCRDWSDEPIKECGTN-ECLD 299 (699)
T ss_dssp TCCSSSCCCSS-----SSCSSSS---TTC-CCCCCSTTCCCCTTS-CCCCSSCCSCSSCCSSSSCSCCCSSCCCC-CTTS
T ss_pred ecccCCCCCCC-----CCCccCC---CCC-CCcccCCCceecCCC-cEeCCcccccccceecCcccccccccccc-cccc
Confidence 99999999999 9999998 865 3467 4778999997 99999999999999999999974 37777 897
Q ss_pred -CCCCcCCCCCCCCCccccCCCCc-cCCCCCccccccccCCCCCCceeeecCCceEEecCCCeEECCCCCccccCCCCCC
Q psy14262 384 -NLKCSHKCSPTPRGAMCFCPAGQ-NPNKTQCVDADECLIDGSCDQTCTNTHLSYVCSCTEGYTLRPDGKSCTAVNVPQD 461 (482)
Q Consensus 384 -~~~C~~~C~~~~~~~~C~C~~G~-~~~~~~C~di~eC~~~~~Cs~~C~n~~gsy~C~C~~Gy~l~~d~~tC~didec~~ 461 (482)
+++|+++|.+++++|+|.|++|| ..++++|++++||..+++|+++|+|++|+|+|.|++||++..++++|++++ .
T Consensus 300 ~~~~C~~~C~~~~~~~~C~C~~G~~~~~~~~C~dideC~~~~~C~~~C~n~~g~y~C~C~~G~~~~~~~~~C~~~~---~ 376 (699)
T 1n7d_A 300 NNGGCSHVCNDLKIGYECLCPDGFQLVAQRRCEDIDECQDPDTCSQLCVNLEGGYKCQCEEGFQLDPHTKACKAVG---S 376 (699)
T ss_dssp STTTSCTTCCCCTTCCCCCCCSSSCCCSSSCCCCCCCCSSSSSCTTTCCBCSSCBCCCCCSSCBCCSSCCCCBCCS---S
T ss_pred cccCcCCCcccCCCCcEEeCCCCeEcCCCCcccCccccCCCCccccccccCCCCeeeeeecccccCCCCCcccccc---c
Confidence 46799999999999999999999 556889999999986788999999999999999999999999999999886 4
Q ss_pred CCcEEEeccCCceEEEeccC
Q psy14262 462 EPASIIFSSTVDIRRIHLNG 481 (482)
Q Consensus 462 ~p~~l~~~~~~~ir~~~l~~ 481 (482)
.+ +|||+++++|++|.|.+
T Consensus 377 ~~-~ll~~~~~~I~~id~~~ 395 (699)
T 1n7d_A 377 IA-YLFFTNRHEVRKMTLDR 395 (699)
T ss_dssp CC-CBCCCCTTC-CEECTTS
T ss_pred ce-eEEecCccceEEEeCCC
Confidence 56 99999999999999865
|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} | Back alignment and structure |
|---|
| >2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B | Back alignment and structure |
|---|
| >2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B | Back alignment and structure |
|---|
| >2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B | Back alignment and structure |
|---|
| >2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} | Back alignment and structure |
|---|
| >2gtl_O Extracellular hemoglobin linker L3 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 | Back alignment and structure |
|---|
| >2gtl_O Extracellular hemoglobin linker L3 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 | Back alignment and structure |
|---|
| >2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} | Back alignment and structure |
|---|
| >2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A | Back alignment and structure |
|---|
| >1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* | Back alignment and structure |
|---|
| >2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A | Back alignment and structure |
|---|
| >2kny_A LRP-1, linker, APO-E; lipoprotein receptor, ligand binding module, COMP repeat, calcium, cell membrane, coated PIT, cytoplasm, DEVE protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* | Back alignment and structure |
|---|
| >1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 | Back alignment and structure |
|---|
| >1d2l_A Lipoprotein receptor related protein; ligand binding, calcium binding, complement-like repeat, signaling protein; NMR {Homo sapiens} SCOP: g.12.1.1 | Back alignment and structure |
|---|
| >1ajj_A LR5, low-density lipoprotein receptor; LDL receptor, cysteine-rich module, calcium; 1.70A {Homo sapiens} SCOP: g.12.1.1 | Back alignment and structure |
|---|
| >1cr8_A Protein (LOW density lipoprotein receptor related protein); ligand binding, calcium binding, LDLR, LRP, lipid binding protein; NMR {Homo sapiens} SCOP: g.12.1.1 | Back alignment and structure |
|---|
| >2jm4_A Relaxin receptor 1; LDL-A module, RXFP1 receptor, LGR7, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A | Back alignment and structure |
|---|
| >2m0p_A Low-density lipoprotein receptor-related protein; complement type repeat, megalin, LDL receptor FAMI lipid binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3a7q_B Low-density lipoprotein receptor-related protein; signaling protein; HET: NAG; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* | Back alignment and structure |
|---|
| >2knx_A Prolow-density lipoprotein receptor-related prote; LDLR, ligand binding module, ligand binding repeat, compleme repeat, protein binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1k7b_A Subgroup A ROUS sarcoma virus receptor PG800 and PG950; beta hairpin, 3-10 helix, calcium binding, membrane protein; NMR {Coturnix coturnix} SCOP: g.12.1.1 | Back alignment and structure |
|---|
| >1j8e_A Low-density lipoprotein receptor-related protein 1; ligand binding, calcium binding, complement-like repeat, LRP receptor, signaling protein; 1.85A {Homo sapiens} SCOP: g.12.1.1 | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* | Back alignment and structure |
|---|
| >1cr8_A Protein (LOW density lipoprotein receptor related protein); ligand binding, calcium binding, LDLR, LRP, lipid binding protein; NMR {Homo sapiens} SCOP: g.12.1.1 | Back alignment and structure |
|---|
| >3dpr_E LDL-receptor class A 3; human rhinovirus, VLDL-receptor, virus-protein complex, icosahedral virus, ATP-binding, capsid protein; HET: DAO; 3.50A {Homo sapiens} PDB: 1v9u_5* | Back alignment and structure |
|---|
| >1jrf_A TVA LDL-A module, subgroup A ROUS sarcoma virus receptors PG800 and PG950; disulfide bond, alpha helix, calcium CAGE, signaling protein; NMR {Coturnix japonica} SCOP: g.12.1.1 | Back alignment and structure |
|---|
| >2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... | Back alignment and structure |
|---|
| >1ajj_A LR5, low-density lipoprotein receptor; LDL receptor, cysteine-rich module, calcium; 1.70A {Homo sapiens} SCOP: g.12.1.1 | Back alignment and structure |
|---|
| >1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A | Back alignment and structure |
|---|
| >2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... | Back alignment and structure |
|---|
| >2i1p_A Low-density lipoprotein receptor-related protein 2; cysteine-rich repeat, ligand binding domain, calcium CAGE, ligand binding protein; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >2i1p_A Low-density lipoprotein receptor-related protein 2; cysteine-rich repeat, ligand binding domain, calcium CAGE, ligand binding protein; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >2kny_A LRP-1, linker, APO-E; lipoprotein receptor, ligand binding module, COMP repeat, calcium, cell membrane, coated PIT, cytoplasm, DEVE protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3dpr_E LDL-receptor class A 3; human rhinovirus, VLDL-receptor, virus-protein complex, icosahedral virus, ATP-binding, capsid protein; HET: DAO; 3.50A {Homo sapiens} PDB: 1v9u_5* | Back alignment and structure |
|---|
| >1d2l_A Lipoprotein receptor related protein; ligand binding, calcium binding, complement-like repeat, signaling protein; NMR {Homo sapiens} SCOP: g.12.1.1 | Back alignment and structure |
|---|
| >1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A | Back alignment and structure |
|---|
| >2knx_A Prolow-density lipoprotein receptor-related prote; LDLR, ligand binding module, ligand binding repeat, compleme repeat, protein binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jm4_A Relaxin receptor 1; LDL-A module, RXFP1 receptor, LGR7, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3a7q_B Low-density lipoprotein receptor-related protein; signaling protein; HET: NAG; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2m0p_A Low-density lipoprotein receptor-related protein; complement type repeat, megalin, LDL receptor FAMI lipid binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} | Back alignment and structure |
|---|
| >1k7b_A Subgroup A ROUS sarcoma virus receptor PG800 and PG950; beta hairpin, 3-10 helix, calcium binding, membrane protein; NMR {Coturnix coturnix} SCOP: g.12.1.1 | Back alignment and structure |
|---|
| >4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* | Back alignment and structure |
|---|
| >2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... | Back alignment and structure |
|---|
| >1j8e_A Low-density lipoprotein receptor-related protein 1; ligand binding, calcium binding, complement-like repeat, LRP receptor, signaling protein; 1.85A {Homo sapiens} SCOP: g.12.1.1 | Back alignment and structure |
|---|
| >3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1jrf_A TVA LDL-A module, subgroup A ROUS sarcoma virus receptors PG800 and PG950; disulfide bond, alpha helix, calcium CAGE, signaling protein; NMR {Coturnix japonica} SCOP: g.12.1.1 | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A | Back alignment and structure |
|---|
| >1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A | Back alignment and structure |
|---|
| >1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* | Back alignment and structure |
|---|
| >1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A | Back alignment and structure |
|---|
| >1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* | Back alignment and structure |
|---|
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* | Back alignment and structure |
|---|
| >2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* | Back alignment and structure |
|---|
| >2gtl_N Extracellular hemoglobin linker L2 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 | Back alignment and structure |
|---|
| >1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A | Back alignment and structure |
|---|
| >4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >2gtl_M Hemoglobin linker chain L1; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 | Back alignment and structure |
|---|
| >2gtl_N Extracellular hemoglobin linker L2 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A | Back alignment and structure |
|---|
| >2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A | Back alignment and structure |
|---|
| >2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* | Back alignment and structure |
|---|
| >2gtl_M Hemoglobin linker chain L1; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} | Back alignment and structure |
|---|
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A | Back alignment and structure |
|---|
| >4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A | Back alignment and structure |
|---|
| >1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 | Back alignment and structure |
|---|
| >2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A | Back alignment and structure |
|---|
| >3ojy_B Complement component C8 beta chain; macpf, lipocalin, immune system; HET: TPO BMA; 2.51A {Homo sapiens} | Back alignment and structure |
|---|
| >3ojy_B Complement component C8 beta chain; macpf, lipocalin, immune system; HET: TPO BMA; 2.51A {Homo sapiens} | Back alignment and structure |
|---|
| >1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... | Back alignment and structure |
|---|
| >3ojy_A Complement component C8 alpha chain; macpf, lipocalin, immune system; HET: TPO BMA; 2.51A {Homo sapiens} | Back alignment and structure |
|---|
| >1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* | Back alignment and structure |
|---|
| >2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* | Back alignment and structure |
|---|
| >1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >3ojy_A Complement component C8 alpha chain; macpf, lipocalin, immune system; HET: TPO BMA; 2.51A {Homo sapiens} | Back alignment and structure |
|---|
| >3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* | Back alignment and structure |
|---|
| >1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* | Back alignment and structure |
|---|
| >1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 | Back alignment and structure |
|---|
| >2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L | Back alignment and structure |
|---|
| >1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* | Back alignment and structure |
|---|
| >3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... | Back alignment and structure |
|---|
| >2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... | Back alignment and structure |
|---|
| >1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* | Back alignment and structure |
|---|
| >1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 | Back alignment and structure |
|---|
| >4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* | Back alignment and structure |
|---|
| >3t5o_A Complement component C6; macpf, MAC, membrane attack complex, innate IMMU system, blood, membrane, cytolysin, immune SYST; HET: NAG FUL FUC BGC MAN; 2.87A {Homo sapiens} PDB: 4a5w_B* 4e0s_B* | Back alignment and structure |
|---|
| >1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A | Back alignment and structure |
|---|
| >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* | Back alignment and structure |
|---|
| >2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A | Back alignment and structure |
|---|
| >1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A | Back alignment and structure |
|---|
| >1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 | Back alignment and structure |
|---|
| >3t5o_A Complement component C6; macpf, MAC, membrane attack complex, innate IMMU system, blood, membrane, cytolysin, immune SYST; HET: NAG FUL FUC BGC MAN; 2.87A {Homo sapiens} PDB: 4a5w_B* 4e0s_B* | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A | Back alignment and structure |
|---|
| >3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B | Back alignment and structure |
|---|
| >4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* | Back alignment and structure |
|---|
| >3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* | Back alignment and structure |
|---|
| >1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A | Back alignment and structure |
|---|
| >3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} | Back alignment and structure |
|---|
| >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* | Back alignment and structure |
|---|
| >1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A | Back alignment and structure |
|---|
| >3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} | Back alignment and structure |
|---|
| >2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* | Back alignment and structure |
|---|
| >2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A | Back alignment and structure |
|---|
| >3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A | Back alignment and structure |
|---|
| >1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A | Back alignment and structure |
|---|
| >3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A | Back alignment and structure |
|---|
| >1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A | Back alignment and structure |
|---|
| >2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* | Back alignment and structure |
|---|
| >1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* | Back alignment and structure |
|---|
| >1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A | Back alignment and structure |
|---|
| >1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 | Back alignment and structure |
|---|
| >2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A | Back alignment and structure |
|---|
| >2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A | Back alignment and structure |
|---|
| >1n1i_A Merozoite surface protein-1; MSP1, malaria, surface antigen, glycoprotein, EGF domain, cell adhesion; HET: HIS; 2.40A {Plasmodium knowlesi strain H} SCOP: g.3.11.4 g.3.11.4 | Back alignment and structure |
|---|
| >3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D | Back alignment and structure |
|---|
| >1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A | Back alignment and structure |
|---|
| >1ob1_C Major merozoite surface protein; immune system, immunoglobulin/complex, immunoglobulin, antib fragment, MSP1-19, EGF-like domain; 2.90A {Plasmodium falciparum} SCOP: g.3.11.4 g.3.11.4 PDB: 1cej_A 2flg_A | Back alignment and structure |
|---|
| >4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* | Back alignment and structure |
|---|
| >1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 482 | ||||
| d1i0ua2 | 41 | g.3.11.1 (A:42-82) Low density lipoprotein (LDL) r | 7e-10 | |
| d1apqa_ | 53 | g.3.11.1 (A:) Complement protease C1R {Human (Homo | 6e-08 | |
| d1d2la_ | 45 | g.12.1.1 (A:) Ligand-binding domain of low-density | 8e-08 | |
| d1d2la_ | 45 | g.12.1.1 (A:) Ligand-binding domain of low-density | 8e-04 | |
| d1d2la_ | 45 | g.12.1.1 (A:) Ligand-binding domain of low-density | 8e-04 | |
| d1nt0a3 | 45 | g.3.11.1 (A:120-164) Mannose-binding protein assoc | 1e-07 | |
| d1f8za_ | 39 | g.12.1.1 (A:) Ligand-binding domain of low-density | 2e-07 | |
| d1f8za_ | 39 | g.12.1.1 (A:) Ligand-binding domain of low-density | 0.001 | |
| d1f8za_ | 39 | g.12.1.1 (A:) Ligand-binding domain of low-density | 0.001 | |
| d1j8ea_ | 44 | g.12.1.1 (A:) Ligand-binding domain of low-density | 2e-07 | |
| d1j8ea_ | 44 | g.12.1.1 (A:) Ligand-binding domain of low-density | 0.002 | |
| d1j8ea_ | 44 | g.12.1.1 (A:) Ligand-binding domain of low-density | 0.002 | |
| d2fcwb1 | 39 | g.12.1.1 (B:86-124) Ligand-binding domain of low-d | 2e-07 | |
| d2fcwb1 | 39 | g.12.1.1 (B:86-124) Ligand-binding domain of low-d | 9e-04 | |
| d2fcwb1 | 39 | g.12.1.1 (B:86-124) Ligand-binding domain of low-d | 9e-04 | |
| d1nzia2 | 42 | g.3.11.1 (A:118-159) Complement C1S component {Hum | 2e-07 | |
| d2p3ua1 | 51 | g.3.11.1 (A:87-137) Factor X, N-terminal module {H | 4e-07 | |
| d1f5ya1 | 44 | g.12.1.1 (A:1-44) Ligand-binding domain of low-den | 4e-07 | |
| d1f5ya1 | 44 | g.12.1.1 (A:1-44) Ligand-binding domain of low-den | 0.003 | |
| d1f5ya1 | 44 | g.12.1.1 (A:1-44) Ligand-binding domain of low-den | 0.003 | |
| d2fcwb2 | 39 | g.12.1.1 (B:125-163) Ligand-binding domain of low- | 5e-07 | |
| d2fcwb2 | 39 | g.12.1.1 (B:125-163) Ligand-binding domain of low- | 8e-04 | |
| d2fcwb2 | 39 | g.12.1.1 (B:125-163) Ligand-binding domain of low- | 8e-04 | |
| d1ajja_ | 37 | g.12.1.1 (A:) Ligand-binding domain of low-density | 5e-07 | |
| d1ajja_ | 37 | g.12.1.1 (A:) Ligand-binding domain of low-density | 0.002 | |
| d1ajja_ | 37 | g.12.1.1 (A:) Ligand-binding domain of low-density | 0.002 | |
| d1szba2 | 45 | g.3.11.1 (A:124-168) Mannose-binding protein assoc | 6e-07 | |
| d1kigl_ | 51 | g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bo | 7e-07 | |
| d1autl2 | 50 | g.3.11.1 (L:97-146) Activated protein c (autoproth | 2e-06 | |
| d1xfea2 | 44 | g.12.1.1 (A:1-44) Ligand-binding domain of low-den | 2e-06 | |
| d1uzka2 | 43 | g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sa | 2e-06 | |
| d1npea_ | 263 | b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId | 3e-06 | |
| d1f5ya2 | 41 | g.12.1.1 (A:45-85) Ligand-binding domain of low-de | 4e-06 | |
| d1f5ya2 | 41 | g.12.1.1 (A:45-85) Ligand-binding domain of low-de | 0.001 | |
| d1f5ya2 | 41 | g.12.1.1 (A:45-85) Ligand-binding domain of low-de | 0.001 | |
| d1uzka1 | 43 | g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sa | 4e-06 | |
| d1lmja2 | 42 | g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapien | 8e-06 | |
| d1dx5i3 | 40 | g.3.11.1 (I:423-462) Thrombomodulin, different EGF | 1e-05 | |
| d2gtlo2 | 41 | g.12.1.1 (O:60-100) Extracellular hemoglobin linke | 1e-05 | |
| d2gtlo2 | 41 | g.12.1.1 (O:60-100) Extracellular hemoglobin linke | 0.001 | |
| d2gtlo2 | 41 | g.12.1.1 (O:60-100) Extracellular hemoglobin linke | 0.001 | |
| d1cr8a_ | 42 | g.12.1.1 (A:) Ligand-binding domain of low-density | 1e-05 | |
| d1cr8a_ | 42 | g.12.1.1 (A:) Ligand-binding domain of low-density | 3e-05 | |
| d1cr8a_ | 42 | g.12.1.1 (A:) Ligand-binding domain of low-density | 3e-05 | |
| d1v9u5_ | 39 | g.12.1.1 (5:) Very low-density lipoprotein recepto | 1e-05 | |
| d1v9u5_ | 39 | g.12.1.1 (5:) Very low-density lipoprotein recepto | 0.003 | |
| d1v9u5_ | 39 | g.12.1.1 (5:) Very low-density lipoprotein recepto | 0.003 | |
| d3bpse1 | 40 | g.3.11.1 (E:293-332) Low density lipoprotein (LDL) | 2e-05 | |
| d2bz6l1 | 53 | g.3.11.1 (L:90-142) Coagulation factor VIIa {Human | 2e-05 | |
| d1ijqa1 | 266 | b.68.5.1 (A:377-642) Low density lipoprotein (LDL) | 3e-05 | |
| d1k7ba_ | 42 | g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quai | 3e-05 | |
| d1rfnb_ | 57 | g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens | 4e-05 | |
| d1emoa1 | 43 | g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sa | 4e-05 | |
| d2gtlm2 | 42 | g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Co | 5e-05 | |
| d2gtlm2 | 42 | g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Co | 0.002 | |
| d2gtlm2 | 42 | g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Co | 0.002 | |
| d2gtln2 | 41 | g.12.1.1 (N:61-101) Extracellular hemoglobin linke | 8e-05 | |
| d2gtln2 | 41 | g.12.1.1 (N:61-101) Extracellular hemoglobin linke | 0.003 | |
| d2gtln2 | 41 | g.12.1.1 (N:61-101) Extracellular hemoglobin linke | 0.003 | |
| d1ijqa2 | 50 | g.3.11.1 (A:643-692) Low density lipoprotein (LDL) | 8e-04 | |
| d1lmja1 | 44 | g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens | 0.003 |
| >d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Length = 41 | Back information, alignment and structure |
|---|
class: Small proteins fold: Knottins (small inhibitors, toxins, lectins) superfamily: EGF/Laminin family: EGF-type module domain: Low density lipoprotein (LDL) receptor, different EGF domains species: Human (Homo sapiens) [TaxId: 9606]
Score = 52.1 bits (125), Expect = 7e-10
Identities = 18/40 (45%), Positives = 21/40 (52%)
Query: 417 DECLIDGSCDQTCTNTHLSYVCSCTEGYTLRPDGKSCTAV 456
DEC +C Q C N Y C C EG+ L P K+C AV
Sbjct: 2 DECQDPDTCSQLCVNLEGGYKCQCEEGFQLDPHTKACKAV 41
|
| >d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Length = 53 | Back information, alignment and structure |
|---|
| >d1d2la_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 45 | Back information, alignment and structure |
|---|
| >d1d2la_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 45 | Back information, alignment and structure |
|---|
| >d1d2la_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 45 | Back information, alignment and structure |
|---|
| >d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 45 | Back information, alignment and structure |
|---|
| >d1f8za_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d1f8za_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d1f8za_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 | Back information, alignment and structure |
|---|
| >d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 | Back information, alignment and structure |
|---|
| >d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 | Back information, alignment and structure |
|---|
| >d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Length = 42 | Back information, alignment and structure |
|---|
| >d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 51 | Back information, alignment and structure |
|---|
| >d1f5ya1 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 | Back information, alignment and structure |
|---|
| >d1f5ya1 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 | Back information, alignment and structure |
|---|
| >d1f5ya1 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 | Back information, alignment and structure |
|---|
| >d2fcwb2 g.12.1.1 (B:125-163) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d2fcwb2 g.12.1.1 (B:125-163) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d2fcwb2 g.12.1.1 (B:125-163) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d1ajja_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 37 | Back information, alignment and structure |
|---|
| >d1ajja_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 37 | Back information, alignment and structure |
|---|
| >d1ajja_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 37 | Back information, alignment and structure |
|---|
| >d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 45 | Back information, alignment and structure |
|---|
| >d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Length = 51 | Back information, alignment and structure |
|---|
| >d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 50 | Back information, alignment and structure |
|---|
| >d1xfea2 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 | Back information, alignment and structure |
|---|
| >d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 | Back information, alignment and structure |
|---|
| >d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Length = 263 | Back information, alignment and structure |
|---|
| >d1f5ya2 g.12.1.1 (A:45-85) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 41 | Back information, alignment and structure |
|---|
| >d1f5ya2 g.12.1.1 (A:45-85) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 41 | Back information, alignment and structure |
|---|
| >d1f5ya2 g.12.1.1 (A:45-85) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 41 | Back information, alignment and structure |
|---|
| >d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 | Back information, alignment and structure |
|---|
| >d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 | Back information, alignment and structure |
|---|
| >d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Length = 40 | Back information, alignment and structure |
|---|
| >d2gtlo2 g.12.1.1 (O:60-100) Extracellular hemoglobin linker l3 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 | Back information, alignment and structure |
|---|
| >d2gtlo2 g.12.1.1 (O:60-100) Extracellular hemoglobin linker l3 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 | Back information, alignment and structure |
|---|
| >d2gtlo2 g.12.1.1 (O:60-100) Extracellular hemoglobin linker l3 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 | Back information, alignment and structure |
|---|
| >d1cr8a_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 42 | Back information, alignment and structure |
|---|
| >d1cr8a_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 42 | Back information, alignment and structure |
|---|
| >d1cr8a_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 42 | Back information, alignment and structure |
|---|
| >d1v9u5_ g.12.1.1 (5:) Very low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d1v9u5_ g.12.1.1 (5:) Very low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d1v9u5_ g.12.1.1 (5:) Very low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Length = 40 | Back information, alignment and structure |
|---|
| >d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Length = 53 | Back information, alignment and structure |
|---|
| >d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 266 | Back information, alignment and structure |
|---|
| >d1k7ba_ g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quail (Coturnix coturnix) [TaxId: 9091]} Length = 42 | Back information, alignment and structure |
|---|
| >d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 57 | Back information, alignment and structure |
|---|
| >d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 | Back information, alignment and structure |
|---|
| >d2gtlm2 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 42 | Back information, alignment and structure |
|---|
| >d2gtlm2 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 42 | Back information, alignment and structure |
|---|
| >d2gtlm2 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 42 | Back information, alignment and structure |
|---|
| >d2gtln2 g.12.1.1 (N:61-101) Extracellular hemoglobin linker l2 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 | Back information, alignment and structure |
|---|
| >d2gtln2 g.12.1.1 (N:61-101) Extracellular hemoglobin linker l2 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 | Back information, alignment and structure |
|---|
| >d2gtln2 g.12.1.1 (N:61-101) Extracellular hemoglobin linker l2 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 | Back information, alignment and structure |
|---|
| >d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Length = 50 | Back information, alignment and structure |
|---|
| >d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 44 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 482 | |||
| d1f5ya2 | 41 | Ligand-binding domain of low-density lipoprotein r | 99.15 | |
| d1ajja_ | 37 | Ligand-binding domain of low-density lipoprotein r | 99.09 | |
| d2fcwb1 | 39 | Ligand-binding domain of low-density lipoprotein r | 99.08 | |
| d1f8za_ | 39 | Ligand-binding domain of low-density lipoprotein r | 99.06 | |
| d1cr8a_ | 42 | Ligand-binding domain of low-density lipoprotein r | 99.06 | |
| d1f5ya1 | 44 | Ligand-binding domain of low-density lipoprotein r | 99.03 | |
| d2fcwb1 | 39 | Ligand-binding domain of low-density lipoprotein r | 99.03 | |
| d2fcwb2 | 39 | Ligand-binding domain of low-density lipoprotein r | 99.02 | |
| d2gtlo2 | 41 | Extracellular hemoglobin linker l3 subunit {Common | 99.02 | |
| d1j8ea_ | 44 | Ligand-binding domain of low-density lipoprotein r | 99.01 | |
| d1cr8a_ | 42 | Ligand-binding domain of low-density lipoprotein r | 99.0 | |
| d1i0ua2 | 41 | Low density lipoprotein (LDL) receptor, different | 98.99 | |
| d1f5ya2 | 41 | Ligand-binding domain of low-density lipoprotein r | 98.98 | |
| d2gtlm2 | 42 | Hemoglobin linker chain l1 {Common earthworm (Lumb | 98.96 | |
| d1d2la_ | 45 | Ligand-binding domain of low-density lipoprotein r | 98.95 | |
| d1v9u5_ | 39 | Very low-density lipoprotein receptor {Human (Homo | 98.95 | |
| d1f5ya1 | 44 | Ligand-binding domain of low-density lipoprotein r | 98.93 | |
| d1ajja_ | 37 | Ligand-binding domain of low-density lipoprotein r | 98.93 | |
| d2gtln2 | 41 | Extracellular hemoglobin linker l2 subunit {Common | 98.93 | |
| d1f8za_ | 39 | Ligand-binding domain of low-density lipoprotein r | 98.93 | |
| d1v9u5_ | 39 | Very low-density lipoprotein receptor {Human (Homo | 98.91 | |
| d1k7ba_ | 42 | soluble Tva ectodomain, sTva47 {Quail (Coturnix co | 98.88 | |
| d1xfea2 | 44 | Ligand-binding domain of low-density lipoprotein r | 98.86 | |
| d2gtlo2 | 41 | Extracellular hemoglobin linker l3 subunit {Common | 98.83 | |
| d1k7ba_ | 42 | soluble Tva ectodomain, sTva47 {Quail (Coturnix co | 98.82 | |
| d1d2la_ | 45 | Ligand-binding domain of low-density lipoprotein r | 98.82 | |
| d2fcwb2 | 39 | Ligand-binding domain of low-density lipoprotein r | 98.76 | |
| d1nt0a3 | 45 | Mannose-binding protein associated serine protease | 98.75 | |
| d1uzka1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 98.73 | |
| d1j8ea_ | 44 | Ligand-binding domain of low-density lipoprotein r | 98.73 | |
| d1szba2 | 45 | Mannose-binding protein associated serine protease | 98.7 | |
| d2gtlm2 | 42 | Hemoglobin linker chain l1 {Common earthworm (Lumb | 98.69 | |
| d1nzia2 | 42 | Complement C1S component {Human (Homo sapiens) [Ta | 98.66 | |
| d2gtln2 | 41 | Extracellular hemoglobin linker l2 subunit {Common | 98.66 | |
| d1xfea2 | 44 | Ligand-binding domain of low-density lipoprotein r | 98.64 | |
| d1apqa_ | 53 | Complement protease C1R {Human (Homo sapiens) [Tax | 98.58 | |
| d1uzka2 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 98.57 | |
| d3bpse1 | 40 | Low density lipoprotein (LDL) receptor, different | 98.55 | |
| d1lmja2 | 42 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 98.55 | |
| d1emoa1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 98.52 | |
| d1dx5i3 | 40 | Thrombomodulin, different EGF-like domains {Human | 98.49 | |
| d1kigl_ | 51 | Factor X, N-terminal module {Cow (Bos taurus) [Tax | 98.4 | |
| d1autl2 | 50 | Activated protein c (autoprothrombin IIa) {Human ( | 98.39 | |
| d1lmja1 | 44 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 98.34 | |
| d2p3ua1 | 51 | Factor X, N-terminal module {Human (Homo sapiens) | 98.33 | |
| d1rfnb_ | 57 | Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 | 98.1 | |
| d1i0ua2 | 41 | Low density lipoprotein (LDL) receptor, different | 98.0 | |
| d1ijqa2 | 50 | Low density lipoprotein (LDL) receptor, different | 97.99 | |
| d2bz6l1 | 53 | Coagulation factor VIIa {Human (Homo sapiens) [Tax | 97.82 | |
| d2vj3a1 | 42 | Neurogenic locus notch homolog protein 1, Notch1 { | 97.59 | |
| d1nt0a3 | 45 | Mannose-binding protein associated serine protease | 97.45 | |
| d1nzia2 | 42 | Complement C1S component {Human (Homo sapiens) [Ta | 97.43 | |
| d3bpse1 | 40 | Low density lipoprotein (LDL) receptor, different | 97.42 | |
| d1szba2 | 45 | Mannose-binding protein associated serine protease | 97.4 | |
| d1emoa1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 97.37 | |
| d1uzka1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 97.3 | |
| d1kigl_ | 51 | Factor X, N-terminal module {Cow (Bos taurus) [Tax | 97.13 | |
| d1dx5i3 | 40 | Thrombomodulin, different EGF-like domains {Human | 97.12 | |
| d1autl2 | 50 | Activated protein c (autoprothrombin IIa) {Human ( | 96.93 | |
| d1lmja2 | 42 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 96.84 | |
| d1uzka2 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 96.8 | |
| d2p3ua1 | 51 | Factor X, N-terminal module {Human (Homo sapiens) | 96.76 | |
| d1lmja1 | 44 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 96.61 | |
| d2c4fl1 | 37 | Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | 96.59 | |
| d2vj3a2 | 39 | Neurogenic locus notch homolog protein 1, Notch1 { | 96.47 | |
| d1edmb_ | 39 | Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 | 96.46 | |
| d1apqa_ | 53 | Complement protease C1R {Human (Homo sapiens) [Tax | 96.44 | |
| d2vj3a2 | 39 | Neurogenic locus notch homolog protein 1, Notch1 { | 96.12 | |
| d1xkba1 | 39 | Factor X, N-terminal module {Human (Homo sapiens) | 96.12 | |
| d2vj3a1 | 42 | Neurogenic locus notch homolog protein 1, Notch1 { | 96.09 | |
| d1ijqa2 | 50 | Low density lipoprotein (LDL) receptor, different | 96.02 | |
| d1rfnb_ | 57 | Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 | 95.99 | |
| d1gl4a2 | 40 | EGF-like domain of nidogen-1 {Mouse (Mus musculus) | 95.84 | |
| d1edmb_ | 39 | Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 | 95.79 | |
| d2vj3a3 | 35 | Neurogenic locus notch homolog protein 1, Notch1 { | 95.75 | |
| d2vj3a3 | 35 | Neurogenic locus notch homolog protein 1, Notch1 { | 95.41 | |
| d2c4fl1 | 37 | Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | 95.34 | |
| d1autl1 | 48 | Activated protein c (autoprothrombin IIa) {Human ( | 95.14 | |
| d1emoa2 | 39 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 95.01 | |
| d1g1sa2 | 40 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 94.96 | |
| d1xkba1 | 39 | Factor X, N-terminal module {Human (Homo sapiens) | 94.74 | |
| d2bz6l1 | 53 | Coagulation factor VIIa {Human (Homo sapiens) [Tax | 94.62 | |
| d1g1sa2 | 40 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 93.96 | |
| d1g1ta2 | 39 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 93.83 | |
| d1autl1 | 48 | Activated protein c (autoprothrombin IIa) {Human ( | 93.69 | |
| d1gl4a2 | 40 | EGF-like domain of nidogen-1 {Mouse (Mus musculus) | 93.45 | |
| d1g1ta2 | 39 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 93.4 | |
| d1emoa2 | 39 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 91.23 | |
| d1tpga1 | 41 | Plasminogen activator (tissue-type), t-PA {Human ( | 90.65 | |
| d1q4ga2 | 42 | Prostaglandin H2 synthase-1, EGF-like module {Shee | 89.66 | |
| d1q4ga2 | 42 | Prostaglandin H2 synthase-1, EGF-like module {Shee | 88.64 | |
| d1cvua2 | 41 | Prostaglandin H2 synthase-1, EGF-like module {Mous | 87.48 | |
| d1dx5i1 | 43 | Thrombomodulin, different EGF-like domains {Human | 87.44 | |
| d1tpga1 | 41 | Plasminogen activator (tissue-type), t-PA {Human ( | 86.81 | |
| d1cvua2 | 41 | Prostaglandin H2 synthase-1, EGF-like module {Mous | 84.17 | |
| d1haea_ | 63 | Heregulin-alpha, EGF-like domain {Human (Homo sapi | 80.62 |
| >d1f5ya2 g.12.1.1 (A:45-85) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: LDL receptor-like module superfamily: LDL receptor-like module family: LDL receptor-like module domain: Ligand-binding domain of low-density lipoprotein receptor species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.15 E-value=1.1e-11 Score=83.37 Aligned_cols=40 Identities=33% Similarity=0.839 Sum_probs=35.6
Q ss_pred CCcccCCCCeeeCC-CCCeecCccccCCCCCCCCCCCCCCCCcccc
Q psy14262 1 MIHQCFNGQVQCAL-SKKCIPHNWLCDEEMDCSTDDIVDNTDEDWD 45 (482)
Q Consensus 1 ~~~~C~~~~f~C~~-~~~Ci~~~~~CDg~~dC~~~~~~d~sDE~~~ 45 (482)
+..+|.++||+|.. +++|||..|+|||+.||+ |+|||.+|
T Consensus 1 ls~~C~~~~f~C~~~~~~CI~~~~~CDg~~DC~-----DgsDE~~C 41 (41)
T d1f5ya2 1 LSVTCKSGDFSCGGRVNRCIPQFWRCDGQVDCD-----NGSDEQGC 41 (41)
T ss_dssp TTTTCCSSCEECCSSCCCEECGGGTTCSCCCSS-----SCTTTTTC
T ss_pred CccccCCCceECCCCCCCCccchhcCCCcCcCc-----CcccccCC
Confidence 46789999999963 689999999999999998 99999864
|
| >d1ajja_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f8za_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cr8a_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f5ya1 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fcwb2 g.12.1.1 (B:125-163) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gtlo2 g.12.1.1 (O:60-100) Extracellular hemoglobin linker l3 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} | Back information, alignment and structure |
|---|
| >d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cr8a_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f5ya2 g.12.1.1 (A:45-85) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gtlm2 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} | Back information, alignment and structure |
|---|
| >d1d2la_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v9u5_ g.12.1.1 (5:) Very low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f5ya1 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ajja_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gtln2 g.12.1.1 (N:61-101) Extracellular hemoglobin linker l2 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} | Back information, alignment and structure |
|---|
| >d1f8za_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v9u5_ g.12.1.1 (5:) Very low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k7ba_ g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quail (Coturnix coturnix) [TaxId: 9091]} | Back information, alignment and structure |
|---|
| >d1xfea2 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gtlo2 g.12.1.1 (O:60-100) Extracellular hemoglobin linker l3 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} | Back information, alignment and structure |
|---|
| >d1k7ba_ g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quail (Coturnix coturnix) [TaxId: 9091]} | Back information, alignment and structure |
|---|
| >d1d2la_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fcwb2 g.12.1.1 (B:125-163) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gtlm2 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} | Back information, alignment and structure |
|---|
| >d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gtln2 g.12.1.1 (N:61-101) Extracellular hemoglobin linker l2 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} | Back information, alignment and structure |
|---|
| >d1xfea2 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1dx5i1 g.3.11.1 (I:345-387) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|