Psyllid ID: psy14262


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480--
MIHQCFNGQVQCALSKKCIPHNWLCDEEMDCSTDDIVDNTDEDWDKYFKRILNGTHTLALEFNHRNQSLCFIQQQNVSSVRLRCAQINDLLNSWDLPAPEIFPLDERLEKAGMHGENRSPLVTKNIQWPSSLVIDYNQDILYWCDSHLNTVESVRVDGSHNAVLCHPNELRCGSSNQCVALSKFCDGKPDCSNGEDEGPFCNAECTPGQFSCGMGKCIPESWKCDGFVDCLEDGSDEPNTCIHQCFNGQVQCALSKKCIPHNWLCDEEMDCSTDDIVDNTDEDWDKFHQCFNGQVQCALSKKCIPHNWLCDEEMDCSTDDIVDNTDEDWDKYFSHNAVLCHPNELRCGSSNQCVALSKFCDGKPDCSNGEDEGPFCNNKADCENLKCSHKCSPTPRGAMCFCPAGQNPNKTQCVDADECLIDGSCDQTCTNTHLSYVCSCTEGYTLRPDGKSCTAVNVPQDEPASIIFSSTVDIRRIHLNGS
cccccccccEEccccccccccccccccccccccccccccccccccccccEEccccccccccEEEccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccccccEEEccccccccccccccccccccccccccEEEcccccEEccccccccccccccccccccccccccccccEEcccccEEcccccccccccccccccccccccccccccccEEcccccccccccEEEcccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccEEEEcccccEEccccccccccccccccccEEEEEccccEEEEEcccc
cccccccccEEEcccccEcccEEEEcccccccccccccccccccEEEEEEEccccccEEEEEEccccccccccccEEEEEccccccEEEEEccccccccEEEEEccccccccccccccEEEccccccccccEEEEccccEEEEEcccccccccccccccccccEccccccEcccccEEEcccEEccccccccccccccccccccccccccEcccccccccccccccccccccccccccccccccccccccEcccccEEccccEEcccccccccccccccccccccccccccccccEcccccEEccccEEEcccccccccccccccccccccccccccccccccccEcccccEEccccEEccccccccccccccccccccccccccccccccEccccccEEcccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccccccccccEEEEEccccEEEEccccc
mihqcfngqvqcalskkciphnwlcdeemdcstddivdntdeDWDKYFKRILNGTHTLALEFnhrnqslcfiqqqnvssVRLRCAQINDLlnswdlpapeifplderlekagmhgenrsplvtkniqwpsslvidynQDILYWCDSHLNTVESVrvdgshnavlchpnelrcgssnqcvalskfcdgkpdcsngedegpfcnaectpgqfscgmgkcipeswkcdgfvdcledgsdepntcihqcfngqvqcalskkciphnwlcdeemdcstddivdntdedwdkfhqcfngqvqcalskkciphnwlcdeemdcstddivdntdedwdkyfshnavlchpnelrcgssnqcvalskfcdgkpdcsngedegpfcnnkadcenlkcshkcsptprgamcfcpagqnpnktqcvdadeclidgscdqtctnthlsyvcsctegytlrpdgksctavnvpqdepasiifssTVDIRRIHLNGS
MIHQCFNGQVQCALSKKCIPHNWLCDEEMDCSTDDIVDNTDEDWDKYFKRILNGTHTLALEFNHRNQSLCFIQQQNVSSVRLRCAQINDLlnswdlpapEIFPLDERLEKAGMhgenrsplvtkniqwpSSLVIDYNQDILYWCDSHLNTVESVRVDGSHNAVLCHPNELRCGSSNQCVALSKFCDGKPDCSNGEDEGPFCNAECTPGQFSCGMGKCIPESWKCDGFVDCLEDGSDEPNTCIHQCFNGQVQCALSKKCIPHNWLCDEEMDCSTDDIVDNTDEDWDKFHQCFNGQVQCALSKKCIPHNWLCDEEMDCSTDDIVDNTDEDWDKYFSHNAVLCHPNELRCGSSNQCVALSKFCDGKPDCSNGEDEGPFCNNKADCENLKCSHKCSPTPRGAMCFCPAGQNPNKTQCVDADECLIDGSCDQTCTNTHLSYVCSCTEGYTLRPDGKSCTAvnvpqdepasiifsstvdiRRIHLNGS
MIHQCFNGQVQCALSKKCIPHNWLCDEEMDCSTDDIVDNTDEDWDKYFKRILNGTHTLALEFNHRNQSLCFIQQQNVSSVRLRCAQINDLLNSWDLPAPEIFPLDERLEKAGMHGENRSPLVTKNIQWPSSLVIDYNQDILYWCDSHLNTVESVRVDGSHNAVLCHPNELRCGSSNQCVALSKFCDGKPDCSNGEDEGPFCNAECTPGQFSCGMGKCIPESWKCDGFVDCLEDGSDEPNTCIHQCFNGQVQCALSKKCIPHNWLCDEEMDCSTDDIVDNTDEDWDKFHQCFNGQVQCALSKKCIPHNWLCDEEMDCSTDDIVDNTDEDWDKYFSHNAVLCHPNELRCGSSNQCVALSKFCDGKPDCSNGEDEGPFCNNKADCENLKCSHKCSPTPRGAMCFCPAGQNPNKTQCVDADECLIDGSCDQTCTNTHLSYVCSCTEGYTLRPDGKSCTAVNVPQDEPASIIFSSTVDIRRIHLNGS
***QCFNGQVQCALSKKCIPHNWLCDEEMDCSTDDIVDNTDEDWDKYFKRILNGTHTLALEFNHRNQSLCFIQQQNVSSVRLRCAQINDLLNSWDLPAPEIFPLDERL***********PLVTKNIQWPSSLVIDYNQDILYWCDSHLNTVESVRVDGSHNAVLCHPNELRCGSSNQCVALSKFCDGKPDC*****EGPFCNAECTPGQFSCGMGKCIPESWKCDGFVDCLEDGSDEPNTCIHQCFNGQVQCALSKKCIPHNWLCDEEMDCSTDDIVDNTDEDWDKFHQCFNGQVQCALSKKCIPHNWLCDEEMDCSTDDIVDNTDEDWDKYFSHNAVLCHPNELRCGSSNQCVALSKFCDGK***********FCNNKADCENLKCSHKCSPTPRGAMCFCPAGQNPNKTQCVDADECLIDGSCDQTCTNTHLSYVCSCTEGYTLRPDGKSCTAVNVPQDEPASIIFSSTVDIRRI*****
MIHQCFNGQVQCALSKKCIPHNWLCDEEMDCSTDDIVDNTDEDWDKYFKRILNGTHTLALEFNHRNQSLCFIQQQNVSSVRLRCAQINDLLNSWDLPAPEIFPLDERLEKAGMHGENRSPLVTKNIQWPSSLVIDYNQDILYWCDSHLNTVESVRVDGSHNAVLCHPNELRCGSSNQCVALSKFCDGKPDCSNGEDEGPFCNAECTPGQFSCGMGKCIPESWKCDGFVDCLEDGSDEPNTCIHQCFNGQVQCALSKKCIPHNWLCDEEMDCSTDDIVDNTDEDWDKFHQCFNGQVQCALSKKCIPHNWLCDEEMDCSTDDIVDNTDEDWDKYFSHNAVLCHPNELRCGSSNQCVALSKFCDGKPDCSNGEDEGPFCNNKADCENLKCSHKCSPTPRGAMCFCPAGQNPNKTQCVDADECLIDGSCDQTCTNTHLSYVCSCTEGYTLRPDGKSCTAVNVPQDEPASIIFSSTVDIRRIHL***
MIHQCFNGQVQCALSKKCIPHNWLCDEEMDCSTDDIVDNTDEDWDKYFKRILNGTHTLALEFNHRNQSLCFIQQQNVSSVRLRCAQINDLLNSWDLPAPEIFPLDERLEKAGMHGENRSPLVTKNIQWPSSLVIDYNQDILYWCDSHLNTVESVRVDGSHNAVLCHPNELRCGSSNQCVALSKFCDGKPDCSNGEDEGPFCNAECTPGQFSCGMGKCIPESWKCDGFVDCLEDGSDEPNTCIHQCFNGQVQCALSKKCIPHNWLCDEEMDCSTDDIVDNTDEDWDKFHQCFNGQVQCALSKKCIPHNWLCDEEMDCSTDDIVDNTDEDWDKYFSHNAVLCHPNELRCGSSNQCVALSKFCDGKPDCSNGEDEGPFCNNKADCENLKCSHKCSPTPRGAMCFCPAGQNPNKTQCVDADECLIDGSCDQTCTNTHLSYVCSCTEGYTLRPDGKSCTAVNVPQDEPASIIFSSTVDIRRIHLNGS
*IHQCFNGQVQCALSKKCIPHNWLCDEEMDCSTDDIVDNTDEDWDKYFKRILNGTHTLALEFNHRNQSLCFIQQQNVSSVRLRCAQINDLLNSWDLPAPEIFPLDERLEKAGMHGENRSPLVTKNIQWPSSLVIDYNQDILYWCDSHLNTVESVRVDGSHNAVLCHPNELRCGSSNQCVALSKFCDGKPDCSNGEDEGPFCNAECTPGQFSCGMGKCIPESWKCDGFVDCLEDGSDEPNTCIHQCFNGQVQCALSKKCIPHNWLCDEEMDCSTDDIVDNTDEDWDKFHQCFNGQVQCALSKKCIPHNWLCDEEMDCSTDDIVDNTDEDWDKYFSHNAVLCHPNELRCGSSNQCVALSKFCDGKPDCSNGEDEGPFCNNKADCENLKCSHKCSPTPRGAMCFCPAGQNPNKTQCVDADECLIDGSCDQTCTNTHLSYVCSCTEGYTLRPDGKSCTAVNVPQDEPASIIFSSTVDIRRIHL***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIHQCFNGQVQCALSKKCIPHNWLCDEEMDCSTDDIVDNTDEDWDKYFKRILNGTHTLALEFNHRNQSLCFIQQQNVSSVRLRCAQINDLLNSWDLPAPEIFPLDERLEKAGMHGENRSPLVTKNIQWPSSLVIDYNQDILYWCDSHLNTVESVRVDGSHNAVLCHPNELRCGSSNQCVALSKFCDGKPDCSNGEDEGPFCNAECTPGQFSCGMGKCIPESWKCDGFVDCLEDGSDEPNTCIHQCFNGQVQCALSKKCIPHNWLCDEEMDCSTDDIVDNTDEDWDKFHQCFNGQVQCALSKKCIPHNWLCDEEMDCSTDDIVDNTDEDWDKYFSHNAVLCHPNELRCGSSNQCVALSKFCDGKPDCSNGEDEGPFCNNKADCENLKCSHKCSPTPRGAMCFCPAGQNPNKTQCVDADECLIDGSCDQTCTNTHLSYVCSCTEGYTLRPDGKSCTAVNVPQDEPASIIFSSTVDIRRIHLNGS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query482 2.2.26 [Sep-21-2011]
A2ARV4 4660 Low-density lipoprotein r yes N/A 0.616 0.063 0.370 8e-35
P98164 4655 Low-density lipoprotein r yes N/A 0.614 0.063 0.363 2e-34
Q04833 4753 Low-density lipoprotein r yes N/A 0.595 0.060 0.361 4e-34
Q91ZX7 4545 Prolow-density lipoprotei no N/A 0.595 0.063 0.345 9e-34
P98165 863 Very low-density lipoprot no N/A 0.632 0.353 0.340 2e-33
P98158 4660 Low-density lipoprotein r no N/A 0.609 0.063 0.352 3e-33
Q07954 4544 Prolow-density lipoprotei no N/A 0.595 0.063 0.339 5e-33
P98163 1984 Putative vitellogenin rec no N/A 0.632 0.153 0.307 1e-32
P98157 4543 Low-density lipoprotein r no N/A 0.593 0.062 0.338 5e-32
P35953 873 Very low-density lipoprot no N/A 0.605 0.334 0.326 7e-32
>sp|A2ARV4|LRP2_MOUSE Low-density lipoprotein receptor-related protein 2 OS=Mus musculus GN=Lrp2 PE=1 SV=1 Back     alignment and function desciption
 Score =  148 bits (374), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 122/329 (37%), Positives = 162/329 (49%), Gaps = 32/329 (9%)

Query: 162 AVLCHPNELRCGSSNQCVALSKFCDGKPDCSNGEDEGPFCNAECTPGQFSCGMGKCIPES 221
              C   +L C S+ QCV +   CD   DC +G DE       C   Q +C  G C   S
Sbjct: 105 GTTCSSQQLTC-SNGQCVPIEYRCDHVSDCPDGSDERNCYYPTCD--QLTCANGACYNTS 161

Query: 222 WKCDGFVDCLEDGSDEPNTCIHQCFNGQVQCALSKKCIPHNWLCDEEMDCSTDDIVDNTD 281
            KCD  VDC  D SDE N C   C   + QC  S +CI   ++CD + DC      DN+D
Sbjct: 162 QKCDHKVDC-RDSSDEAN-CTTLCSQKEFQCG-SGECILRAYVCDHDNDCE-----DNSD 213

Query: 282 EDWDKFHQCFNGQVQCALSKKCIPHNWLCDEEMDCSTDDIVDNTDEDW-DKYFSHNAVLC 340
           E    +  C   Q  C+ + +CI  NW+CD + DC      D+ DED  +    H+   C
Sbjct: 214 EHNCNYDTCGGHQFTCS-NGQCINQNWVCDGDDDCQ-----DSGDEDGCESNQRHHT--C 265

Query: 341 HPNELRCGSSNQCVALSKFCDGKPDCSNGEDE-----GPFCNNKADCENLKCSHKCSPTP 395
           +P E  C  S +C+++ K CDG PDC  GEDE     G +C     C  L C ++C  TP
Sbjct: 266 YPREWACPGSGRCISMDKVCDGVPDCPEGEDENNATSGRYCGTGL-CSILNCEYQCHQTP 324

Query: 396 RGAMCFCPAGQ--NPNKTQ-CVDADECLIDGSCDQTCTNTHLSYVCSCTEGYTLRPDGKS 452
            G  CFCP G   N N ++ C+D D+C I G CDQ C +    + C C EGY L   G+ 
Sbjct: 325 YGGECFCPPGHIINSNDSRTCIDFDDCQIWGICDQKCESRQGRHQCLCEEGYILE-RGQH 383

Query: 453 CTAVNVPQDEPASIIFSSTVDIRRIHLNG 481
           C + +      ASIIFS+  D+    L+G
Sbjct: 384 CKSND--SFSAASIIFSNGRDLLVGDLHG 410




Acts together with cubilin to mediate HDL endocytosis.
Mus musculus (taxid: 10090)
>sp|P98164|LRP2_HUMAN Low-density lipoprotein receptor-related protein 2 OS=Homo sapiens GN=LRP2 PE=1 SV=3 Back     alignment and function description
>sp|Q04833|LRP_CAEEL Low-density lipoprotein receptor-related protein OS=Caenorhabditis elegans GN=lrp-1 PE=1 SV=1 Back     alignment and function description
>sp|Q91ZX7|LRP1_MOUSE Prolow-density lipoprotein receptor-related protein 1 OS=Mus musculus GN=Lrp1 PE=1 SV=1 Back     alignment and function description
>sp|P98165|VLDLR_CHICK Very low-density lipoprotein receptor OS=Gallus gallus GN=VLDLR PE=1 SV=1 Back     alignment and function description
>sp|P98158|LRP2_RAT Low-density lipoprotein receptor-related protein 2 OS=Rattus norvegicus GN=Lrp2 PE=1 SV=1 Back     alignment and function description
>sp|Q07954|LRP1_HUMAN Prolow-density lipoprotein receptor-related protein 1 OS=Homo sapiens GN=LRP1 PE=1 SV=2 Back     alignment and function description
>sp|P98163|YL_DROME Putative vitellogenin receptor OS=Drosophila melanogaster GN=yl PE=1 SV=2 Back     alignment and function description
>sp|P98157|LRP1_CHICK Low-density lipoprotein receptor-related protein 1 OS=Gallus gallus GN=LRP1 PE=2 SV=1 Back     alignment and function description
>sp|P35953|VLDLR_RABIT Very low-density lipoprotein receptor OS=Oryctolagus cuniculus GN=VLDLR PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query482
328702065 2150 PREDICTED: low-density lipoprotein recep 0.483 0.108 0.407 3e-47
270010181 4576 hypothetical protein TcasGA2_TC009548 [T 0.475 0.050 0.425 6e-43
427796811 4696 Putative prolow-density lipoprotein rece 0.477 0.048 0.418 3e-41
432117303 1645 Low-density lipoprotein receptor-related 0.605 0.177 0.377 3e-40
157115039 4649 low-density lipoprotein receptor (ldl) [ 0.475 0.049 0.381 3e-39
156407458 629 predicted protein [Nematostella vectensi 0.614 0.470 0.360 2e-38
158300186 4718 AGAP012372-PA [Anopheles gambiae str. PE 0.468 0.047 0.402 3e-38
297471646 4680 PREDICTED: low-density lipoprotein recep 0.624 0.064 0.345 3e-38
170035892 4695 very low-density lipoprotein receptor [C 0.452 0.046 0.426 5e-38
427788305 4586 Putative megalin [Rhipicephalus pulchell 0.614 0.064 0.390 6e-38
>gi|328702065|ref|XP_001946912.2| PREDICTED: low-density lipoprotein receptor-related protein 1-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  195 bits (496), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 115/282 (40%), Positives = 144/282 (51%), Gaps = 49/282 (17%)

Query: 203 AECTPGQFSCGMGKCIPESWKCDGFVDCLEDGSDEPNTC-IHQCFNGQVQCALSKKCIPH 261
           + C   QF CG G+CIP  WKCD   DC  DGSDE ++C +  C   Q QCALSKKCIP 
Sbjct: 33  SSCNSNQFFCGSGECIPLKWKCDFNPDC-ADGSDEFDSCGLPTCKYSQFQCALSKKCIPR 91

Query: 262 NWLCDEEMDCSTDDIVDNTDEDWDKFHQCFNGQVQCALSKKCIPHNWLCDEEMDCSTDDI 321
            W+CD E+DC                                     L   E D S +D 
Sbjct: 92  EWICDGELDCGAS----------------------------------LNSTEQDASDEDS 117

Query: 322 VDNTDEDWDKYFSHNAVLCHPNELRCGSSNQCVALSKFCDGKPDCSNGEDEGPFCNNKAD 381
           +                 C PN  RCG+S QC  +  FCDG   C N  DEG FC N   
Sbjct: 118 LQ----------CQKPSSCPPNMARCGNSTQCKYIESFCDGTSHCENSTDEGRFCENMVP 167

Query: 382 CENLKCSHKCSPTPRGAMCFCPAGQNPNKTQCVDADEC-LIDGSCDQTCTNTHLSYVCSC 440
           C  L C+H C PT +G  CFCP G  P+  +C+D DEC +++ +CDQ CTN   S+ CSC
Sbjct: 168 CHGLNCAHGCKPTGKGPACFCPEGMQPHNNECIDMDECEVLNYTCDQICTNKKGSFSCSC 227

Query: 441 TEGYTLRPDGKSCTAVNVPQDEPASIIFSSTVDIRRIHLNGS 482
             GY       +C A+NVP++E ASI+ S++ DIRRI+LNGS
Sbjct: 228 VPGYI--QTNSTCKAINVPENEDASILVSTSKDIRRIYLNGS 267




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|270010181|gb|EFA06629.1| hypothetical protein TcasGA2_TC009548 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|427796811|gb|JAA63857.1| Putative prolow-density lipoprotein receptor-related protein 1, partial [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|432117303|gb|ELK37690.1| Low-density lipoprotein receptor-related protein 2 [Myotis davidii] Back     alignment and taxonomy information
>gi|157115039|ref|XP_001652530.1| low-density lipoprotein receptor (ldl) [Aedes aegypti] gi|108877064|gb|EAT41289.1| AAEL007041-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|156407458|ref|XP_001641561.1| predicted protein [Nematostella vectensis] gi|156228700|gb|EDO49498.1| predicted protein [Nematostella vectensis] Back     alignment and taxonomy information
>gi|158300186|ref|XP_320185.4| AGAP012372-PA [Anopheles gambiae str. PEST] gi|157013036|gb|EAA00393.5| AGAP012372-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|297471646|ref|XP_002685354.1| PREDICTED: low-density lipoprotein receptor-related protein 2 [Bos taurus] gi|296490675|tpg|DAA32788.1| TPA: low-density lipoprotein receptor-related protein 2-like [Bos taurus] Back     alignment and taxonomy information
>gi|170035892|ref|XP_001845800.1| very low-density lipoprotein receptor [Culex quinquefasciatus] gi|167878399|gb|EDS41782.1| very low-density lipoprotein receptor [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|427788305|gb|JAA59604.1| Putative megalin [Rhipicephalus pulchellus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query482
UNIPROTKB|P98164 4655 LRP2 "Low-density lipoprotein 0.597 0.061 0.377 2.2e-64
ZFIN|ZDB-GENE-050208-608 4616 lrp1ba "low density lipoprotei 0.655 0.068 0.338 6e-64
MGI|MGI:95794 4660 Lrp2 "low density lipoprotein 0.639 0.066 0.349 1.9e-63
UNIPROTKB|E2R4Q1 4528 LRP1 "Uncharacterized protein" 0.609 0.064 0.364 2.2e-62
UNIPROTKB|J9P315 4544 LRP1 "Uncharacterized protein" 0.609 0.064 0.364 2.3e-62
UNIPROTKB|G3V928 4545 Lrp1 "Protein Lrp1" [Rattus no 0.609 0.064 0.364 3.7e-62
UNIPROTKB|F1NJS9 4644 LRP2 "Uncharacterized protein" 0.562 0.058 0.352 4.4e-62
UNIPROTKB|F1NCT2 4645 LRP2 "Uncharacterized protein" 0.562 0.058 0.352 4.4e-62
FB|FBgn0053087 4699 LRP1 "LDL receptor protein 1" 0.435 0.044 0.414 2.3e-42
ZFIN|ZDB-GENE-070912-401 4456 lrp1bb "low density lipoprotei 0.605 0.065 0.351 1.7e-61
UNIPROTKB|P98164 LRP2 "Low-density lipoprotein receptor-related protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 499 (180.7 bits), Expect = 2.2e-64, Sum P(4) = 2.2e-64
 Identities = 123/326 (37%), Positives = 154/326 (47%)

Query:   143 W-CDSHLNTVESVRVDGSHNAVLCHPNELRCGSSNQCVALSKFCDGKPDCSNGEDEGPFC 201
             W CD+  +  +       ++   C P++  C  +++C+ LS  CDG  DC +G DE   C
Sbjct:  1126 WVCDTDNDCGDGSDEKNCNSTETCQPSQFNC-PNHRCIDLSFVCDGDKDCVDGSDEVG-C 1183

Query:   202 NAECTPGQFSCGMG-KCIPESWKCDGFVDCLEDGSDE---PNTCIHQCFNGQVQCALSKK 257
                CT  QF C  G KCI  + +CDG  DC  D SDE   P      C + + QC     
Sbjct:  1184 VLNCTASQFKCASGDKCIGVTNRCDGVFDC-SDNSDEAGCPTRPPGMCHSDEFQCQEDGI 1242

Query:   258 CIPHNWLCDEEMDC--STDD---IVDNTDEDWDKFHQCFNGQVQCALSKKCIPHNWLCDE 312
             CIP+ W CD   DC   +D+    V  T      FH C NG         CI   WLCD 
Sbjct:  1243 CIPNFWECDGHPDCLYGSDEHNACVPKTCPS-SYFH-CDNGN--------CIHRAWLCDR 1292

Query:   313 EMDCSTDDIVDNTDEDWDKYFSHNAVLCHPNELRCGSSNQCVALSKFCDGKPDCSNGEDE 372
             + DC      D +DE   K        C   + +C   N CV LS  CDG  DC NG DE
Sbjct:  1293 DNDCG-----DMSDE---KDCPTQPFRCPSWQWQCLGHNICVNLSVVCDGIFDCPNGTDE 1344

Query:   373 GPFCNNKADCENLK--CSHKCSPTPRGAMCFCPAG---QNPNKTQCVDADECLIDGSCDQ 427
              P CN  + C +    C+H+C   P GA C CP G    N +KT C D DEC I GSC Q
Sbjct:  1345 SPLCNGNS-CSDFNGGCTHECVQEPFGAKCLCPLGFLLANDSKT-CEDIDECDILGSCSQ 1402

Query:   428 TCTNTHLSYVCSCTEGYTLRPDGKSC 453
              C N   S+ CSC  GY L  DG++C
Sbjct:  1403 HCYNMRGSFRCSCDTGYMLESDGRTC 1428


GO:0005509 "calcium ion binding" evidence=IEA
GO:0016021 "integral to membrane" evidence=IEA
GO:0017124 "SH3 domain binding" evidence=IEA
GO:0005768 "endosome" evidence=IEA
GO:0005783 "endoplasmic reticulum" evidence=IEA
GO:0005794 "Golgi apparatus" evidence=IEA
GO:0006898 "receptor-mediated endocytosis" evidence=IEA
GO:0008283 "cell proliferation" evidence=IEA
GO:0030139 "endocytic vesicle" evidence=IEA
GO:0030900 "forebrain development" evidence=IEA
GO:0031526 "brush border membrane" evidence=IEA
GO:0005905 "coated pit" evidence=IEA
GO:0005515 "protein binding" evidence=IPI
GO:0016324 "apical plasma membrane" evidence=ISS
GO:0005764 "lysosome" evidence=TAS
GO:0006486 "protein glycosylation" evidence=TAS
GO:0006629 "lipid metabolic process" evidence=TAS
GO:0006897 "endocytosis" evidence=TAS
GO:0005886 "plasma membrane" evidence=TAS
GO:0008202 "steroid metabolic process" evidence=TAS
GO:0042359 "vitamin D metabolic process" evidence=TAS
GO:0044281 "small molecule metabolic process" evidence=TAS
ZFIN|ZDB-GENE-050208-608 lrp1ba "low density lipoprotein receptor-related protein 1Ba" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:95794 Lrp2 "low density lipoprotein receptor-related protein 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E2R4Q1 LRP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9P315 LRP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|G3V928 Lrp1 "Protein Lrp1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1NJS9 LRP2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NCT2 LRP2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
FB|FBgn0053087 LRP1 "LDL receptor protein 1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070912-401 lrp1bb "low density lipoprotein receptor-related protein 1Bb" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query482
cd0011235 cd00112, LDLa, Low Density Lipoprotein Receptor Cl 1e-08
smart0013543 smart00135, LY, Low-density lipoprotein-receptor Y 8e-08
smart0019233 smart00192, LDLa, Low-density lipoprotein receptor 2e-07
pfam0005737 pfam00057, Ldl_recept_a, Low-density lipoprotein r 9e-07
cd01475224 cd01475, vWA_Matrilin, VWA_Matrilin: In cartilagin 8e-06
cd0011235 cd00112, LDLa, Low Density Lipoprotein Receptor Cl 1e-04
cd0011235 cd00112, LDLa, Low Density Lipoprotein Receptor Cl 1e-04
smart0019233 smart00192, LDLa, Low-density lipoprotein receptor 3e-04
smart0019233 smart00192, LDLa, Low-density lipoprotein receptor 3e-04
pfam0005737 pfam00057, Ldl_recept_a, Low-density lipoprotein r 4e-04
pfam0005737 pfam00057, Ldl_recept_a, Low-density lipoprotein r 4e-04
pfam0005842 pfam00058, Ldl_recept_b, Low-density lipoprotein r 0.001
pfam1266224 pfam12662, cEGF, Complement Clr-like EGF-like 0.001
smart0017939 smart00179, EGF_CA, Calcium-binding EGF-like domai 0.002
>gnl|CDD|238060 cd00112, LDLa, Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure Back     alignment and domain information
 Score = 50.3 bits (121), Expect = 1e-08
 Identities = 21/35 (60%), Positives = 23/35 (65%), Gaps = 1/35 (2%)

Query: 205 CTPGQFSCGMGKCIPESWKCDGFVDCLEDGSDEPN 239
           C P +F C  G+CIP SW CDG  DC  DGSDE N
Sbjct: 1   CPPNEFRCANGRCIPSSWVCDGEDDC-GDGSDEEN 34


Length = 35

>gnl|CDD|214531 smart00135, LY, Low-density lipoprotein-receptor YWTD domain Back     alignment and domain information
>gnl|CDD|197566 smart00192, LDLa, Low-density lipoprotein receptor domain class A Back     alignment and domain information
>gnl|CDD|200964 pfam00057, Ldl_recept_a, Low-density lipoprotein receptor domain class A Back     alignment and domain information
>gnl|CDD|238752 cd01475, vWA_Matrilin, VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity Back     alignment and domain information
>gnl|CDD|238060 cd00112, LDLa, Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure Back     alignment and domain information
>gnl|CDD|238060 cd00112, LDLa, Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure Back     alignment and domain information
>gnl|CDD|197566 smart00192, LDLa, Low-density lipoprotein receptor domain class A Back     alignment and domain information
>gnl|CDD|197566 smart00192, LDLa, Low-density lipoprotein receptor domain class A Back     alignment and domain information
>gnl|CDD|200964 pfam00057, Ldl_recept_a, Low-density lipoprotein receptor domain class A Back     alignment and domain information
>gnl|CDD|200964 pfam00057, Ldl_recept_a, Low-density lipoprotein receptor domain class A Back     alignment and domain information
>gnl|CDD|215683 pfam00058, Ldl_recept_b, Low-density lipoprotein receptor repeat class B Back     alignment and domain information
>gnl|CDD|221695 pfam12662, cEGF, Complement Clr-like EGF-like Back     alignment and domain information
>gnl|CDD|214542 smart00179, EGF_CA, Calcium-binding EGF-like domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 482
KOG1215|consensus 877 99.84
KOG1215|consensus 877 99.24
PF0005737 Ldl_recept_a: Low-density lipoprotein receptor dom 98.91
cd0011235 LDLa Low Density Lipoprotein Receptor Class A doma 98.89
PF0005737 Ldl_recept_a: Low-density lipoprotein receptor dom 98.81
cd0011235 LDLa Low Density Lipoprotein Receptor Class A doma 98.74
smart0019233 LDLa Low-density lipoprotein receptor domain class 98.65
smart0019233 LDLa Low-density lipoprotein receptor domain class 98.47
KOG1214|consensus 1289 98.43
PF12999176 PRKCSH-like: Glucosidase II beta subunit-like 98.43
PF1467036 FXa_inhibition: Coagulation Factor Xa inhibitory s 98.4
KOG1219|consensus 4289 98.18
PF12999176 PRKCSH-like: Glucosidase II beta subunit-like 98.09
PF0764542 EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 98.06
PF1266224 cEGF: Complement Clr-like EGF-like 98.0
KOG1219|consensus 4289 97.38
KOG1214|consensus 1289 97.28
KOG4260|consensus350 97.17
PF1467036 FXa_inhibition: Coagulation Factor Xa inhibitory s 96.98
PF1266224 cEGF: Complement Clr-like EGF-like 96.78
cd01475224 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, 96.2
KOG2397|consensus 480 96.13
smart0017939 EGF_CA Calcium-binding EGF-like domain. 95.94
KOG1217|consensus487 95.88
KOG4289|consensus 2531 95.4
KOG1217|consensus 487 95.27
PF0764542 EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 95.01
KOG4260|consensus350 94.84
KOG3509|consensus 964 94.3
KOG2397|consensus 480 93.84
cd0005438 EGF_CA Calcium-binding EGF-like domain, present in 93.42
smart0018135 EGF Epidermal growth factor-like domain. 93.42
KOG4289|consensus 2531 92.95
PF1294736 EGF_3: EGF domain; InterPro: IPR024731 This entry 92.94
KOG3509|consensus 964 92.91
smart0017939 EGF_CA Calcium-binding EGF-like domain. 91.45
cd0005336 EGF Epidermal growth factor domain, found in epide 89.25
PF1294736 EGF_3: EGF domain; InterPro: IPR024731 This entry 89.23
smart0018135 EGF Epidermal growth factor-like domain. 88.69
PF0000832 EGF: EGF-like domain This is a sub-family of the P 84.59
PF0000832 EGF: EGF-like domain This is a sub-family of the P 84.16
cd0005438 EGF_CA Calcium-binding EGF-like domain, present in 81.98
cd0005336 EGF Epidermal growth factor domain, found in epide 81.26
KOG1225|consensus525 80.21
>KOG1215|consensus Back     alignment and domain information
Probab=99.84  E-value=3.5e-20  Score=211.54  Aligned_cols=324  Identities=32%  Similarity=0.614  Sum_probs=250.1

Q ss_pred             CCCCcceeeCCceecCceeeCCCCCCCcccCCCCCCccccccCCCC----------------------------------
Q psy14262        115 GENRSPLVTKNIQWPSSLVIDYNQDILYWCDSHLNTVESVRVDGSH----------------------------------  160 (482)
Q Consensus       115 ~~~~~~~~~~~~ci~~~~~cdg~~dc~dw~d~~~~sdE~~~~~~~c----------------------------------  160 (482)
                      |+.+..++-...-||+++..|....+.+|.|++...+|..++++.-                                  
T Consensus        25 g~~~~~~~~~~~~~~ng~~id~~~~~~y~~d~~~~~i~~~~~dg~~r~~l~~~~~~~y~~d~~v~~~~~~sg~~~~~~~~  104 (877)
T KOG1215|consen   25 GGERKILEKEEFEWPNGLTIDLAWQRIYWADAKNDLIESANYDGSGRRALTLFEDGLYWTDKSVSAANKKTGKDVTRLSQ  104 (877)
T ss_pred             CcceEEeeccceeCCCcceecchhheeeeccccCCceEEeccCCccceeeeeeccceeeccchhhhhccCCCCcceeehh
Confidence            3444455555677888888888899999999999888887776631                                  


Q ss_pred             -----------------------------CCccCCCCCeecC--CCCceecCCcccCCCCCCCCCCCCCCCCC---CCCC
Q psy14262        161 -----------------------------NAVLCHPNELRCG--SSNQCVALSKFCDGKPDCSNGEDEGPFCN---AECT  206 (482)
Q Consensus       161 -----------------------------~~~~C~~~~f~C~--~~~~Ci~~~~~CDg~~dC~dgsDE~~~C~---~~C~  206 (482)
                                                   +...|...+|+|.  +. +||+..|+|||..+|.+|+||.+ |.   ....
T Consensus       105 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~c~~~~~-~Cip~~~~cd~~~~C~dg~de~~-~~~~~~~~~  182 (877)
T KOG1215|consen  105 DSHFPLDIHAYHPSSQPLAPDPCAESGNGPCSHCCLDKFSCRTGSC-KCIPGDWLCDGEADCPDGSDELN-CAVRRCEPR  182 (877)
T ss_pred             cCCCCcceeEEecCCCCCCCCcccccCCCCCccccCCCCCCcCccc-cCCCCceeCCCCCccccchhhhc-ccccccCcc
Confidence                                         0123566789998  44 89999999999999999999998 64   1222


Q ss_pred             CCceecCCCCeeccCCCCCCCcCCCCCCCCCCCccccccc---CCccccCCCCceecCCCccCccCCCCCCCCCCCCCCC
Q psy14262        207 PGQFSCGMGKCIPESWKCDGFVDCLEDGSDEPNTCIHQCF---NGQVQCALSKKCIPHNWLCDEEMDCSTDDIVDNTDED  283 (482)
Q Consensus       207 ~~~f~C~~g~Ci~~~~~CDg~~dC~~dgsDE~~C~~~~C~---~~~f~C~~~g~Ci~~~~~CDg~~dC~~~~~~dgsDE~  283 (482)
                      ...|+|     |...++||+..+| .+++|+.......+.   ...++|.+.++||...+.|||..+|.     +++||.
T Consensus       183 ~~~~~~-----~~~~~~~d~~~~~-~~~~d~~~~~~~~~~~~~~~~~~c~g~~~~i~~~~~~Dg~~dc~-----~~~de~  251 (877)
T KOG1215|consen  183 GASLDC-----IVAIKVCDIQHDC-ADDYDESEGRIYWTDDSRIEVTRCDGSSRCILISEVCDGPRDCV-----DGPDEG  251 (877)
T ss_pred             cccccc-----ceeeeecCccccc-ccccccccCcccccCCcceeEEEecCCCcEEeehhccCCCcccc-----cCCcCc
Confidence            344555     9999999999999 999999887544443   46788985569999999999999999     999994


Q ss_pred             --CCCCccccCcccccCCCCccCCCCCCCCCCCCCCCCCcCCCCCCCcCCcCccCcccccCCCcccCCCCcccccccccC
Q psy14262        284 --WDKFHQCFNGQVQCALSKKCIPHNWLCDEEMDCSTDDIVDNTDEDWDKYFSHNAVLCHPNELRCGSSNQCVALSKFCD  361 (482)
Q Consensus       284 --~C~~~~C~~~~f~C~~g~~Ci~~~~~CDg~~DC~~g~~~dgsDE~~~~~C~~~~~~C~~~~f~C~~g~~Ci~~~~~CD  361 (482)
                        ++....|...++.|.++ .|++...+|+|..||+     +|+||..   |..  ..+.+..|.|..+ + |...++|+
T Consensus       252 ~~~~~~~~~~~~e~~~~~~-~~~~~~~~~~g~~d~p-----dg~de~~---~~~--~~~~~~~~d~~~~-~-i~~~~~~~  318 (877)
T KOG1215|consen  252 VMNCSDATCEAPEIECADG-DCSDRQKLCDGDLDCP-----DGLDEDY---CKK--KLYWSMNVDGSGR-R-ILLSKLCH  318 (877)
T ss_pred             eeEeeccccCCcceeecCC-CCccceEEecCccCCC-----Ccccccc---ccc--ceeeeeecccCCc-e-eeecccCc
Confidence              66667788889999876 9999999999999999     9999987   754  2233667888877 8 99999998


Q ss_pred             CCCCCCCCCCCCCCCCCCCCcc--CCCCcCCCCCCCCCccccCCCCc--cCCCCCccccccccCCCCCCceee-ecCCce
Q psy14262        362 GKPDCSNGEDEGPFCNNKADCE--NLKCSHKCSPTPRGAMCFCPAGQ--NPNKTQCVDADECLIDGSCDQTCT-NTHLSY  436 (482)
Q Consensus       362 g~~dC~dgsDE~~~C~~~~~C~--~~~C~~~C~~~~~~~~C~C~~G~--~~~~~~C~di~eC~~~~~Cs~~C~-n~~gsy  436 (482)
                      +     ...+..+      ++.  ...+.+.+.+......+.|..++  .....+ ....++..++.|+|.|. +.++.|
T Consensus       319 ~-----~~~~~~~------~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~~~-~~~~~~~~~g~Csq~C~~~~p~~~  386 (877)
T KOG1215|consen  319 G-----YWTDGLN------ECAERVLKCSHKCPDVSVGPRCDCMGAKVLPLGART-DSNPCESDNGGCSQLCVPNSPGTF  386 (877)
T ss_pred             c-----ccccccc------cchhhcccccCCCCccccCCcccCCccceecccccc-cCCcccccCCccceeccCCCCCce
Confidence            8     1233322      443  45666778888888999999988  222322 12233336799999999 569999


Q ss_pred             EEecCCCeEECCCCCccccCCCCCCCCcEEEeccCCceEEEeccC
Q psy14262        437 VCSCTEGYTLRPDGKSCTAVNVPQDEPASIIFSSTVDIRRIHLNG  481 (482)
Q Consensus       437 ~C~C~~Gy~l~~d~~tC~didec~~~p~~l~~~~~~~ir~~~l~~  481 (482)
                      +|.|..||.+..++  |...+   ...++|+|+++++||++.|..
T Consensus       387 ~c~c~~g~~~~~~~--c~~~~---~~~~~l~~s~~~~ir~~~~~~  426 (877)
T KOG1215|consen  387 KCACSPGYELRLDK--CEASD---QPEAFLLFSNRHDIRRISLDC  426 (877)
T ss_pred             eEecCCCcEeccCC--ceecC---CCCcEEEEecCccceecccCC
Confidence            99999999998766  66554   334599999999999999875



>KOG1215|consensus Back     alignment and domain information
>PF00057 Ldl_recept_a: Low-density lipoprotein receptor domain class A This prints entry is specific to LDL receptor; InterPro: IPR002172 The low-density lipoprotein receptor (LDLR) is the major cholesterol-carrying lipoprotein of plasma, acting to regulate cholesterol homeostasis in mammalian cells Back     alignment and domain information
>cd00112 LDLa Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure Back     alignment and domain information
>PF00057 Ldl_recept_a: Low-density lipoprotein receptor domain class A This prints entry is specific to LDL receptor; InterPro: IPR002172 The low-density lipoprotein receptor (LDLR) is the major cholesterol-carrying lipoprotein of plasma, acting to regulate cholesterol homeostasis in mammalian cells Back     alignment and domain information
>cd00112 LDLa Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure Back     alignment and domain information
>smart00192 LDLa Low-density lipoprotein receptor domain class A Back     alignment and domain information
>smart00192 LDLa Low-density lipoprotein receptor domain class A Back     alignment and domain information
>KOG1214|consensus Back     alignment and domain information
>PF12999 PRKCSH-like: Glucosidase II beta subunit-like Back     alignment and domain information
>PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>PF12999 PRKCSH-like: Glucosidase II beta subunit-like Back     alignment and domain information
>PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins Back     alignment and domain information
>PF12662 cEGF: Complement Clr-like EGF-like Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>KOG1214|consensus Back     alignment and domain information
>KOG4260|consensus Back     alignment and domain information
>PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A Back     alignment and domain information
>PF12662 cEGF: Complement Clr-like EGF-like Back     alignment and domain information
>cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity Back     alignment and domain information
>KOG2397|consensus Back     alignment and domain information
>smart00179 EGF_CA Calcium-binding EGF-like domain Back     alignment and domain information
>KOG1217|consensus Back     alignment and domain information
>KOG4289|consensus Back     alignment and domain information
>KOG1217|consensus Back     alignment and domain information
>PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins Back     alignment and domain information
>KOG4260|consensus Back     alignment and domain information
>KOG3509|consensus Back     alignment and domain information
>KOG2397|consensus Back     alignment and domain information
>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>smart00181 EGF Epidermal growth factor-like domain Back     alignment and domain information
>KOG4289|consensus Back     alignment and domain information
>PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins Back     alignment and domain information
>KOG3509|consensus Back     alignment and domain information
>smart00179 EGF_CA Calcium-binding EGF-like domain Back     alignment and domain information
>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins Back     alignment and domain information
>smart00181 EGF Epidermal growth factor-like domain Back     alignment and domain information
>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>KOG1225|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query482
3m0c_C 791 The X-Ray Crystal Structure Of Pcsk9 In Complex Wit 1e-28
1n7d_A 699 Extracellular Domain Of The Ldl Receptor Length = 6 1e-28
3p5c_L 440 The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE 1e-12
3v65_B 386 Crystal Structure Of Agrin And Lrp4 Complex Length 2e-09
3p5b_L 400 The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE 8e-09
3soq_A318 The Structure Of The First Ywtd Beta Propeller Doma 7e-08
3sob_B316 The Structure Of The First Ywtd Beta Propeller Doma 7e-08
4dg6_A 616 Crystal Structure Of Domains 1 And 2 Of Lrp6 Length 7e-08
3s94_A619 Crystal Structure Of Lrp6-E1e2 Length = 619 7e-08
1ijq_A316 Crystal Structure Of The Ldl Receptor Ywtd-Egf Doma 3e-07
1hz8_A82 Solution Structure And Backbone Dynamics Of A Conca 3e-07
1f5y_A85 Nmr Structure Of A Concatemer Of The First And Seco 4e-07
1f5y_A85 Nmr Structure Of A Concatemer Of The First And Seco 1e-05
3v64_C 349 Crystal Structure Of Agrin And Lrp4 Length = 349 8e-07
2fyj_A82 Nmr Solution Structure Of Calcium-Loaded Lrp Double 1e-06
2w2m_E107 Wt Pcsk9-Deltac Bound To Wt Egf-A Of Ldlr Length = 3e-06
1hj7_A80 Nmr Study Of A Pair Of Ldl Receptor Ca2+ Binding Ep 3e-06
3bps_E83 Pcsk9:egf-a Complex Length = 83 4e-06
2fcw_B80 Structure Of A Complex Between The Pair Of The Ldl 1e-05
2fcw_B80 Structure Of A Complex Between The Pair Of The Ldl 4e-05
2w2n_E107 Wt Pcsk9-Deltac Bound To Egf-A H306y Mutant Of Ldlr 1e-05
3gcw_E83 Pcsk9:egfa(H306y) Length = 83 1e-05
2lgp_A94 Solution Structure Of La45 From Ldlr Length = 94 4e-05
1d2l_A45 Nmr Solution Structure Of Complement-Like Repeat Cr 1e-04
>pdb|3M0C|C Chain C, The X-Ray Crystal Structure Of Pcsk9 In Complex With The Ldl Receptor Length = 791 Back     alignment and structure

Iteration: 1

Score = 124 bits (310), Expect = 1e-28, Method: Compositional matrix adjust. Identities = 112/332 (33%), Positives = 149/332 (44%), Gaps = 37/332 (11%) Query: 165 CHPNELRCGSSNQCVALSKFCDGKPDCSNGEDEGPFCNAECTPGQFSCGMGKCIPESWKC 224 C +E RC +C++ CD DC +G DE C P F C CIP+ W C Sbjct: 106 CSQDEFRC-HDGKCISRQFVCDSDRDCLDGSDEASCPVLTCGPASFQCNSSTCIPQLWAC 164 Query: 225 DGFVDCLEDGSDE-PNTC----IHQ-----CFNGQVQCALSKKCIPHNWLCDEEMDCSTD 274 D DC EDGSDE P C + Q C + C LS +CI +W CD DC Sbjct: 165 DNDPDC-EDGSDEWPQRCRGLYVFQGDSSPCSAFEFHC-LSGECIHSSWRCDGGPDCK-- 220 Query: 275 DIVDNTDEDWDKFHQCFNGQVQCALSKKCIPHNWLCDEEMDCSTDDIVDNTDEDWDKYFS 334 D +DE+ C + QC+ CI + CD E DC D +DE Sbjct: 221 ---DKSDEENCAVATCRPDEFQCS-DGNCIHGSRQCDREYDCK-----DMSDE----VGC 267 Query: 335 HNAVLCH-PNELRCGSSNQCVALSKFCDGKPDCSNGEDEGPFCNNKADC--ENLKCSHKC 391 N LC PN+ +C S +C+ L K C+ DC + DE +C N CSH C Sbjct: 268 VNVTLCEGPNKFKC-HSGECITLDKVCNMARDCRDWSDEPIKECGTNECLDNNGGCSHVC 326 Query: 392 SPTPRGAMCFCPAG-QNPNKTQCVDADECLIDGSCDQTCTNTHLSYVCSCTEGYTLRPDG 450 + G C CP G Q + +C D DEC +C Q C N Y C C EG+ L P Sbjct: 327 NDLKIGYECLCPDGFQLVAQRRCEDIDECQDPDTCSQLCVNLEGGYKCQCEEGFQLDPHT 386 Query: 451 KSCTAVNVPQDEPASIIFSSTVDIRRIHLNGS 482 K+C AV A + F++ ++R++ L+ S Sbjct: 387 KACKAVG----SIAYLFFTNRHEVRKMTLDRS 414
>pdb|1N7D|A Chain A, Extracellular Domain Of The Ldl Receptor Length = 699 Back     alignment and structure
>pdb|3P5C|L Chain L, The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE RECEPTOR IN AN Extended Conformation Length = 440 Back     alignment and structure
>pdb|3V65|B Chain B, Crystal Structure Of Agrin And Lrp4 Complex Length = 386 Back     alignment and structure
>pdb|3P5B|L Chain L, The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE RECEPTOR IN AN Extended Conformation Length = 400 Back     alignment and structure
>pdb|3SOQ|A Chain A, The Structure Of The First Ywtd Beta Propeller Domain Of Lrp6 In Complex With A Dkk1 Peptide Length = 318 Back     alignment and structure
>pdb|3SOB|B Chain B, The Structure Of The First Ywtd Beta Propeller Domain Of Lrp6 In Complex With A Fab Length = 316 Back     alignment and structure
>pdb|4DG6|A Chain A, Crystal Structure Of Domains 1 And 2 Of Lrp6 Length = 616 Back     alignment and structure
>pdb|3S94|A Chain A, Crystal Structure Of Lrp6-E1e2 Length = 619 Back     alignment and structure
>pdb|1IJQ|A Chain A, Crystal Structure Of The Ldl Receptor Ywtd-Egf Domain Pair Length = 316 Back     alignment and structure
>pdb|1HZ8|A Chain A, Solution Structure And Backbone Dynamics Of A Concatemer Of Egf-Homology Modules Of The Human Low Density Lipoprotein Receptor Length = 82 Back     alignment and structure
>pdb|1F5Y|A Chain A, Nmr Structure Of A Concatemer Of The First And Second Ligand-Binding Modules Of The Human Ldl Receptor Length = 85 Back     alignment and structure
>pdb|1F5Y|A Chain A, Nmr Structure Of A Concatemer Of The First And Second Ligand-Binding Modules Of The Human Ldl Receptor Length = 85 Back     alignment and structure
>pdb|3V64|C Chain C, Crystal Structure Of Agrin And Lrp4 Length = 349 Back     alignment and structure
>pdb|2FYJ|A Chain A, Nmr Solution Structure Of Calcium-Loaded Lrp Double Module Length = 82 Back     alignment and structure
>pdb|2W2M|E Chain E, Wt Pcsk9-Deltac Bound To Wt Egf-A Of Ldlr Length = 107 Back     alignment and structure
>pdb|1HJ7|A Chain A, Nmr Study Of A Pair Of Ldl Receptor Ca2+ Binding Epidermal Growth Factor-Like Domains, 20 Structures Length = 80 Back     alignment and structure
>pdb|3BPS|E Chain E, Pcsk9:egf-a Complex Length = 83 Back     alignment and structure
>pdb|2FCW|B Chain B, Structure Of A Complex Between The Pair Of The Ldl Receptor Ligand-Binding Modules 3-4 And The Receptor Associated Protein (Rap) Length = 80 Back     alignment and structure
>pdb|2FCW|B Chain B, Structure Of A Complex Between The Pair Of The Ldl Receptor Ligand-Binding Modules 3-4 And The Receptor Associated Protein (Rap) Length = 80 Back     alignment and structure
>pdb|2W2N|E Chain E, Wt Pcsk9-Deltac Bound To Egf-A H306y Mutant Of Ldlr Length = 107 Back     alignment and structure
>pdb|3GCW|E Chain E, Pcsk9:egfa(H306y) Length = 83 Back     alignment and structure
>pdb|2LGP|A Chain A, Solution Structure Of La45 From Ldlr Length = 94 Back     alignment and structure
>pdb|1D2L|A Chain A, Nmr Solution Structure Of Complement-Like Repeat Cr3 From The Low Density Lipoprotein Receptor-Related Protein (Lrp) . Evidence For Specific Binding To The Receptor Binding Domain Of Human Alpha-2 Macroglobulin Length = 45 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query482
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 5e-37
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 6e-28
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 1e-22
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 3e-17
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 8e-08
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 2e-34
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 3e-29
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 6e-23
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 3e-18
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 4e-08
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 2e-06
2fcw_B80 LDL receptor, low-density lipoprotein receptor; pr 1e-17
2fcw_B80 LDL receptor, low-density lipoprotein receptor; pr 1e-16
2fcw_B80 LDL receptor, low-density lipoprotein receptor; pr 2e-10
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 1e-16
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 2e-08
2fyj_A82 Low-density lipoprotein receptor-related protein 1 7e-16
2fyj_A82 Low-density lipoprotein receptor-related protein 1 1e-15
2fyj_A82 Low-density lipoprotein receptor-related protein 1 1e-09
2fyj_A82 Low-density lipoprotein receptor-related protein 1 5e-04
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 3e-14
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 5e-10
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 3e-06
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 6e-05
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 5e-04
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 5e-14
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 2e-07
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 2e-12
3p5b_L400 Low density lipoprotein receptor variant; B-propel 3e-10
2xrc_A565 Human complement factor I; immune system, hydrolas 2e-12
2xrc_A 565 Human complement factor I; immune system, hydrolas 2e-05
3v65_B 386 Low-density lipoprotein receptor-related protein; 3e-12
3v65_B386 Low-density lipoprotein receptor-related protein; 5e-10
3v65_B386 Low-density lipoprotein receptor-related protein; 1e-05
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 8e-12
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 2e-11
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 4e-11
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 3e-05
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 6e-05
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 9e-04
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 2e-10
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 3e-06
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 9e-10
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 8e-06
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 1e-09
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 5e-09
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 7e-09
1d2l_A45 Lipoprotein receptor related protein; ligand bindi 1e-09
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 2e-09
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 2e-04
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 3e-04
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 5e-04
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 3e-09
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 4e-09
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 1e-08
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 3e-07
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 2e-04
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 4e-04
1ajj_A37 LR5, low-density lipoprotein receptor; LDL recepto 7e-09
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 1e-08
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 6e-08
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 8e-08
3s94_A 619 LRP-6, low-density lipoprotein receptor-related pr 3e-05
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 2e-04
3a7q_B44 Low-density lipoprotein receptor-related protein; 2e-08
2kny_A80 LRP-1, linker, APO-E; lipoprotein receptor, ligand 2e-08
2kny_A80 LRP-1, linker, APO-E; lipoprotein receptor, ligand 2e-07
2kny_A80 LRP-1, linker, APO-E; lipoprotein receptor, ligand 1e-04
2kny_A80 LRP-1, linker, APO-E; lipoprotein receptor, ligand 8e-04
2gtl_O215 Extracellular hemoglobin linker L3 subunit; anneli 4e-08
2gtl_O215 Extracellular hemoglobin linker L3 subunit; anneli 2e-05
2gtl_O215 Extracellular hemoglobin linker L3 subunit; anneli 6e-04
1j8e_A44 Low-density lipoprotein receptor-related protein 1 6e-08
2jkh_L55 Factor X light chain; plasma, calcium, zymogen, se 7e-08
1aut_L114 Activated protein C; serine proteinase, plasma cal 8e-08
2i1p_A48 Low-density lipoprotein receptor-related protein 2 1e-07
2i1p_A48 Low-density lipoprotein receptor-related protein 2 3e-05
2i1p_A48 Low-density lipoprotein receptor-related protein 2 3e-05
3dpr_E39 LDL-receptor class A 3; human rhinovirus, VLDL-rec 3e-07
3dpr_E39 LDL-receptor class A 3; human rhinovirus, VLDL-rec 6e-04
3dpr_E39 LDL-receptor class A 3; human rhinovirus, VLDL-rec 6e-04
1cr8_A42 Protein (LOW density lipoprotein receptor related 3e-07
1cr8_A42 Protein (LOW density lipoprotein receptor related 2e-05
1cr8_A42 Protein (LOW density lipoprotein receptor related 2e-05
1jrf_A47 TVA LDL-A module, subgroup A ROUS sarcoma virus re 4e-07
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 4e-07
3v64_C 349 Agrin; beta propeller, laminin-G, signaling, prote 9e-07
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 5e-05
1kig_L51 Factor XA; glycoprotein, serine protease, plasma, 4e-07
2knx_A50 Prolow-density lipoprotein receptor-related prote; 5e-07
2knx_A50 Prolow-density lipoprotein receptor-related prote; 2e-05
2knx_A50 Prolow-density lipoprotein receptor-related prote; 5e-05
1k7b_A47 Subgroup A ROUS sarcoma virus receptor PG800 and P 5e-07
2bou_A143 EGF-like module containing mucin-like hormone rece 6e-07
1kli_L69 Factor VIIA; extrinsic coagulation pathway, serine 2e-06
2jm4_A43 Relaxin receptor 1; LDL-A module, RXFP1 receptor, 3e-06
2jm4_A43 Relaxin receptor 1; LDL-A module, RXFP1 receptor, 2e-05
2jm4_A43 Relaxin receptor 1; LDL-A module, RXFP1 receptor, 2e-05
2wph_E59 Coagulation factor IXA light chain; serine proteas 9e-06
2gtl_N220 Extracellular hemoglobin linker L2 subunit; anneli 1e-05
2gtl_N220 Extracellular hemoglobin linker L2 subunit; anneli 3e-05
3h5c_B 317 Vitamin K-dependent protein Z; protein Z-protein Z 2e-05
3f1s_B 283 Vitamin K-dependent protein Z; PZ, ZPI, complex, s 2e-05
2bz6_L53 Blood coagulation factor VIIA; serine protease, en 3e-05
1nzi_A159 Complement C1S component; calcium, innate immunity 4e-05
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 6e-05
2gtl_M217 Hemoglobin linker chain L1; annelid erythrocruorin 7e-05
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 2e-04
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 2e-04
1szb_A170 Mannose binding lectin-associated serine protease- 7e-04
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 Back     alignment and structure
 Score =  143 bits (362), Expect = 5e-37
 Identities = 99/304 (32%), Positives = 129/304 (42%), Gaps = 31/304 (10%)

Query: 165 CHPNELRCGSSNQCVALSKFCDGKPDCSNGEDEGPFCNAECTPGQFSCGMGKCIPESWKC 224
           C  +E RC    +C++    CD   DC +G DE       C P  F C    CIP+ W C
Sbjct: 88  CSQDEFRC-HDGKCISRQFVCDSDRDCLDGSDEASCPVLTCGPASFQCNSSTCIPQLWAC 146

Query: 225 DGFVDCLEDGSDEPN----------TCIHQCFNGQVQCALSKKCIPHNWLCDEEMDCSTD 274
           D   DC EDGSDE                 C   +  C  S +CI  +W CD   DC   
Sbjct: 147 DNDPDC-EDGSDEWPQRCRGLYVFQGDSSPCSAFEFHCL-SGECIHSSWRCDGGPDCK-- 202

Query: 275 DIVDNTDEDWDKFHQCFNGQVQCALSKKCIPHNWLCDEEMDCSTDDIVDNTDEDWDKYFS 334
              D +DE+      C   + QC+    CI  +  CD E DC      D +DE       
Sbjct: 203 ---DKSDEENCAVATCRPDEFQCS-DGNCIHGSRQCDREYDCK-----DMSDEV---GCV 250

Query: 335 HNAVLCHPNELRCGSSNQCVALSKFCDGKPDCSNGEDEGPFC--NNKADCENLKCSHKCS 392
           +  +   PN+ +C  S +C+ L K C+   DC +  DE       N+    N  CSH C+
Sbjct: 251 NVTLCEGPNKFKCH-SGECITLDKVCNMARDCRDWSDEPIKECGTNECLDNNGGCSHVCN 309

Query: 393 PTPRGAMCFCPAG-QNPNKTQCVDADECLIDGSCDQTCTNTHLSYVCSCTEGYTLRPDGK 451
               G  C CP G Q   + +C D DEC    +C Q C N    Y C C EG+ L P  K
Sbjct: 310 DLKIGYECLCPDGFQLVAQRRCEDIDECQDPDTCSQLCVNLEGGYKCQCEEGFQLDPHTK 369

Query: 452 SCTA 455
           +C A
Sbjct: 370 ACKA 373


>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 Back     alignment and structure
>2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B Length = 80 Back     alignment and structure
>2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B Length = 80 Back     alignment and structure
>2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B Length = 80 Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 Back     alignment and structure
>2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B Length = 82 Back     alignment and structure
>2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B Length = 82 Back     alignment and structure
>2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B Length = 82 Back     alignment and structure
>2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B Length = 82 Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Length = 267 Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Length = 267 Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Length = 267 Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Length = 267 Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Length = 267 Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Length = 87 Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Length = 87 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 Back     alignment and structure
>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Length = 565 Back     alignment and structure
>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Length = 565 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Length = 118 Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86 Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Length = 318 Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Length = 318 Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Length = 318 Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Length = 318 Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>1d2l_A Lipoprotein receptor related protein; ligand binding, calcium binding, complement-like repeat, signaling protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 45 Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Length = 316 Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Length = 316 Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Length = 316 Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Length = 316 Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Length = 53 Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Length = 628 Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Length = 628 Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Length = 628 Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Length = 628 Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Length = 628 Back     alignment and structure
>1ajj_A LR5, low-density lipoprotein receptor; LDL receptor, cysteine-rich module, calcium; 1.70A {Homo sapiens} SCOP: g.12.1.1 Length = 37 Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} Length = 619 Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} Length = 619 Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} Length = 619 Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} Length = 619 Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} Length = 619 Back     alignment and structure
>3a7q_B Low-density lipoprotein receptor-related protein; signaling protein; HET: NAG; 2.60A {Homo sapiens} Length = 44 Back     alignment and structure
>2kny_A LRP-1, linker, APO-E; lipoprotein receptor, ligand binding module, COMP repeat, calcium, cell membrane, coated PIT, cytoplasm, DEVE protein; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2kny_A LRP-1, linker, APO-E; lipoprotein receptor, ligand binding module, COMP repeat, calcium, cell membrane, coated PIT, cytoplasm, DEVE protein; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2kny_A LRP-1, linker, APO-E; lipoprotein receptor, ligand binding module, COMP repeat, calcium, cell membrane, coated PIT, cytoplasm, DEVE protein; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2kny_A LRP-1, linker, APO-E; lipoprotein receptor, ligand binding module, COMP repeat, calcium, cell membrane, coated PIT, cytoplasm, DEVE protein; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2gtl_O Extracellular hemoglobin linker L3 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 215 Back     alignment and structure
>2gtl_O Extracellular hemoglobin linker L3 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 215 Back     alignment and structure
>2gtl_O Extracellular hemoglobin linker L3 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 215 Back     alignment and structure
>1j8e_A Low-density lipoprotein receptor-related protein 1; ligand binding, calcium binding, complement-like repeat, LRP receptor, signaling protein; 1.85A {Homo sapiens} SCOP: g.12.1.1 Length = 44 Back     alignment and structure
>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Length = 55 Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 Back     alignment and structure
>2i1p_A Low-density lipoprotein receptor-related protein 2; cysteine-rich repeat, ligand binding domain, calcium CAGE, ligand binding protein; NMR {Rattus norvegicus} Length = 48 Back     alignment and structure
>2i1p_A Low-density lipoprotein receptor-related protein 2; cysteine-rich repeat, ligand binding domain, calcium CAGE, ligand binding protein; NMR {Rattus norvegicus} Length = 48 Back     alignment and structure
>2i1p_A Low-density lipoprotein receptor-related protein 2; cysteine-rich repeat, ligand binding domain, calcium CAGE, ligand binding protein; NMR {Rattus norvegicus} Length = 48 Back     alignment and structure
>3dpr_E LDL-receptor class A 3; human rhinovirus, VLDL-receptor, virus-protein complex, icosahedral virus, ATP-binding, capsid protein; HET: DAO; 3.50A {Homo sapiens} PDB: 1v9u_5* Length = 39 Back     alignment and structure
>3dpr_E LDL-receptor class A 3; human rhinovirus, VLDL-receptor, virus-protein complex, icosahedral virus, ATP-binding, capsid protein; HET: DAO; 3.50A {Homo sapiens} PDB: 1v9u_5* Length = 39 Back     alignment and structure
>3dpr_E LDL-receptor class A 3; human rhinovirus, VLDL-receptor, virus-protein complex, icosahedral virus, ATP-binding, capsid protein; HET: DAO; 3.50A {Homo sapiens} PDB: 1v9u_5* Length = 39 Back     alignment and structure
>1cr8_A Protein (LOW density lipoprotein receptor related protein); ligand binding, calcium binding, LDLR, LRP, lipid binding protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 42 Back     alignment and structure
>1cr8_A Protein (LOW density lipoprotein receptor related protein); ligand binding, calcium binding, LDLR, LRP, lipid binding protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 42 Back     alignment and structure
>1cr8_A Protein (LOW density lipoprotein receptor related protein); ligand binding, calcium binding, LDLR, LRP, lipid binding protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 42 Back     alignment and structure
>1jrf_A TVA LDL-A module, subgroup A ROUS sarcoma virus receptors PG800 and PG950; disulfide bond, alpha helix, calcium CAGE, signaling protein; NMR {Coturnix japonica} SCOP: g.12.1.1 Length = 47 Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Length = 349 Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Length = 349 Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Length = 349 Back     alignment and structure
>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 Length = 51 Back     alignment and structure
>2knx_A Prolow-density lipoprotein receptor-related prote; LDLR, ligand binding module, ligand binding repeat, compleme repeat, protein binding; NMR {Homo sapiens} Length = 50 Back     alignment and structure
>2knx_A Prolow-density lipoprotein receptor-related prote; LDLR, ligand binding module, ligand binding repeat, compleme repeat, protein binding; NMR {Homo sapiens} Length = 50 Back     alignment and structure
>2knx_A Prolow-density lipoprotein receptor-related prote; LDLR, ligand binding module, ligand binding repeat, compleme repeat, protein binding; NMR {Homo sapiens} Length = 50 Back     alignment and structure
>1k7b_A Subgroup A ROUS sarcoma virus receptor PG800 and PG950; beta hairpin, 3-10 helix, calcium binding, membrane protein; NMR {Coturnix coturnix} SCOP: g.12.1.1 Length = 47 Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 Back     alignment and structure
>1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* Length = 69 Back     alignment and structure
>2jm4_A Relaxin receptor 1; LDL-A module, RXFP1 receptor, LGR7, signaling protein; NMR {Homo sapiens} Length = 43 Back     alignment and structure
>2jm4_A Relaxin receptor 1; LDL-A module, RXFP1 receptor, LGR7, signaling protein; NMR {Homo sapiens} Length = 43 Back     alignment and structure
>2jm4_A Relaxin receptor 1; LDL-A module, RXFP1 receptor, LGR7, signaling protein; NMR {Homo sapiens} Length = 43 Back     alignment and structure
>2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* Length = 59 Back     alignment and structure
>2gtl_N Extracellular hemoglobin linker L2 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 220 Back     alignment and structure
>2gtl_N Extracellular hemoglobin linker L2 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 220 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 Back     alignment and structure
>3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} Length = 283 Back     alignment and structure
>2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* Length = 53 Back     alignment and structure
>1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Length = 159 Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Length = 302 Back     alignment and structure
>2gtl_M Hemoglobin linker chain L1; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 217 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Length = 186 Back     alignment and structure
>1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Length = 170 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query482
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 100.0
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 100.0
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 100.0
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 100.0
2fyj_A82 Low-density lipoprotein receptor-related protein 1 99.79
2fcw_B80 LDL receptor, low-density lipoprotein receptor; pr 99.76
2fyj_A82 Low-density lipoprotein receptor-related protein 1 99.76
2fcw_B80 LDL receptor, low-density lipoprotein receptor; pr 99.74
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 99.43
3v65_B 386 Low-density lipoprotein receptor-related protein; 99.39
2xrc_A565 Human complement factor I; immune system, hydrolas 99.27
2gtl_O215 Extracellular hemoglobin linker L3 subunit; anneli 99.25
2gtl_O215 Extracellular hemoglobin linker L3 subunit; anneli 99.25
2xrc_A565 Human complement factor I; immune system, hydrolas 99.2
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 99.19
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 99.13
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 99.12
2bou_A143 EGF-like module containing mucin-like hormone rece 99.12
2kny_A80 LRP-1, linker, APO-E; lipoprotein receptor, ligand 99.09
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 99.07
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 99.06
1d2l_A45 Lipoprotein receptor related protein; ligand bindi 99.04
1ajj_A37 LR5, low-density lipoprotein receptor; LDL recepto 99.03
1cr8_A42 Protein (LOW density lipoprotein receptor related 99.03
2jm4_A43 Relaxin receptor 1; LDL-A module, RXFP1 receptor, 99.02
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 99.0
2m0p_A52 Low-density lipoprotein receptor-related protein; 98.99
3a7q_B44 Low-density lipoprotein receptor-related protein; 98.99
1aut_L114 Activated protein C; serine proteinase, plasma cal 98.97
2knx_A50 Prolow-density lipoprotein receptor-related prote; 98.95
1k7b_A47 Subgroup A ROUS sarcoma virus receptor PG800 and P 98.95
1j8e_A44 Low-density lipoprotein receptor-related protein 1 98.93
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 98.92
1cr8_A42 Protein (LOW density lipoprotein receptor related 98.91
3dpr_E39 LDL-receptor class A 3; human rhinovirus, VLDL-rec 98.9
1jrf_A47 TVA LDL-A module, subgroup A ROUS sarcoma virus re 98.89
2vh0_B134 Activated factor XA light chain; serine protease, 98.88
1ajj_A37 LR5, low-density lipoprotein receptor; LDL recepto 98.87
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 98.87
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 98.86
2i1p_A48 Low-density lipoprotein receptor-related protein 2 98.86
2i1p_A48 Low-density lipoprotein receptor-related protein 2 98.86
2kny_A80 LRP-1, linker, APO-E; lipoprotein receptor, ligand 98.85
3dpr_E39 LDL-receptor class A 3; human rhinovirus, VLDL-rec 98.82
1d2l_A45 Lipoprotein receptor related protein; ligand bindi 98.82
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 98.81
2knx_A50 Prolow-density lipoprotein receptor-related prote; 98.81
2jm4_A43 Relaxin receptor 1; LDL-A module, RXFP1 receptor, 98.8
3a7q_B44 Low-density lipoprotein receptor-related protein; 98.8
2m0p_A52 Low-density lipoprotein receptor-related protein; 98.78
3h5c_B 317 Vitamin K-dependent protein Z; protein Z-protein Z 98.73
1k7b_A47 Subgroup A ROUS sarcoma virus receptor PG800 and P 98.72
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 98.7
1kli_L69 Factor VIIA; extrinsic coagulation pathway, serine 98.68
2jkh_L55 Factor X light chain; plasma, calcium, zymogen, se 98.68
1j8e_A44 Low-density lipoprotein receptor-related protein 1 98.63
3v64_C 349 Agrin; beta propeller, laminin-G, signaling, prote 98.6
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 98.59
1jrf_A47 TVA LDL-A module, subgroup A ROUS sarcoma virus re 98.59
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 98.58
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 98.55
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 98.55
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 98.54
1kig_L51 Factor XA; glycoprotein, serine protease, plasma, 98.49
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 98.49
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 98.47
2bz6_L53 Blood coagulation factor VIIA; serine protease, en 98.46
2gtl_N220 Extracellular hemoglobin linker L2 subunit; anneli 98.37
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 98.33
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 98.25
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 98.23
2gtl_M217 Hemoglobin linker chain L1; annelid erythrocruorin 98.23
2gtl_N220 Extracellular hemoglobin linker L2 subunit; anneli 98.2
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 98.19
2bou_A143 EGF-like module containing mucin-like hormone rece 98.17
2wph_E59 Coagulation factor IXA light chain; serine proteas 98.13
2gtl_M217 Hemoglobin linker chain L1; annelid erythrocruorin 98.07
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 98.01
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 97.9
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 97.83
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 97.79
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 97.76
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 97.76
3ojy_B 537 Complement component C8 beta chain; macpf, lipocal 97.63
3ojy_B 537 Complement component C8 beta chain; macpf, lipocal 97.62
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 97.61
2jkh_L55 Factor X light chain; plasma, calcium, zymogen, se 97.56
3ojy_A 554 Complement component C8 alpha chain; macpf, lipoca 97.54
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 97.52
2wph_E59 Coagulation factor IXA light chain; serine proteas 97.45
1kig_L51 Factor XA; glycoprotein, serine protease, plasma, 97.45
3ojy_A 554 Complement component C8 alpha chain; macpf, lipoca 97.39
3s94_A 619 LRP-6, low-density lipoprotein receptor-related pr 97.32
1kli_L69 Factor VIIA; extrinsic coagulation pathway, serine 97.28
1szb_A170 Mannose binding lectin-associated serine protease- 97.19
2bz6_L53 Blood coagulation factor VIIA; serine protease, en 97.15
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 97.15
3v65_B 386 Low-density lipoprotein receptor-related protein; 97.12
3h5c_B 317 Vitamin K-dependent protein Z; protein Z-protein Z 97.11
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 97.09
1aut_L114 Activated protein C; serine proteinase, plasma cal 97.07
3f1s_B 283 Vitamin K-dependent protein Z; PZ, ZPI, complex, s 97.04
2kl7_A71 Fibulin-4; secreted, calcium, disease mutation, di 97.0
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 96.99
2vh0_B134 Activated factor XA light chain; serine protease, 96.85
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 96.85
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 96.8
1nzi_A159 Complement C1S component; calcium, innate immunity 96.6
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 96.31
3t5o_A 913 Complement component C6; macpf, MAC, membrane atta 96.19
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 96.07
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 96.04
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 95.82
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 95.67
2k2s_B61 Micronemal protein 6; microneme protein complex, c 95.53
1gl4_A 285 Nidogen-1, entactin; immunoglobulin-like domain, e 95.48
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 95.47
3t5o_A 913 Complement component C6; macpf, MAC, membrane atta 95.47
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 95.29
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 94.87
4fbr_A 267 Lectin, myxobacterial hemagglutinin; beta-barrel, 94.64
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 94.43
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 94.16
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 93.97
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 93.76
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 93.17
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 93.17
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 92.94
2k2s_B61 Micronemal protein 6; microneme protein complex, c 92.9
3v64_C 349 Agrin; beta propeller, laminin-G, signaling, prote 91.77
1a3p_A45 Epidermal growth factor; disulfide connectivities, 91.5
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 91.41
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 90.88
3f1s_B 283 Vitamin K-dependent protein Z; PZ, ZPI, complex, s 90.87
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 90.8
1a3p_A45 Epidermal growth factor; disulfide connectivities, 90.32
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 90.24
2gy5_A 423 Angiopoietin-1 receptor; ligand-binding domain, tr 90.21
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 89.69
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 89.46
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 88.56
1szb_A170 Mannose binding lectin-associated serine protease- 87.9
2kl7_A71 Fibulin-4; secreted, calcium, disease mutation, di 87.85
1gl4_A 285 Nidogen-1, entactin; immunoglobulin-like domain, e 87.44
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 87.4
1n1i_A105 Merozoite surface protein-1; MSP1, malaria, surfac 87.25
3ca7_A52 Protein spitz; argos, EGF, developmental protein, 86.66
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 85.42
1ob1_C99 Major merozoite surface protein; immune system, im 83.77
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 83.07
1nzi_A159 Complement C1S component; calcium, innate immunity 80.37
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 80.27
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
Probab=100.00  E-value=2.4e-65  Score=567.09  Aligned_cols=371  Identities=33%  Similarity=0.729  Sum_probs=292.5

Q ss_pred             cccCCCCeeeCCCCCeecCccccCCCCCCCCCCCCCCCCccc--ccccceeccCcccccceeccCCCceeeecccccccc
Q psy14262          3 HQCFNGQVQCALSKKCIPHNWLCDEEMDCSTDDIVDNTDEDW--DKYFKRILNGTHTLALEFNHRNQSLCFIQQQNVSSV   80 (482)
Q Consensus         3 ~~C~~~~f~C~~~~~Ci~~~~~CDg~~dC~~~~~~d~sDE~~--~~~~~~~~~~~~~~~~~~~c~~~~~c~~~~~~~~~~   80 (482)
                      +.|.++||+|. ||+|||..|+|||++||+     |+|||..  |...                                
T Consensus         4 ~~C~~~~f~C~-~g~ci~~~~~Cdg~~dC~-----d~sDE~~~~C~~~--------------------------------   45 (699)
T 1n7d_A            4 DRCERNEFQCQ-DGKCISYKWVCDGSAECQ-----DGSDESQETCLSV--------------------------------   45 (699)
T ss_dssp             ----------------------------------------------CC--------------------------------
T ss_pred             CCCCccceeCC-CCcEEcHHhcCCCcccCC-----CCCCCCccccCCc--------------------------------
Confidence            57999999998 899999999999999998     9999975  3110                                


Q ss_pred             cccccccccCCCCCCCCCCCCCChhhhhhhccCCCCCCcceeeCC---ceecCceeeCCCCCCCcccCCCCCCccccccC
Q psy14262         81 RLRCAQINDLLNSWDLPAPEIFPLDERLEKAGMHGENRSPLVTKN---IQWPSSLVIDYNQDILYWCDSHLNTVESVRVD  157 (482)
Q Consensus        81 ~~~c~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~ci~~~~~cdg~~dc~dw~d~~~~sdE~~~~~  157 (482)
                        .|                                ....|.|.+   +|||..|+|||..||.|      ||||.    
T Consensus        46 --~C--------------------------------~~~~f~C~~~~~~Ci~~~~~Cdg~~dC~d------gsDE~----   81 (699)
T 1n7d_A           46 --TC--------------------------------KSGDFSCGGRVNRCIPQFWRCDGQVDCDN------GSDEQ----   81 (699)
T ss_dssp             --SC--------------------------------SSSSCCCCC--CCCCCSSSTTSSSCCC-C------CCTTT----
T ss_pred             --CC--------------------------------CCCccCCCCCCCceeCcceecCCcccCCC------CcccC----
Confidence              01                                001244433   79999999999999999      99998    


Q ss_pred             CCCCCccCCCCCeecCCCCceecCCcccCCCCCCCCCCCCCCCCC-CCCCCCceecCCCCeeccCCCCCCCcCCCCCCCC
Q psy14262        158 GSHNAVLCHPNELRCGSSNQCVALSKFCDGKPDCSNGEDEGPFCN-AECTPGQFSCGMGKCIPESWKCDGFVDCLEDGSD  236 (482)
Q Consensus       158 ~~c~~~~C~~~~f~C~~~~~Ci~~~~~CDg~~dC~dgsDE~~~C~-~~C~~~~f~C~~g~Ci~~~~~CDg~~dC~~dgsD  236 (482)
                       +|...+|.+.+|+|.++ +||+.+|+|||..||.|||||.+ |. ..|.+.+|+|.+|+||+..|+|||..|| .||||
T Consensus        82 -~C~~~~C~~~~f~C~~g-~Ci~~~~~Cdg~~dC~dgsDE~~-C~~~~C~~~~f~C~~~~Ci~~~~~Cdg~~dC-~dgsD  157 (699)
T 1n7d_A           82 -GCPPKTCSQDEFRCHDG-KCISRQFVCDSDRDCLDGSDEAS-CPVLTCGPASFQCNSSTCIPQLWACDNDPDC-EDGSD  157 (699)
T ss_dssp             -SCSSCCCCSSCCCSSCC-----CCCTTCSSCCSSSSCSSSS-CCCCCCCSSCCCCSSSCCCCTTSTTCSSCCS-SSSSS
T ss_pred             -cccccccccCcEEcCCC-CEecHHHcCCCcCcCCCCCccCC-cCccccCccccCCCCCcccchhcccCCCCcC-CCCcc
Confidence             89888899999999987 89999999999999999999998 97 5799999999999999999999999999 99999


Q ss_pred             C--CCccc--------ccccCCccccCCCCceecCCCccCccCCCCCCCCCCCCCCCCCCCccccCcccccCCCCccCCC
Q psy14262        237 E--PNTCI--------HQCFNGQVQCALSKKCIPHNWLCDEEMDCSTDDIVDNTDEDWDKFHQCFNGQVQCALSKKCIPH  306 (482)
Q Consensus       237 E--~~C~~--------~~C~~~~f~C~~~g~Ci~~~~~CDg~~dC~~~~~~dgsDE~~C~~~~C~~~~f~C~~g~~Ci~~  306 (482)
                      |  .+|..        ..|...+|+|. +|.||+..|+|||..||.     ||+||.+|....|.+.+|+|.++ +||+.
T Consensus       158 E~~~~C~~~~~~~~~~~~C~~~~f~C~-~g~Ci~~~~~CDg~~dC~-----dgsDE~~C~~~~C~~~~f~C~~g-~Ci~~  230 (699)
T 1n7d_A          158 EWPQRCRGLYVFQGDSSPCSAFEFHCL-SGECIHSSWRCDGGPDCK-----DKSDEENCAVATCRPDEFQCSDG-NCIHG  230 (699)
T ss_dssp             SSCSSSSCCCCCSSCCCCSCSSSCCCS-SSCCCSTTCTTSSSCCST-----TSCSSCSCCCCCCCSSEEESSSS-CEEET
T ss_pred             cccccCCCcccccCCCCCCCCcceecC-CCceEechhccCCCCCCC-----CCcccccCCCcccCCCcEecCCC-ceeee
Confidence            9  88953        46999999999 889999999999999999     99999999878899999999976 99999


Q ss_pred             CCCCCCCCCCCCCCcCCCCCCCcCCcCccCcccc-cCCCcccCCCCcccccccccCCCCCCCCCCCCCC-CCCCCCCcc-
Q psy14262        307 NWLCDEEMDCSTDDIVDNTDEDWDKYFSHNAVLC-HPNELRCGSSNQCVALSKFCDGKPDCSNGEDEGP-FCNNKADCE-  383 (482)
Q Consensus       307 ~~~CDg~~DC~~g~~~dgsDE~~~~~C~~~~~~C-~~~~f~C~~g~~Ci~~~~~CDg~~dC~dgsDE~~-~C~~~~~C~-  383 (482)
                      +|+|||+.||.     ||+||.+   |.. ...| .+.+|+|.++ .||+..++||+..+|.+|+||.. .|.++ +|. 
T Consensus       231 ~~~Cdg~~dC~-----dgsde~~---C~~-~~~C~~~~~~~C~~g-~Ci~~~~~Cd~~~dC~dgsDe~~~~C~~~-eC~~  299 (699)
T 1n7d_A          231 SRQCDREYDCK-----DMSDEVG---CVN-VTLCEGPNKFKCHSG-ECITLDKVCNMARDCRDWSDEPIKECGTN-ECLD  299 (699)
T ss_dssp             TCCSSSCCCSS-----SSCSSSS---TTC-CCCCCSTTCCCCTTS-CCCCSSCCSCSSCCSSSSCSCCCSSCCCC-CTTS
T ss_pred             ecccCCCCCCC-----CCCccCC---CCC-CCcccCCCceecCCC-cEeCCcccccccceecCcccccccccccc-cccc
Confidence            99999999999     9999998   865 3467 4778999997 99999999999999999999974 37777 897 


Q ss_pred             -CCCCcCCCCCCCCCccccCCCCc-cCCCCCccccccccCCCCCCceeeecCCceEEecCCCeEECCCCCccccCCCCCC
Q psy14262        384 -NLKCSHKCSPTPRGAMCFCPAGQ-NPNKTQCVDADECLIDGSCDQTCTNTHLSYVCSCTEGYTLRPDGKSCTAVNVPQD  461 (482)
Q Consensus       384 -~~~C~~~C~~~~~~~~C~C~~G~-~~~~~~C~di~eC~~~~~Cs~~C~n~~gsy~C~C~~Gy~l~~d~~tC~didec~~  461 (482)
                       +++|+++|.+++++|+|.|++|| ..++++|++++||..+++|+++|+|++|+|+|.|++||++..++++|++++   .
T Consensus       300 ~~~~C~~~C~~~~~~~~C~C~~G~~~~~~~~C~dideC~~~~~C~~~C~n~~g~y~C~C~~G~~~~~~~~~C~~~~---~  376 (699)
T 1n7d_A          300 NNGGCSHVCNDLKIGYECLCPDGFQLVAQRRCEDIDECQDPDTCSQLCVNLEGGYKCQCEEGFQLDPHTKACKAVG---S  376 (699)
T ss_dssp             STTTSCTTCCCCTTCCCCCCCSSSCCCSSSCCCCCCCCSSSSSCTTTCCBCSSCBCCCCCSSCBCCSSCCCCBCCS---S
T ss_pred             cccCcCCCcccCCCCcEEeCCCCeEcCCCCcccCccccCCCCccccccccCCCCeeeeeecccccCCCCCcccccc---c
Confidence             46799999999999999999999 556889999999986788999999999999999999999999999999886   4


Q ss_pred             CCcEEEeccCCceEEEeccC
Q psy14262        462 EPASIIFSSTVDIRRIHLNG  481 (482)
Q Consensus       462 ~p~~l~~~~~~~ir~~~l~~  481 (482)
                      .+ +|||+++++|++|.|.+
T Consensus       377 ~~-~ll~~~~~~I~~id~~~  395 (699)
T 1n7d_A          377 IA-YLFFTNRHEVRKMTLDR  395 (699)
T ss_dssp             CC-CBCCCCTTC-CEECTTS
T ss_pred             ce-eEEecCccceEEEeCCC
Confidence            56 99999999999999865



>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B Back     alignment and structure
>2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B Back     alignment and structure
>2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B Back     alignment and structure
>2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Back     alignment and structure
>2gtl_O Extracellular hemoglobin linker L3 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Back     alignment and structure
>2gtl_O Extracellular hemoglobin linker L3 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Back     alignment and structure
>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>2kny_A LRP-1, linker, APO-E; lipoprotein receptor, ligand binding module, COMP repeat, calcium, cell membrane, coated PIT, cytoplasm, DEVE protein; NMR {Homo sapiens} Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>1d2l_A Lipoprotein receptor related protein; ligand binding, calcium binding, complement-like repeat, signaling protein; NMR {Homo sapiens} SCOP: g.12.1.1 Back     alignment and structure
>1ajj_A LR5, low-density lipoprotein receptor; LDL receptor, cysteine-rich module, calcium; 1.70A {Homo sapiens} SCOP: g.12.1.1 Back     alignment and structure
>1cr8_A Protein (LOW density lipoprotein receptor related protein); ligand binding, calcium binding, LDLR, LRP, lipid binding protein; NMR {Homo sapiens} SCOP: g.12.1.1 Back     alignment and structure
>2jm4_A Relaxin receptor 1; LDL-A module, RXFP1 receptor, LGR7, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>2m0p_A Low-density lipoprotein receptor-related protein; complement type repeat, megalin, LDL receptor FAMI lipid binding protein; NMR {Homo sapiens} Back     alignment and structure
>3a7q_B Low-density lipoprotein receptor-related protein; signaling protein; HET: NAG; 2.60A {Homo sapiens} Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>2knx_A Prolow-density lipoprotein receptor-related prote; LDLR, ligand binding module, ligand binding repeat, compleme repeat, protein binding; NMR {Homo sapiens} Back     alignment and structure
>1k7b_A Subgroup A ROUS sarcoma virus receptor PG800 and PG950; beta hairpin, 3-10 helix, calcium binding, membrane protein; NMR {Coturnix coturnix} SCOP: g.12.1.1 Back     alignment and structure
>1j8e_A Low-density lipoprotein receptor-related protein 1; ligand binding, calcium binding, complement-like repeat, LRP receptor, signaling protein; 1.85A {Homo sapiens} SCOP: g.12.1.1 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>1cr8_A Protein (LOW density lipoprotein receptor related protein); ligand binding, calcium binding, LDLR, LRP, lipid binding protein; NMR {Homo sapiens} SCOP: g.12.1.1 Back     alignment and structure
>3dpr_E LDL-receptor class A 3; human rhinovirus, VLDL-receptor, virus-protein complex, icosahedral virus, ATP-binding, capsid protein; HET: DAO; 3.50A {Homo sapiens} PDB: 1v9u_5* Back     alignment and structure
>1jrf_A TVA LDL-A module, subgroup A ROUS sarcoma virus receptors PG800 and PG950; disulfide bond, alpha helix, calcium CAGE, signaling protein; NMR {Coturnix japonica} SCOP: g.12.1.1 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>1ajj_A LR5, low-density lipoprotein receptor; LDL receptor, cysteine-rich module, calcium; 1.70A {Homo sapiens} SCOP: g.12.1.1 Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>2i1p_A Low-density lipoprotein receptor-related protein 2; cysteine-rich repeat, ligand binding domain, calcium CAGE, ligand binding protein; NMR {Rattus norvegicus} Back     alignment and structure
>2i1p_A Low-density lipoprotein receptor-related protein 2; cysteine-rich repeat, ligand binding domain, calcium CAGE, ligand binding protein; NMR {Rattus norvegicus} Back     alignment and structure
>2kny_A LRP-1, linker, APO-E; lipoprotein receptor, ligand binding module, COMP repeat, calcium, cell membrane, coated PIT, cytoplasm, DEVE protein; NMR {Homo sapiens} Back     alignment and structure
>3dpr_E LDL-receptor class A 3; human rhinovirus, VLDL-receptor, virus-protein complex, icosahedral virus, ATP-binding, capsid protein; HET: DAO; 3.50A {Homo sapiens} PDB: 1v9u_5* Back     alignment and structure
>1d2l_A Lipoprotein receptor related protein; ligand binding, calcium binding, complement-like repeat, signaling protein; NMR {Homo sapiens} SCOP: g.12.1.1 Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>2knx_A Prolow-density lipoprotein receptor-related prote; LDLR, ligand binding module, ligand binding repeat, compleme repeat, protein binding; NMR {Homo sapiens} Back     alignment and structure
>2jm4_A Relaxin receptor 1; LDL-A module, RXFP1 receptor, LGR7, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>3a7q_B Low-density lipoprotein receptor-related protein; signaling protein; HET: NAG; 2.60A {Homo sapiens} Back     alignment and structure
>2m0p_A Low-density lipoprotein receptor-related protein; complement type repeat, megalin, LDL receptor FAMI lipid binding protein; NMR {Homo sapiens} Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>1k7b_A Subgroup A ROUS sarcoma virus receptor PG800 and PG950; beta hairpin, 3-10 helix, calcium binding, membrane protein; NMR {Coturnix coturnix} SCOP: g.12.1.1 Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* Back     alignment and structure
>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Back     alignment and structure
>1j8e_A Low-density lipoprotein receptor-related protein 1; ligand binding, calcium binding, complement-like repeat, LRP receptor, signaling protein; 1.85A {Homo sapiens} SCOP: g.12.1.1 Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>1jrf_A TVA LDL-A module, subgroup A ROUS sarcoma virus receptors PG800 and PG950; disulfide bond, alpha helix, calcium CAGE, signaling protein; NMR {Coturnix japonica} SCOP: g.12.1.1 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* Back     alignment and structure
>2gtl_N Extracellular hemoglobin linker L2 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>2gtl_M Hemoglobin linker chain L1; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Back     alignment and structure
>2gtl_N Extracellular hemoglobin linker L2 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* Back     alignment and structure
>2gtl_M Hemoglobin linker chain L1; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>3ojy_B Complement component C8 beta chain; macpf, lipocalin, immune system; HET: TPO BMA; 2.51A {Homo sapiens} Back     alignment and structure
>3ojy_B Complement component C8 beta chain; macpf, lipocalin, immune system; HET: TPO BMA; 2.51A {Homo sapiens} Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Back     alignment and structure
>3ojy_A Complement component C8 alpha chain; macpf, lipocalin, immune system; HET: TPO BMA; 2.51A {Homo sapiens} Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* Back     alignment and structure
>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 Back     alignment and structure
>3ojy_A Complement component C8 alpha chain; macpf, lipocalin, immune system; HET: TPO BMA; 2.51A {Homo sapiens} Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* Back     alignment and structure
>1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} Back     alignment and structure
>2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Back     alignment and structure
>3t5o_A Complement component C6; macpf, MAC, membrane attack complex, innate IMMU system, blood, membrane, cytolysin, immune SYST; HET: NAG FUL FUC BGC MAN; 2.87A {Homo sapiens} PDB: 4a5w_B* 4e0s_B* Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure
>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3t5o_A Complement component C6; macpf, MAC, membrane attack complex, innate IMMU system, blood, membrane, cytolysin, immune SYST; HET: NAG FUL FUC BGC MAN; 2.87A {Homo sapiens} PDB: 4a5w_B* 4e0s_B* Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Back     alignment and structure
>1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>1n1i_A Merozoite surface protein-1; MSP1, malaria, surface antigen, glycoprotein, EGF domain, cell adhesion; HET: HIS; 2.40A {Plasmodium knowlesi strain H} SCOP: g.3.11.4 g.3.11.4 Back     alignment and structure
>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Back     alignment and structure
>1ob1_C Major merozoite surface protein; immune system, immunoglobulin/complex, immunoglobulin, antib fragment, MSP1-19, EGF-like domain; 2.90A {Plasmodium falciparum} SCOP: g.3.11.4 g.3.11.4 PDB: 1cej_A 2flg_A Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 482
d1i0ua241 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) r 7e-10
d1apqa_53 g.3.11.1 (A:) Complement protease C1R {Human (Homo 6e-08
d1d2la_45 g.12.1.1 (A:) Ligand-binding domain of low-density 8e-08
d1d2la_45 g.12.1.1 (A:) Ligand-binding domain of low-density 8e-04
d1d2la_45 g.12.1.1 (A:) Ligand-binding domain of low-density 8e-04
d1nt0a345 g.3.11.1 (A:120-164) Mannose-binding protein assoc 1e-07
d1f8za_39 g.12.1.1 (A:) Ligand-binding domain of low-density 2e-07
d1f8za_39 g.12.1.1 (A:) Ligand-binding domain of low-density 0.001
d1f8za_39 g.12.1.1 (A:) Ligand-binding domain of low-density 0.001
d1j8ea_44 g.12.1.1 (A:) Ligand-binding domain of low-density 2e-07
d1j8ea_44 g.12.1.1 (A:) Ligand-binding domain of low-density 0.002
d1j8ea_44 g.12.1.1 (A:) Ligand-binding domain of low-density 0.002
d2fcwb139 g.12.1.1 (B:86-124) Ligand-binding domain of low-d 2e-07
d2fcwb139 g.12.1.1 (B:86-124) Ligand-binding domain of low-d 9e-04
d2fcwb139 g.12.1.1 (B:86-124) Ligand-binding domain of low-d 9e-04
d1nzia242 g.3.11.1 (A:118-159) Complement C1S component {Hum 2e-07
d2p3ua151 g.3.11.1 (A:87-137) Factor X, N-terminal module {H 4e-07
d1f5ya144 g.12.1.1 (A:1-44) Ligand-binding domain of low-den 4e-07
d1f5ya144 g.12.1.1 (A:1-44) Ligand-binding domain of low-den 0.003
d1f5ya144 g.12.1.1 (A:1-44) Ligand-binding domain of low-den 0.003
d2fcwb239 g.12.1.1 (B:125-163) Ligand-binding domain of low- 5e-07
d2fcwb239 g.12.1.1 (B:125-163) Ligand-binding domain of low- 8e-04
d2fcwb239 g.12.1.1 (B:125-163) Ligand-binding domain of low- 8e-04
d1ajja_37 g.12.1.1 (A:) Ligand-binding domain of low-density 5e-07
d1ajja_37 g.12.1.1 (A:) Ligand-binding domain of low-density 0.002
d1ajja_37 g.12.1.1 (A:) Ligand-binding domain of low-density 0.002
d1szba245 g.3.11.1 (A:124-168) Mannose-binding protein assoc 6e-07
d1kigl_51 g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bo 7e-07
d1autl250 g.3.11.1 (L:97-146) Activated protein c (autoproth 2e-06
d1xfea244 g.12.1.1 (A:1-44) Ligand-binding domain of low-den 2e-06
d1uzka243 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sa 2e-06
d1npea_263 b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId 3e-06
d1f5ya241 g.12.1.1 (A:45-85) Ligand-binding domain of low-de 4e-06
d1f5ya241 g.12.1.1 (A:45-85) Ligand-binding domain of low-de 0.001
d1f5ya241 g.12.1.1 (A:45-85) Ligand-binding domain of low-de 0.001
d1uzka143 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sa 4e-06
d1lmja242 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapien 8e-06
d1dx5i340 g.3.11.1 (I:423-462) Thrombomodulin, different EGF 1e-05
d2gtlo241 g.12.1.1 (O:60-100) Extracellular hemoglobin linke 1e-05
d2gtlo241 g.12.1.1 (O:60-100) Extracellular hemoglobin linke 0.001
d2gtlo241 g.12.1.1 (O:60-100) Extracellular hemoglobin linke 0.001
d1cr8a_42 g.12.1.1 (A:) Ligand-binding domain of low-density 1e-05
d1cr8a_42 g.12.1.1 (A:) Ligand-binding domain of low-density 3e-05
d1cr8a_42 g.12.1.1 (A:) Ligand-binding domain of low-density 3e-05
d1v9u5_39 g.12.1.1 (5:) Very low-density lipoprotein recepto 1e-05
d1v9u5_39 g.12.1.1 (5:) Very low-density lipoprotein recepto 0.003
d1v9u5_39 g.12.1.1 (5:) Very low-density lipoprotein recepto 0.003
d3bpse140 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) 2e-05
d2bz6l153 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human 2e-05
d1ijqa1266 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) 3e-05
d1k7ba_42 g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quai 3e-05
d1rfnb_57 g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens 4e-05
d1emoa143 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sa 4e-05
d2gtlm242 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Co 5e-05
d2gtlm242 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Co 0.002
d2gtlm242 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Co 0.002
d2gtln241 g.12.1.1 (N:61-101) Extracellular hemoglobin linke 8e-05
d2gtln241 g.12.1.1 (N:61-101) Extracellular hemoglobin linke 0.003
d2gtln241 g.12.1.1 (N:61-101) Extracellular hemoglobin linke 0.003
d1ijqa250 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) 8e-04
d1lmja144 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens 0.003
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure

class: Small proteins
fold: Knottins (small inhibitors, toxins, lectins)
superfamily: EGF/Laminin
family: EGF-type module
domain: Low density lipoprotein (LDL) receptor, different EGF domains
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 52.1 bits (125), Expect = 7e-10
 Identities = 18/40 (45%), Positives = 21/40 (52%)

Query: 417 DECLIDGSCDQTCTNTHLSYVCSCTEGYTLRPDGKSCTAV 456
           DEC    +C Q C N    Y C C EG+ L P  K+C AV
Sbjct: 2   DECQDPDTCSQLCVNLEGGYKCQCEEGFQLDPHTKACKAV 41


>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1d2la_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 45 Back     information, alignment and structure
>d1d2la_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 45 Back     information, alignment and structure
>d1d2la_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 45 Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 45 Back     information, alignment and structure
>d1f8za_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1f8za_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1f8za_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 51 Back     information, alignment and structure
>d1f5ya1 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1f5ya1 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1f5ya1 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d2fcwb2 g.12.1.1 (B:125-163) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2fcwb2 g.12.1.1 (B:125-163) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2fcwb2 g.12.1.1 (B:125-163) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1ajja_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 37 Back     information, alignment and structure
>d1ajja_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 37 Back     information, alignment and structure
>d1ajja_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 37 Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 45 Back     information, alignment and structure
>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Length = 51 Back     information, alignment and structure
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 50 Back     information, alignment and structure
>d1xfea2 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Length = 263 Back     information, alignment and structure
>d1f5ya2 g.12.1.1 (A:45-85) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1f5ya2 g.12.1.1 (A:45-85) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1f5ya2 g.12.1.1 (A:45-85) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Length = 40 Back     information, alignment and structure
>d2gtlo2 g.12.1.1 (O:60-100) Extracellular hemoglobin linker l3 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 Back     information, alignment and structure
>d2gtlo2 g.12.1.1 (O:60-100) Extracellular hemoglobin linker l3 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 Back     information, alignment and structure
>d2gtlo2 g.12.1.1 (O:60-100) Extracellular hemoglobin linker l3 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 Back     information, alignment and structure
>d1cr8a_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1cr8a_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1cr8a_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1v9u5_ g.12.1.1 (5:) Very low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1v9u5_ g.12.1.1 (5:) Very low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1v9u5_ g.12.1.1 (5:) Very low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Length = 40 Back     information, alignment and structure
>d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1k7ba_ g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quail (Coturnix coturnix) [TaxId: 9091]} Length = 42 Back     information, alignment and structure
>d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d2gtlm2 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 42 Back     information, alignment and structure
>d2gtlm2 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 42 Back     information, alignment and structure
>d2gtlm2 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 42 Back     information, alignment and structure
>d2gtln2 g.12.1.1 (N:61-101) Extracellular hemoglobin linker l2 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 Back     information, alignment and structure
>d2gtln2 g.12.1.1 (N:61-101) Extracellular hemoglobin linker l2 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 Back     information, alignment and structure
>d2gtln2 g.12.1.1 (N:61-101) Extracellular hemoglobin linker l2 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 Back     information, alignment and structure
>d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Length = 50 Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query482
d1f5ya241 Ligand-binding domain of low-density lipoprotein r 99.15
d1ajja_37 Ligand-binding domain of low-density lipoprotein r 99.09
d2fcwb139 Ligand-binding domain of low-density lipoprotein r 99.08
d1f8za_39 Ligand-binding domain of low-density lipoprotein r 99.06
d1cr8a_42 Ligand-binding domain of low-density lipoprotein r 99.06
d1f5ya144 Ligand-binding domain of low-density lipoprotein r 99.03
d2fcwb139 Ligand-binding domain of low-density lipoprotein r 99.03
d2fcwb239 Ligand-binding domain of low-density lipoprotein r 99.02
d2gtlo241 Extracellular hemoglobin linker l3 subunit {Common 99.02
d1j8ea_44 Ligand-binding domain of low-density lipoprotein r 99.01
d1cr8a_42 Ligand-binding domain of low-density lipoprotein r 99.0
d1i0ua241 Low density lipoprotein (LDL) receptor, different 98.99
d1f5ya241 Ligand-binding domain of low-density lipoprotein r 98.98
d2gtlm242 Hemoglobin linker chain l1 {Common earthworm (Lumb 98.96
d1d2la_45 Ligand-binding domain of low-density lipoprotein r 98.95
d1v9u5_39 Very low-density lipoprotein receptor {Human (Homo 98.95
d1f5ya144 Ligand-binding domain of low-density lipoprotein r 98.93
d1ajja_37 Ligand-binding domain of low-density lipoprotein r 98.93
d2gtln241 Extracellular hemoglobin linker l2 subunit {Common 98.93
d1f8za_39 Ligand-binding domain of low-density lipoprotein r 98.93
d1v9u5_39 Very low-density lipoprotein receptor {Human (Homo 98.91
d1k7ba_42 soluble Tva ectodomain, sTva47 {Quail (Coturnix co 98.88
d1xfea244 Ligand-binding domain of low-density lipoprotein r 98.86
d2gtlo241 Extracellular hemoglobin linker l3 subunit {Common 98.83
d1k7ba_42 soluble Tva ectodomain, sTva47 {Quail (Coturnix co 98.82
d1d2la_45 Ligand-binding domain of low-density lipoprotein r 98.82
d2fcwb239 Ligand-binding domain of low-density lipoprotein r 98.76
d1nt0a345 Mannose-binding protein associated serine protease 98.75
d1uzka143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.73
d1j8ea_44 Ligand-binding domain of low-density lipoprotein r 98.73
d1szba245 Mannose-binding protein associated serine protease 98.7
d2gtlm242 Hemoglobin linker chain l1 {Common earthworm (Lumb 98.69
d1nzia242 Complement C1S component {Human (Homo sapiens) [Ta 98.66
d2gtln241 Extracellular hemoglobin linker l2 subunit {Common 98.66
d1xfea244 Ligand-binding domain of low-density lipoprotein r 98.64
d1apqa_53 Complement protease C1R {Human (Homo sapiens) [Tax 98.58
d1uzka243 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.57
d3bpse140 Low density lipoprotein (LDL) receptor, different 98.55
d1lmja242 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.55
d1emoa143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.52
d1dx5i340 Thrombomodulin, different EGF-like domains {Human 98.49
d1kigl_51 Factor X, N-terminal module {Cow (Bos taurus) [Tax 98.4
d1autl250 Activated protein c (autoprothrombin IIa) {Human ( 98.39
d1lmja144 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.34
d2p3ua151 Factor X, N-terminal module {Human (Homo sapiens) 98.33
d1rfnb_57 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 98.1
d1i0ua241 Low density lipoprotein (LDL) receptor, different 98.0
d1ijqa250 Low density lipoprotein (LDL) receptor, different 97.99
d2bz6l153 Coagulation factor VIIa {Human (Homo sapiens) [Tax 97.82
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 97.59
d1nt0a345 Mannose-binding protein associated serine protease 97.45
d1nzia242 Complement C1S component {Human (Homo sapiens) [Ta 97.43
d3bpse140 Low density lipoprotein (LDL) receptor, different 97.42
d1szba245 Mannose-binding protein associated serine protease 97.4
d1emoa143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.37
d1uzka143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.3
d1kigl_51 Factor X, N-terminal module {Cow (Bos taurus) [Tax 97.13
d1dx5i340 Thrombomodulin, different EGF-like domains {Human 97.12
d1autl250 Activated protein c (autoprothrombin IIa) {Human ( 96.93
d1lmja242 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 96.84
d1uzka243 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 96.8
d2p3ua151 Factor X, N-terminal module {Human (Homo sapiens) 96.76
d1lmja144 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 96.61
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 96.59
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 96.47
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 96.46
d1apqa_53 Complement protease C1R {Human (Homo sapiens) [Tax 96.44
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 96.12
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 96.12
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 96.09
d1ijqa250 Low density lipoprotein (LDL) receptor, different 96.02
d1rfnb_57 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 95.99
d1gl4a240 EGF-like domain of nidogen-1 {Mouse (Mus musculus) 95.84
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 95.79
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 95.75
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 95.41
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 95.34
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 95.14
d1emoa239 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 95.01
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 94.96
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 94.74
d2bz6l153 Coagulation factor VIIa {Human (Homo sapiens) [Tax 94.62
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 93.96
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 93.83
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 93.69
d1gl4a240 EGF-like domain of nidogen-1 {Mouse (Mus musculus) 93.45
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 93.4
d1emoa239 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 91.23
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 90.65
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 89.66
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 88.64
d1cvua241 Prostaglandin H2 synthase-1, EGF-like module {Mous 87.48
d1dx5i143 Thrombomodulin, different EGF-like domains {Human 87.44
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 86.81
d1cvua241 Prostaglandin H2 synthase-1, EGF-like module {Mous 84.17
d1haea_63 Heregulin-alpha, EGF-like domain {Human (Homo sapi 80.62
>d1f5ya2 g.12.1.1 (A:45-85) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: LDL receptor-like module
superfamily: LDL receptor-like module
family: LDL receptor-like module
domain: Ligand-binding domain of low-density lipoprotein receptor
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.15  E-value=1.1e-11  Score=83.37  Aligned_cols=40  Identities=33%  Similarity=0.839  Sum_probs=35.6

Q ss_pred             CCcccCCCCeeeCC-CCCeecCccccCCCCCCCCCCCCCCCCcccc
Q psy14262          1 MIHQCFNGQVQCAL-SKKCIPHNWLCDEEMDCSTDDIVDNTDEDWD   45 (482)
Q Consensus         1 ~~~~C~~~~f~C~~-~~~Ci~~~~~CDg~~dC~~~~~~d~sDE~~~   45 (482)
                      +..+|.++||+|.. +++|||..|+|||+.||+     |+|||.+|
T Consensus         1 ls~~C~~~~f~C~~~~~~CI~~~~~CDg~~DC~-----DgsDE~~C   41 (41)
T d1f5ya2           1 LSVTCKSGDFSCGGRVNRCIPQFWRCDGQVDCD-----NGSDEQGC   41 (41)
T ss_dssp             TTTTCCSSCEECCSSCCCEECGGGTTCSCCCSS-----SCTTTTTC
T ss_pred             CccccCCCceECCCCCCCCccchhcCCCcCcCc-----CcccccCC
Confidence            46789999999963 689999999999999998     99999864



>d1ajja_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f8za_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cr8a_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f5ya1 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcwb2 g.12.1.1 (B:125-163) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gtlo2 g.12.1.1 (O:60-100) Extracellular hemoglobin linker l3 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Back     information, alignment and structure
>d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cr8a_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f5ya2 g.12.1.1 (A:45-85) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gtlm2 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Back     information, alignment and structure
>d1d2la_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v9u5_ g.12.1.1 (5:) Very low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f5ya1 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ajja_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gtln2 g.12.1.1 (N:61-101) Extracellular hemoglobin linker l2 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Back     information, alignment and structure
>d1f8za_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v9u5_ g.12.1.1 (5:) Very low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k7ba_ g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quail (Coturnix coturnix) [TaxId: 9091]} Back     information, alignment and structure
>d1xfea2 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gtlo2 g.12.1.1 (O:60-100) Extracellular hemoglobin linker l3 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Back     information, alignment and structure
>d1k7ba_ g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quail (Coturnix coturnix) [TaxId: 9091]} Back     information, alignment and structure
>d1d2la_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcwb2 g.12.1.1 (B:125-163) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gtlm2 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gtln2 g.12.1.1 (N:61-101) Extracellular hemoglobin linker l2 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Back     information, alignment and structure
>d1xfea2 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dx5i1 g.3.11.1 (I:345-387) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure