Psyllid ID: psy1426
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 64 | ||||||
| 195339873 | 426 | GM18549 [Drosophila sechellia] gi|194130 | 0.921 | 0.138 | 0.508 | 3e-10 | |
| 194862251 | 401 | GG23651 [Drosophila erecta] gi|190661825 | 0.984 | 0.157 | 0.492 | 4e-10 | |
| 198472737 | 532 | GA16540 [Drosophila pseudoobscura pseudo | 0.953 | 0.114 | 0.491 | 4e-10 | |
| 195386694 | 400 | GJ23845 [Drosophila virilis] gi|19414849 | 0.984 | 0.157 | 0.523 | 4e-10 | |
| 195161585 | 532 | GL26620 [Drosophila persimilis] gi|19410 | 0.953 | 0.114 | 0.491 | 4e-10 | |
| 195435163 | 409 | GK14603 [Drosophila willistoni] gi|19416 | 0.984 | 0.154 | 0.492 | 4e-10 | |
| 24583491 | 531 | CG31871 [Drosophila melanogaster] gi|229 | 0.953 | 0.114 | 0.491 | 5e-10 | |
| 194862191 | 533 | GG23662 [Drosophila erecta] gi|190661811 | 0.953 | 0.114 | 0.491 | 5e-10 | |
| 195339899 | 531 | GM18659 [Drosophila sechellia] gi|194130 | 0.953 | 0.114 | 0.491 | 6e-10 | |
| 195435137 | 546 | GK14608 [Drosophila willistoni] gi|19416 | 0.953 | 0.111 | 0.508 | 7e-10 |
| >gi|195339873|ref|XP_002036541.1| GM18549 [Drosophila sechellia] gi|194130421|gb|EDW52464.1| GM18549 [Drosophila sechellia] | Back alignment and taxonomy information |
|---|
Score = 69.3 bits (168), Expect = 3e-10, Method: Composition-based stats.
Identities = 30/59 (50%), Positives = 42/59 (71%)
Query: 5 DMIRFWNYPSEEHKILTEDGYILTVFRIPNPGGYPVLMLHGLTVSSDCWFLRTPKEDLG 63
D+I+ + YP+E HKI +DG++LT RIP PGG PVL++HGL SS + + PK+ LG
Sbjct: 65 DLIKKYGYPAETHKIQAKDGFVLTAHRIPKPGGQPVLLVHGLLDSSVAYVILGPKKSLG 123
|
Source: Drosophila sechellia Species: Drosophila sechellia Genus: Drosophila Family: Drosophilidae Order: Diptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|194862251|ref|XP_001969958.1| GG23651 [Drosophila erecta] gi|190661825|gb|EDV59017.1| GG23651 [Drosophila erecta] | Back alignment and taxonomy information |
|---|
| >gi|198472737|ref|XP_001356051.2| GA16540 [Drosophila pseudoobscura pseudoobscura] gi|198139139|gb|EAL33110.2| GA16540 [Drosophila pseudoobscura pseudoobscura] | Back alignment and taxonomy information |
|---|
| >gi|195386694|ref|XP_002052039.1| GJ23845 [Drosophila virilis] gi|194148496|gb|EDW64194.1| GJ23845 [Drosophila virilis] | Back alignment and taxonomy information |
|---|
| >gi|195161585|ref|XP_002021643.1| GL26620 [Drosophila persimilis] gi|194103443|gb|EDW25486.1| GL26620 [Drosophila persimilis] | Back alignment and taxonomy information |
|---|
| >gi|195435163|ref|XP_002065571.1| GK14603 [Drosophila willistoni] gi|194161656|gb|EDW76557.1| GK14603 [Drosophila willistoni] | Back alignment and taxonomy information |
|---|
| >gi|24583491|ref|NP_723607.1| CG31871 [Drosophila melanogaster] gi|22946191|gb|AAF52985.2| CG31871 [Drosophila melanogaster] gi|28317004|gb|AAO39522.1| RE24765p [Drosophila melanogaster] gi|220948196|gb|ACL86641.1| CG31871-PA [synthetic construct] gi|220957422|gb|ACL91254.1| CG31871-PA [synthetic construct] | Back alignment and taxonomy information |
|---|
| >gi|194862191|ref|XP_001969944.1| GG23662 [Drosophila erecta] gi|190661811|gb|EDV59003.1| GG23662 [Drosophila erecta] | Back alignment and taxonomy information |
|---|
| >gi|195339899|ref|XP_002036554.1| GM18659 [Drosophila sechellia] gi|194130434|gb|EDW52477.1| GM18659 [Drosophila sechellia] | Back alignment and taxonomy information |
|---|
| >gi|195435137|ref|XP_002065558.1| GK14608 [Drosophila willistoni] gi|194161643|gb|EDW76544.1| GK14608 [Drosophila willistoni] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 64 | ||||||
| FB|FBgn0032266 | 406 | CG18302 [Drosophila melanogast | 0.953 | 0.150 | 0.491 | 1e-11 | |
| FB|FBgn0051871 | 531 | CG31871 [Drosophila melanogast | 0.953 | 0.114 | 0.491 | 3.7e-11 | |
| FB|FBgn0032264 | 434 | Lip4 "Lipase 4" [Drosophila me | 0.984 | 0.145 | 0.460 | 8.8e-11 | |
| FB|FBgn0032265 | 422 | CG18301 [Drosophila melanogast | 0.984 | 0.149 | 0.428 | 2.3e-10 | |
| UNIPROTKB|Q29458 | 397 | LIPF "Gastric triacylglycerol | 0.984 | 0.158 | 0.464 | 4.2e-10 | |
| MGI|MGI:1914967 | 395 | Lipf "lipase, gastric" [Mus mu | 0.968 | 0.156 | 0.457 | 1.5e-09 | |
| FB|FBgn0036996 | 399 | mag "magro" [Drosophila melano | 0.968 | 0.155 | 0.414 | 1.5e-09 | |
| TAIR|locus:2041834 | 393 | LIP1 "lipase 1" [Arabidopsis t | 0.921 | 0.150 | 0.484 | 1.9e-09 | |
| FB|FBgn0032271 | 457 | CG7329 [Drosophila melanogaste | 0.984 | 0.137 | 0.396 | 3.2e-09 | |
| UNIPROTKB|F1NVI9 | 390 | LOC423786 "Lipase" [Gallus gal | 0.968 | 0.158 | 0.450 | 5e-09 |
| FB|FBgn0032266 CG18302 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 166 (63.5 bits), Expect = 1.0e-11, P = 1.0e-11
Identities = 30/61 (49%), Positives = 42/61 (68%)
Query: 3 TDDMIRFWNYPSEEHKILTEDGYILTVFRIPNPGGYPVLMLHGLTVSSDCWFLRTPKEDL 62
T D+I+ + YP+E HKI +DG++LT RIP PGG PVL++HGL SS + + P+ L
Sbjct: 43 TPDLIKKYGYPAETHKIQAKDGFVLTAHRIPKPGGQPVLLVHGLLDSSVAYVILGPERSL 102
Query: 63 G 63
G
Sbjct: 103 G 103
|
|
| FB|FBgn0051871 CG31871 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0032264 Lip4 "Lipase 4" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0032265 CG18301 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q29458 LIPF "Gastric triacylglycerol lipase" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1914967 Lipf "lipase, gastric" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0036996 mag "magro" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2041834 LIP1 "lipase 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0032271 CG7329 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NVI9 LOC423786 "Lipase" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 64 | |||
| pfam04083 | 62 | pfam04083, Abhydro_lipase, Partial alpha/beta-hydr | 1e-21 | |
| PLN02872 | 395 | PLN02872, PLN02872, triacylglycerol lipase | 1e-13 |
| >gnl|CDD|217881 pfam04083, Abhydro_lipase, Partial alpha/beta-hydrolase lipase region | Back alignment and domain information |
|---|
Score = 78.4 bits (194), Expect = 1e-21
Identities = 28/60 (46%), Positives = 35/60 (58%), Gaps = 7/60 (11%)
Query: 3 TDDMIRFWNYPSEEHKILTEDGYILTVFRIPNPG-------GYPVLMLHGLTVSSDCWFL 55
T ++IR + YP EEH++ TEDGYILT+ RIP VL+ HGL SS W L
Sbjct: 1 TSELIRKYGYPVEEHEVTTEDGYILTLHRIPPGRNNRGRGKKPVVLLQHGLLASSADWVL 60
|
This family corresponds to a N-terminal part of an alpha/beta hydrolase domain. Length = 62 |
| >gnl|CDD|215470 PLN02872, PLN02872, triacylglycerol lipase | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 64 | |||
| PF04083 | 63 | Abhydro_lipase: Partial alpha/beta-hydrolase lipas | 99.97 | |
| KOG2624|consensus | 403 | 99.94 | ||
| PLN02872 | 395 | triacylglycerol lipase | 99.83 | |
| PHA02857 | 276 | monoglyceride lipase; Provisional | 95.82 | |
| PLN02511 | 388 | hydrolase | 95.81 | |
| PLN02385 | 349 | hydrolase; alpha/beta fold family protein | 95.49 | |
| PRK10749 | 330 | lysophospholipase L2; Provisional | 95.24 | |
| PRK03204 | 286 | haloalkane dehalogenase; Provisional | 94.77 | |
| PRK05077 | 414 | frsA fermentation/respiration switch protein; Revi | 94.76 | |
| PRK05855 | 582 | short chain dehydrogenase; Validated | 94.67 | |
| PRK10985 | 324 | putative hydrolase; Provisional | 94.64 | |
| TIGR02240 | 276 | PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer | 94.51 | |
| PLN02298 | 330 | hydrolase, alpha/beta fold family protein | 94.48 | |
| PLN02824 | 294 | hydrolase, alpha/beta fold family protein | 94.34 | |
| PRK03592 | 295 | haloalkane dehalogenase; Provisional | 93.92 | |
| PLN03084 | 383 | alpha/beta hydrolase fold protein; Provisional | 93.76 | |
| TIGR03056 | 278 | bchO_mg_che_rel putative magnesium chelatase acces | 93.74 | |
| PLN02578 | 354 | hydrolase | 93.29 | |
| TIGR03343 | 282 | biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die | 93.27 | |
| TIGR01250 | 288 | pro_imino_pep_2 proline-specific peptidases, Bacil | 93.13 | |
| PRK06489 | 360 | hypothetical protein; Provisional | 92.97 | |
| TIGR01249 | 306 | pro_imino_pep_1 proline iminopeptidase, Neisseria- | 92.68 | |
| PLN02211 | 273 | methyl indole-3-acetate methyltransferase | 92.48 | |
| KOG1454|consensus | 326 | 91.99 | ||
| PRK11126 | 242 | 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl | 91.55 | |
| TIGR03101 | 266 | hydr2_PEP hydrolase, ortholog 2, exosortase system | 91.4 | |
| PRK00870 | 302 | haloalkane dehalogenase; Provisional | 91.38 | |
| TIGR03611 | 257 | RutD pyrimidine utilization protein D. This protei | 90.56 | |
| COG0429 | 345 | Predicted hydrolase of the alpha/beta-hydrolase fo | 90.28 | |
| PRK10349 | 256 | carboxylesterase BioH; Provisional | 89.97 | |
| PF12146 | 79 | Hydrolase_4: Putative lysophospholipase; InterPro: | 89.79 | |
| TIGR01738 | 245 | bioH putative pimeloyl-BioC--CoA transferase BioH. | 89.33 | |
| KOG4391|consensus | 300 | 88.91 | ||
| PF12715 | 390 | Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8 | 88.77 | |
| PRK10673 | 255 | acyl-CoA esterase; Provisional | 87.59 | |
| PRK10162 | 318 | acetyl esterase; Provisional | 87.11 | |
| PRK11071 | 190 | esterase YqiA; Provisional | 87.09 | |
| TIGR02427 | 251 | protocat_pcaD 3-oxoadipate enol-lactonase. Members | 86.73 | |
| KOG4178|consensus | 322 | 86.43 | ||
| TIGR03695 | 251 | menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene | 86.27 | |
| PF06500 | 411 | DUF1100: Alpha/beta hydrolase of unknown function | 86.08 | |
| PF02230 | 216 | Abhydrolase_2: Phospholipase/Carboxylesterase; Int | 85.96 | |
| cd04927 | 76 | ACT_ACR-like_2 Second ACT domain, of a novel type | 85.84 | |
| PRK11460 | 232 | putative hydrolase; Provisional | 85.36 | |
| TIGR01607 | 332 | PST-A Plasmodium subtelomeric family (PST-A). Thes | 85.28 | |
| PRK14875 | 371 | acetoin dehydrogenase E2 subunit dihydrolipoyllysi | 85.25 | |
| PRK13604 | 307 | luxD acyl transferase; Provisional | 85.15 | |
| PLN02679 | 360 | hydrolase, alpha/beta fold family protein | 84.89 | |
| cd04900 | 73 | ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, | 84.46 | |
| PRK00175 | 379 | metX homoserine O-acetyltransferase; Provisional | 84.25 | |
| PLN02894 | 402 | hydrolase, alpha/beta fold family protein | 83.52 | |
| PF04270 | 53 | Strep_his_triad: Streptococcal histidine triad pro | 83.24 | |
| PLN02980 | 1655 | 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi | 83.19 | |
| cd04928 | 68 | ACT_TyrKc Uncharacterized, N-terminal ACT domain o | 83.15 | |
| TIGR01836 | 350 | PHA_synth_III_C poly(R)-hydroxyalkanoic acid synth | 82.99 | |
| cd04926 | 72 | ACT_ACR_4 C-terminal ACT domain, of a novel type o | 82.93 | |
| PLN02652 | 395 | hydrolase; alpha/beta fold family protein | 82.66 | |
| KOG2382|consensus | 315 | 82.47 | ||
| PRK10115 | 686 | protease 2; Provisional | 82.42 | |
| PLN03087 | 481 | BODYGUARD 1 domain containing hydrolase; Provision | 82.28 | |
| PRK04057 | 203 | 30S ribosomal protein S3Ae; Validated | 81.09 | |
| PRK10566 | 249 | esterase; Provisional | 81.01 | |
| TIGR03502 | 792 | lipase_Pla1_cef extracellular lipase, Pla-1/cef fa | 80.66 | |
| PF01674 | 219 | Lipase_2: Lipase (class 2); InterPro: IPR002918 Li | 80.08 | |
| PF12697 | 228 | Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 | 80.04 | |
| COG2267 | 298 | PldB Lysophospholipase [Lipid metabolism] | 80.02 |
| >PF04083 Abhydro_lipase: Partial alpha/beta-hydrolase lipase region; InterPro: IPR006693 The alpha/beta hydrolase fold is common to several hydrolytic enzymes of widely differing phylogenetic origin and catalytic function | Back alignment and domain information |
|---|
Probab=99.97 E-value=2.1e-31 Score=150.50 Aligned_cols=55 Identities=51% Similarity=0.833 Sum_probs=40.3
Q ss_pred HHHHHhhcCCcceEEEEecCCCcEEEEEEecCCC-------Ccc-EEEecccccCcccceecC
Q psy1426 3 TDDMIRFWNYPSEEHKILTEDGYILTVFRIPNPG-------GYP-VLMLHGLTVSSDCWFLRT 57 (64)
Q Consensus 3 ~~~~i~~~gy~~e~h~v~T~DGyiL~l~Ri~~~~-------~~p-VlL~HGl~~ss~~wv~~g 57 (64)
+.|+|+++||++|+|.|+|+|||+|+|||||.++ +|| |||||||++||++|++||
T Consensus 1 ~~~~i~~~GY~~E~h~V~T~DGYiL~l~RIp~~~~~~~~~~~k~pVll~HGL~~ss~~wv~ng 63 (63)
T PF04083_consen 1 VPELIEKHGYPCEEHEVTTEDGYILTLHRIPPGKNSSNQNKKKPPVLLQHGLLQSSDDWVLNG 63 (63)
T ss_dssp HHHHHHHTT---EEEEEE-TTSEEEEEEEE-SBTTCTTTTTT--EEEEE--TT--GGGGCSS-
T ss_pred CHHHHHHcCCCcEEEEEEeCCCcEEEEEEccCCCCCcccCCCCCcEEEECCcccChHHHHcCC
Confidence 5799999999999999999999999999998775 455 999999999999999986
|
The core of each enzyme is similar: an alpha/beta sheet, not barrel, of eight beta-sheets connected by alpha-helices []. This entry represents the N-terminal part of an alpha/beta hydrolase domain found in a number of lipases.; GO: 0006629 lipid metabolic process; PDB: 1K8Q_B 1HLG_B. |
| >KOG2624|consensus | Back alignment and domain information |
|---|
| >PLN02872 triacylglycerol lipase | Back alignment and domain information |
|---|
| >PHA02857 monoglyceride lipase; Provisional | Back alignment and domain information |
|---|
| >PLN02511 hydrolase | Back alignment and domain information |
|---|
| >PLN02385 hydrolase; alpha/beta fold family protein | Back alignment and domain information |
|---|
| >PRK10749 lysophospholipase L2; Provisional | Back alignment and domain information |
|---|
| >PRK03204 haloalkane dehalogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05077 frsA fermentation/respiration switch protein; Reviewed | Back alignment and domain information |
|---|
| >PRK05855 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK10985 putative hydrolase; Provisional | Back alignment and domain information |
|---|
| >TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase | Back alignment and domain information |
|---|
| >PLN02298 hydrolase, alpha/beta fold family protein | Back alignment and domain information |
|---|
| >PLN02824 hydrolase, alpha/beta fold family protein | Back alignment and domain information |
|---|
| >PRK03592 haloalkane dehalogenase; Provisional | Back alignment and domain information |
|---|
| >PLN03084 alpha/beta hydrolase fold protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein | Back alignment and domain information |
|---|
| >PLN02578 hydrolase | Back alignment and domain information |
|---|
| >TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase | Back alignment and domain information |
|---|
| >TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily | Back alignment and domain information |
|---|
| >PRK06489 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily | Back alignment and domain information |
|---|
| >PLN02211 methyl indole-3-acetate methyltransferase | Back alignment and domain information |
|---|
| >KOG1454|consensus | Back alignment and domain information |
|---|
| >PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional | Back alignment and domain information |
|---|
| >TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated | Back alignment and domain information |
|---|
| >PRK00870 haloalkane dehalogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR03611 RutD pyrimidine utilization protein D | Back alignment and domain information |
|---|
| >COG0429 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10349 carboxylesterase BioH; Provisional | Back alignment and domain information |
|---|
| >PF12146 Hydrolase_4: Putative lysophospholipase; InterPro: IPR022742 This domain is found in bacteria and eukaryotes and is approximately 110 amino acids in length | Back alignment and domain information |
|---|
| >TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH | Back alignment and domain information |
|---|
| >KOG4391|consensus | Back alignment and domain information |
|---|
| >PF12715 Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8Y_A | Back alignment and domain information |
|---|
| >PRK10673 acyl-CoA esterase; Provisional | Back alignment and domain information |
|---|
| >PRK10162 acetyl esterase; Provisional | Back alignment and domain information |
|---|
| >PRK11071 esterase YqiA; Provisional | Back alignment and domain information |
|---|
| >TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase | Back alignment and domain information |
|---|
| >KOG4178|consensus | Back alignment and domain information |
|---|
| >TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase | Back alignment and domain information |
|---|
| >PF06500 DUF1100: Alpha/beta hydrolase of unknown function (DUF1100); InterPro: IPR010520 Proteins in this entry display esterase activity toward pNP-butyrate [] | Back alignment and domain information |
|---|
| >PF02230 Abhydrolase_2: Phospholipase/Carboxylesterase; InterPro: IPR003140 This entry represents the alpha/beta hydrolase domain found in phospholipases [], carboxylesterases [] and thioesterases | Back alignment and domain information |
|---|
| >cd04927 ACT_ACR-like_2 Second ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >PRK11460 putative hydrolase; Provisional | Back alignment and domain information |
|---|
| >TIGR01607 PST-A Plasmodium subtelomeric family (PST-A) | Back alignment and domain information |
|---|
| >PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK13604 luxD acyl transferase; Provisional | Back alignment and domain information |
|---|
| >PLN02679 hydrolase, alpha/beta fold family protein | Back alignment and domain information |
|---|
| >cd04900 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, includes the first of two C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains | Back alignment and domain information |
|---|
| >PRK00175 metX homoserine O-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02894 hydrolase, alpha/beta fold family protein | Back alignment and domain information |
|---|
| >PF04270 Strep_his_triad: Streptococcal histidine triad protein ; InterPro: IPR006270 This entry represents a repeated sequence region that includes a His-X-X-His-X-His (histidine triad) motif, which is found in family of Streptococcal proteins | Back alignment and domain information |
|---|
| >PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding | Back alignment and domain information |
|---|
| >cd04928 ACT_TyrKc Uncharacterized, N-terminal ACT domain of an Arabidopsis/Oryza predicted tyrosine kinase and other related ACT domains | Back alignment and domain information |
|---|
| >TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit | Back alignment and domain information |
|---|
| >cd04926 ACT_ACR_4 C-terminal ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >PLN02652 hydrolase; alpha/beta fold family protein | Back alignment and domain information |
|---|
| >KOG2382|consensus | Back alignment and domain information |
|---|
| >PRK10115 protease 2; Provisional | Back alignment and domain information |
|---|
| >PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK04057 30S ribosomal protein S3Ae; Validated | Back alignment and domain information |
|---|
| >PRK10566 esterase; Provisional | Back alignment and domain information |
|---|
| >TIGR03502 lipase_Pla1_cef extracellular lipase, Pla-1/cef family | Back alignment and domain information |
|---|
| >PF01674 Lipase_2: Lipase (class 2); InterPro: IPR002918 Lipases or triacylglycerol acylhydrolases hydrolyse ester bonds in triacylglycerol giving diacylglycerol, monoacylglycerol, glycerol and free fatty acids [] | Back alignment and domain information |
|---|
| >PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A | Back alignment and domain information |
|---|
| >COG2267 PldB Lysophospholipase [Lipid metabolism] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 64 | ||||
| 1hlg_A | 371 | Crystal Structure Of Human Gastric Lipase Length = | 5e-10 | ||
| 1k8q_A | 377 | Crystal Structure Of Dog Gastric Lipase In Complex | 5e-09 |
| >pdb|1HLG|A Chain A, Crystal Structure Of Human Gastric Lipase Length = 371 | Back alignment and structure |
|
| >pdb|1K8Q|A Chain A, Crystal Structure Of Dog Gastric Lipase In Complex With A Phosphonate Inhibitor Length = 377 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 64 | |||
| 1k8q_A | 377 | Triacylglycerol lipase, gastric; APHA beta hydrola | 3e-19 | |
| 1tca_A | 317 | Lipase; hydrolase(carboxylic esterase); HET: NAG; | 3e-04 | |
| 3icv_A | 316 | Lipase B, CALB; circular permutation, cleavage on | 7e-04 |
| >1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* Length = 377 | Back alignment and structure |
|---|
Score = 77.7 bits (191), Expect = 3e-19
Identities = 25/71 (35%), Positives = 34/71 (47%), Gaps = 8/71 (11%)
Query: 1 MRTDDMIRFWNYPSEEHKILTEDGYILTVFRIPNP--------GGYPVLMLHGLTVSSDC 52
M MI +W YP+EE++++TEDGYIL + RIP + HGL S+
Sbjct: 14 MNISQMITYWGYPAEEYEVVTEDGYILGIDRIPYGRKNSENIGRRPVAFLQHGLLASATN 73
Query: 53 WFLRTPKEDLG 63
W P L
Sbjct: 74 WISNLPNNSLA 84
|
| >1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A* Length = 317 | Back alignment and structure |
|---|
| >3icv_A Lipase B, CALB; circular permutation, cleavage on PAIR of basic residues, glycoprotein, hydrolase, lipid degradation, zymogen, disulf; HET: NAG BTB; 1.49A {Candida antarctica} PDB: 3icw_A* Length = 316 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 64 | |||
| 1k8q_A | 377 | Triacylglycerol lipase, gastric; APHA beta hydrola | 99.22 | |
| 3i1i_A | 377 | Homoserine O-acetyltransferase; structural genomic | 97.66 | |
| 2i3d_A | 249 | AGR_C_3351P, hypothetical protein ATU1826; structu | 97.49 | |
| 3g9x_A | 299 | Haloalkane dehalogenase; alpha/beta hydrolase, hel | 97.23 | |
| 3ia2_A | 271 | Arylesterase; alpha-beta hydrolase fold, transitio | 97.22 | |
| 3pe6_A | 303 | Monoglyceride lipase; alpha-beta hydrolase fold, 2 | 97.22 | |
| 3hju_A | 342 | Monoglyceride lipase; alpha/beta hydrolase, hydrol | 97.13 | |
| 2r11_A | 306 | Carboxylesterase NP; 2632844, putative hydrolase, | 97.1 | |
| 3bwx_A | 285 | Alpha/beta hydrolase; YP_496220.1, joint center fo | 97.06 | |
| 3fnb_A | 405 | Acylaminoacyl peptidase SMU_737; alpha-beta-alpha | 97.06 | |
| 3bdi_A | 207 | Uncharacterized protein TA0194; NP_393672.1, predi | 97.04 | |
| 4g9e_A | 279 | AHL-lactonase, alpha/beta hydrolase fold protein; | 97.02 | |
| 1a88_A | 275 | Chloroperoxidase L; haloperoxidase, oxidoreductase | 96.98 | |
| 1zoi_A | 276 | Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo | 96.94 | |
| 1tht_A | 305 | Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. | 96.9 | |
| 4f0j_A | 315 | Probable hydrolytic enzyme; alpha/beta hydrolase f | 96.76 | |
| 3qit_A | 286 | CURM TE, polyketide synthase; thioesterase, alpha/ | 96.74 | |
| 3om8_A | 266 | Probable hydrolase; structural genomics, PSI-2, pr | 96.7 | |
| 3llc_A | 270 | Putative hydrolase; structural genomics, joint cen | 96.64 | |
| 2o2g_A | 223 | Dienelactone hydrolase; YP_324580.1, structural ge | 96.63 | |
| 3i28_A | 555 | Epoxide hydrolase 2; aromatic hydrocarbons catabol | 96.58 | |
| 2qvb_A | 297 | Haloalkane dehalogenase 3; RV2579, alpha-beta hydr | 96.57 | |
| 1a8q_A | 274 | Bromoperoxidase A1; haloperoxidase, oxidoreductase | 96.55 | |
| 3trd_A | 208 | Alpha/beta hydrolase; cellular processes; 1.50A {C | 96.5 | |
| 3h04_A | 275 | Uncharacterized protein; protein with unknown func | 96.46 | |
| 1a8s_A | 273 | Chloroperoxidase F; haloperoxidase, oxidoreductase | 96.43 | |
| 1wm1_A | 317 | Proline iminopeptidase; complex with inhibitor, hy | 96.41 | |
| 3r0v_A | 262 | Alpha/beta hydrolase fold protein; structural geno | 96.4 | |
| 3u1t_A | 309 | DMMA haloalkane dehalogenase; alpha/beta-hydrolase | 96.39 | |
| 3oos_A | 278 | Alpha/beta hydrolase family protein; APC67239.0, p | 96.37 | |
| 1q0r_A | 298 | RDMC, aclacinomycin methylesterase; anthracycline, | 96.37 | |
| 1zi8_A | 236 | Carboxymethylenebutenolidase; alpha and beta prote | 96.37 | |
| 3kda_A | 301 | CFTR inhibitory factor (CIF); alpha/beta hydrolase | 96.35 | |
| 3fcy_A | 346 | Xylan esterase 1; alpha/beta hydrolase, carbohydra | 96.29 | |
| 1mj5_A | 302 | 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; | 96.29 | |
| 2yys_A | 286 | Proline iminopeptidase-related protein; TTHA1809, | 96.23 | |
| 1azw_A | 313 | Proline iminopeptidase; aminopeptidase, serine pro | 96.2 | |
| 2hdw_A | 367 | Hypothetical protein PA2218; alpha/beta hydrolase | 96.1 | |
| 2xt0_A | 297 | Haloalkane dehalogenase; hydrolase, alpha-beta hyd | 96.09 | |
| 1l7a_A | 318 | Cephalosporin C deacetylase; structural genomics, | 96.04 | |
| 2jbw_A | 386 | Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine | 96.03 | |
| 1b6g_A | 310 | Haloalkane dehalogenase; hydrolase, alpha/beta-hyd | 96.0 | |
| 2wj6_A | 276 | 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid | 95.99 | |
| 1ehy_A | 294 | Protein (soluble epoxide hydrolase); alpha/beta hy | 95.8 | |
| 1imj_A | 210 | CIB, CCG1-interacting factor B; alpha/beta hydrola | 95.8 | |
| 3f67_A | 241 | Putative dienelactone hydrolase; alpha-beta-alpha | 95.78 | |
| 3fob_A | 281 | Bromoperoxidase; structural genomics, IDP00046, ba | 95.76 | |
| 3mve_A | 415 | FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/ | 95.59 | |
| 3r40_A | 306 | Fluoroacetate dehalogenase; FACD, defluorinase, al | 95.57 | |
| 3ksr_A | 290 | Putative serine hydrolase; catalytic triad, struct | 95.49 | |
| 2hm7_A | 310 | Carboxylesterase; alpha/beta hydrolase fold, hydro | 95.44 | |
| 2psd_A | 318 | Renilla-luciferin 2-monooxygenase; alpha/beta-hydr | 95.42 | |
| 2cjp_A | 328 | Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu | 95.3 | |
| 2xua_A | 266 | PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate | 95.23 | |
| 3ibt_A | 264 | 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, | 95.15 | |
| 1j1i_A | 296 | META cleavage compound hydrolase; carbazole degrad | 95.14 | |
| 2vat_A | 444 | Acetyl-COA--deacetylcephalosporin C acetyltransfer | 95.1 | |
| 3qyj_A | 291 | ALR0039 protein; alpha/beta fold, hydrolase; 1.78A | 95.03 | |
| 1brt_A | 277 | Bromoperoxidase A2; haloperoxidase, oxidoreductase | 95.02 | |
| 1vlq_A | 337 | Acetyl xylan esterase; TM0077, structural genomics | 94.95 | |
| 1jfr_A | 262 | Lipase; serine hydrolase; 1.90A {Streptomyces exfo | 94.93 | |
| 3pfb_A | 270 | Cinnamoyl esterase; alpha/beta hydrolase fold, hyd | 94.89 | |
| 1jji_A | 311 | Carboxylesterase; alpha-beta hydrolase fold, hydro | 94.84 | |
| 3g8y_A | 391 | SUSD/RAGB-associated esterase-like protein; struct | 94.83 | |
| 3ain_A | 323 | 303AA long hypothetical esterase; carboxylesterase | 94.81 | |
| 3vdx_A | 456 | Designed 16NM tetrahedral protein CAGE containing | 94.8 | |
| 2e3j_A | 356 | Epoxide hydrolase EPHB; epoxide hydrolase B, struc | 94.8 | |
| 3afi_E | 316 | Haloalkane dehalogenase; A/B-hydrolase, hydrolase; | 94.77 | |
| 2y6u_A | 398 | Peroxisomal membrane protein LPX1; hydrolase, puta | 94.73 | |
| 4i19_A | 388 | Epoxide hydrolase; structural genomics, PSI-biolog | 94.72 | |
| 3bxp_A | 277 | Putative lipase/esterase; putative carboxylesteras | 94.65 | |
| 1sfr_A | 304 | Antigen 85-A; alpha/beta hydrolase, structural gen | 94.5 | |
| 2fuk_A | 220 | XC6422 protein; A/B hydrolase, structural genomics | 94.37 | |
| 3hxk_A | 276 | Sugar hydrolase; alpha-beta protein., structural g | 94.34 | |
| 1mtz_A | 293 | Proline iminopeptidase; alpha-beta hydrolase, CAP | 94.32 | |
| 1lzl_A | 323 | Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod | 94.27 | |
| 2c7b_A | 311 | Carboxylesterase, ESTE1; carboxyesterase, thermoph | 94.12 | |
| 3nwo_A | 330 | PIP, proline iminopeptidase; structural genomics, | 94.1 | |
| 2wue_A | 291 | 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas | 94.09 | |
| 1iup_A | 282 | META-cleavage product hydrolase; aromatic compound | 94.05 | |
| 3p2m_A | 330 | Possible hydrolase; alpha/beta hydrolase superfami | 94.04 | |
| 1hkh_A | 279 | Gamma lactamase; hydrolase, alpha/beta hydrolase, | 94.04 | |
| 3d0k_A | 304 | Putative poly(3-hydroxybutyrate) depolymerase LPQ; | 93.99 | |
| 3l80_A | 292 | Putative uncharacterized protein SMU.1393C; alpha/ | 93.91 | |
| 1c4x_A | 285 | BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di | 93.82 | |
| 3qh4_A | 317 | Esterase LIPW; structural genomics, ssgcid, seattl | 93.73 | |
| 2xmz_A | 269 | Hydrolase, alpha/beta hydrolase fold family; menaq | 93.73 | |
| 3c5v_A | 316 | PME-1, protein phosphatase methylesterase 1; demet | 93.69 | |
| 3nuz_A | 398 | Putative acetyl xylan esterase; structural genomic | 93.67 | |
| 1r88_A | 280 | MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBP | 93.55 | |
| 3e0x_A | 245 | Lipase-esterase related protein; APC60309, clostri | 93.48 | |
| 3ga7_A | 326 | Acetyl esterase; phosphoserine, IDP00896, hydrolas | 93.47 | |
| 3b12_A | 304 | Fluoroacetate dehalogenase; dehalogease, hydrolase | 92.53 | |
| 2wir_A | 313 | Pesta, alpha/beta hydrolase fold-3 domain protein; | 93.38 | |
| 1ufo_A | 238 | Hypothetical protein TT1662; alpha-beta fold, hydr | 93.35 | |
| 2pbl_A | 262 | Putative esterase/lipase/thioesterase; alpha/beta- | 93.32 | |
| 3g02_A | 408 | Epoxide hydrolase; alpha/beta hydrolase fold, enan | 93.29 | |
| 2pl5_A | 366 | Homoserine O-acetyltransferase; alpha/beta hydrola | 93.21 | |
| 2wtm_A | 251 | EST1E; hydrolase; 1.60A {Clostridium proteoclastic | 93.04 | |
| 3vis_A | 306 | Esterase; alpha/beta-hydrolase fold, polyethylene | 92.75 | |
| 2rau_A | 354 | Putative esterase; NP_343859.1, putative lipase, s | 92.72 | |
| 2b61_A | 377 | Homoserine O-acetyltransferase; acyl-enzyme, aspar | 92.63 | |
| 2qmq_A | 286 | Protein NDRG2, protein NDR2; alpha/beta-hydrolases | 92.62 | |
| 3ebl_A | 365 | Gibberellin receptor GID1; alpha/beta hydrolase, l | 92.61 | |
| 2puj_A | 286 | 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; | 92.41 | |
| 2wfl_A | 264 | Polyneuridine-aldehyde esterase; alkaloid metaboli | 92.38 | |
| 3v48_A | 268 | Aminohydrolase, putative aminoacrylate hydrolase R | 92.21 | |
| 2h1i_A | 226 | Carboxylesterase; structural genomics, PSI-2, prot | 92.18 | |
| 3fsg_A | 272 | Alpha/beta superfamily hydrolase; PF00561, MCSG, P | 92.12 | |
| 3kxp_A | 314 | Alpha-(N-acetylaminomethylene)succinic acid hydrol | 92.11 | |
| 3bf7_A | 255 | Esterase YBFF; thioesterase, helical CAP, hydrolas | 92.01 | |
| 2xdw_A | 710 | Prolyl endopeptidase; alpha/beta-hydrolase, amnesi | 92.0 | |
| 1r3d_A | 264 | Conserved hypothetical protein VC1974; structural | 91.8 | |
| 2ocg_A | 254 | Valacyclovir hydrolase; alpha beta hydrolase fold; | 91.76 | |
| 3o4h_A | 582 | Acylamino-acid-releasing enzyme; alpha/beta hydrol | 91.58 | |
| 3sty_A | 267 | Methylketone synthase 1; alpha/beta hydrolase, dec | 91.54 | |
| 3c6x_A | 257 | Hydroxynitrilase; atomic resolution, hydroxynitril | 91.48 | |
| 4f21_A | 246 | Carboxylesterase/phospholipase family protein; str | 91.45 | |
| 4fbl_A | 281 | LIPS lipolytic enzyme; thermostable, structural ge | 91.43 | |
| 3og9_A | 209 | Protein YAHD A copper inducible hydrolase; alpha/b | 91.42 | |
| 1wom_A | 271 | RSBQ, sigma factor SIGB regulation protein RSBQ; a | 91.11 | |
| 2fx5_A | 258 | Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse | 90.95 | |
| 1yr2_A | 741 | Prolyl oligopeptidase; prolyl endopeptidase, mecha | 90.93 | |
| 1auo_A | 218 | Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl | 90.89 | |
| 1xkl_A | 273 | SABP2, salicylic acid-binding protein 2; alpha-bet | 90.78 | |
| 1m33_A | 258 | BIOH protein; alpha-betta-alpha sandwich, structur | 90.77 | |
| 3hss_A | 293 | Putative bromoperoxidase; alpha beta hydrolase, ox | 90.74 | |
| 1jkm_A | 361 | Brefeldin A esterase; serine hydrolase, degradatio | 90.73 | |
| 3fla_A | 267 | RIFR; alpha-beta hydrolase thioesterase, hydrolase | 90.6 | |
| 3lp5_A | 250 | Putative cell surface hydrolase; structural genom | 90.58 | |
| 3bjr_A | 283 | Putative carboxylesterase; structural genomics, jo | 90.5 | |
| 3doh_A | 380 | Esterase; alpha-beta hydrolase, beta sheet; 2.60A | 90.33 | |
| 1pja_A | 302 | Palmitoyl-protein thioesterase 2 precursor; hydrol | 90.27 | |
| 4dnp_A | 269 | DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu | 90.02 | |
| 3dqz_A | 258 | Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl | 89.9 | |
| 2ecf_A | 741 | Dipeptidyl peptidase IV; prolyl oligopeptidase fam | 89.85 | |
| 2qjw_A | 176 | Uncharacterized protein XCC1541; putative hydrolas | 89.83 | |
| 3ds8_A | 254 | LIN2722 protein; unkonwn function, structural geno | 89.8 | |
| 3icv_A | 316 | Lipase B, CALB; circular permutation, cleavage on | 89.68 | |
| 3fle_A | 249 | SE_1780 protein; structural genomics, APC61035.1, | 89.67 | |
| 2bkl_A | 695 | Prolyl endopeptidase; mechanistic study, celiac sp | 89.64 | |
| 1tqh_A | 247 | Carboxylesterase precursor; tetrahedral intermedia | 89.64 | |
| 1gkl_A | 297 | Endo-1,4-beta-xylanase Y; hydrolase, esterase fami | 89.56 | |
| 4h0c_A | 210 | Phospholipase/carboxylesterase; PSI-biology, midwe | 89.48 | |
| 3u0v_A | 239 | Lysophospholipase-like protein 1; alpha, beta hydr | 89.42 | |
| 3iuj_A | 693 | Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas | 89.27 | |
| 3b5e_A | 223 | MLL8374 protein; NP_108484.1, carboxylesterase, st | 89.16 | |
| 3qvm_A | 282 | OLEI00960; structural genomics, PSI-biology, midwe | 89.12 | |
| 3i6y_A | 280 | Esterase APC40077; lipase, structural genomics, PS | 89.1 | |
| 4fle_A | 202 | Esterase; structural genomics, PSI-biology, northe | 88.95 | |
| 2uz0_A | 263 | Esterase, tributyrin esterase; alpha/beta hydrolas | 88.92 | |
| 1qlw_A | 328 | Esterase; anisotropic refinement, atomic resolutio | 88.87 | |
| 1ei9_A | 279 | Palmitoyl protein thioesterase 1; alpha/beta hydro | 88.82 | |
| 1dqz_A | 280 | 85C, protein (antigen 85-C); fibronectin, structur | 88.8 | |
| 1uxo_A | 192 | YDEN protein; hydrolase, A/B hydrolase, esterase, | 88.71 | |
| 3azo_A | 662 | Aminopeptidase; POP family, hydrolase; 2.00A {Stre | 88.55 | |
| 1jjf_A | 268 | Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-x | 88.31 | |
| 1isp_A | 181 | Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 | 88.29 | |
| 3dkr_A | 251 | Esterase D; alpha beta hydrolase, mechanism, catal | 88.1 | |
| 3ls2_A | 280 | S-formylglutathione hydrolase; psychrophilic organ | 87.77 | |
| 2r8b_A | 251 | AGR_C_4453P, uncharacterized protein ATU2452; APC6 | 87.55 | |
| 1fj2_A | 232 | Protein (acyl protein thioesterase 1); alpha/beta | 87.55 | |
| 3qmv_A | 280 | Thioesterase, REDJ; alpha/beta hydrolase fold, hyd | 87.44 | |
| 3e4d_A | 278 | Esterase D; S-formylglutathione hydrolase, hydrola | 86.82 | |
| 4hvt_A | 711 | Ritya.17583.B, post-proline cleaving enzyme; ssgci | 86.69 | |
| 3cn9_A | 226 | Carboxylesterase; alpha/beta hydrolase fold super- | 86.67 | |
| 1ycd_A | 243 | Hypothetical 27.3 kDa protein in AAP1-SMF2 interge | 86.29 | |
| 2xe4_A | 751 | Oligopeptidase B; hydrolase-inhibitor complex, hyd | 85.95 | |
| 1u2e_A | 289 | 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase | 85.43 | |
| 4fhz_A | 285 | Phospholipase/carboxylesterase; alpha/beta hydrola | 85.2 | |
| 4b6g_A | 283 | Putative esterase; hydrolase, formaldehyde detoxif | 85.14 | |
| 2zsh_A | 351 | Probable gibberellin receptor GID1L1; plant hormon | 85.03 | |
| 3fcx_A | 282 | FGH, esterase D, S-formylglutathione hydrolase; re | 84.64 | |
| 2o7r_A | 338 | CXE carboxylesterase; alpha/beta hydrolase; 1.40A | 84.42 | |
| 2z3z_A | 706 | Dipeptidyl aminopeptidase IV; peptidase family S9, | 83.93 | |
| 3d7r_A | 326 | Esterase; alpha/beta fold, hydrolase; 2.01A {Staph | 83.9 | |
| 4ao6_A | 259 | Esterase; hydrolase, thermo label; 1.60A {Unidenti | 83.83 | |
| 4go6_A | 45 | HCF N-terminal chain 1; tandem fibronectin repeat, | 83.68 | |
| 3tjm_A | 283 | Fatty acid synthase; thioesterase domain, fatty ac | 83.67 | |
| 3rm3_A | 270 | MGLP, thermostable monoacylglycerol lipase; alpha/ | 83.66 | |
| 1xfd_A | 723 | DIP, dipeptidyl aminopeptidase-like protein 6, dip | 83.37 | |
| 3j20_A | 198 | 30S ribosomal protein S3AE; archaea, archaeal, KIN | 83.15 | |
| 1tca_A | 317 | Lipase; hydrolase(carboxylic esterase); HET: NAG; | 83.14 | |
| 2qs9_A | 194 | Retinoblastoma-binding protein 9; B5T overexpresse | 83.04 | |
| 3bdv_A | 191 | Uncharacterized protein DUF1234; DUF1234 family pr | 81.86 | |
| 2qru_A | 274 | Uncharacterized protein; alpha/beta-hydrolase, str | 81.59 |
| >1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* | Back alignment and structure |
|---|
Probab=99.22 E-value=3e-11 Score=78.40 Aligned_cols=58 Identities=43% Similarity=0.853 Sum_probs=50.7
Q ss_pred CCHHHHHhhcCCcceEEEEecCCCcEEEEEEecCCC-------Ccc-EEEecccccCcccceecCC
Q psy1426 1 MRTDDMIRFWNYPSEEHKILTEDGYILTVFRIPNPG-------GYP-VLMLHGLTVSSDCWFLRTP 58 (64)
Q Consensus 1 ~~~~~~i~~~gy~~e~h~v~T~DGyiL~l~Ri~~~~-------~~p-VlL~HGl~~ss~~wv~~gp 58 (64)
|++.++++.+||++|++.++|.||+.|.+++++.+. .+| |+|+||+.+++..|....+
T Consensus 14 ~~~~~~~~~~~~~~~~~~~~~~dG~~l~~~~~~~~~~~~~~~~~~~~vvl~HG~~~~~~~~~~~~~ 79 (377)
T 1k8q_A 14 MNISQMITYWGYPAEEYEVVTEDGYILGIDRIPYGRKNSENIGRRPVAFLQHGLLASATNWISNLP 79 (377)
T ss_dssp CCHHHHHHHTTCCCEEEEEECTTSEEEEEEEECSCSSCCTTTTTCCEEEEECCTTCCGGGGSSSCT
T ss_pred cCHHHHHHHcCCCceEEEeEcCCCCEEEEEEecCCCCCccccCCCCeEEEECCCCCchhhhhcCCC
Confidence 578999999999999999999999999999996542 455 9999999999999976554
|
| >3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 | Back alignment and structure |
|---|
| >3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A | Back alignment and structure |
|---|
| >3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A | Back alignment and structure |
|---|
| >3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* | Back alignment and structure |
|---|
| >3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans} | Back alignment and structure |
|---|
| >3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} | Back alignment and structure |
|---|
| >4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A | Back alignment and structure |
|---|
| >1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 | Back alignment and structure |
|---|
| >1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A | Back alignment and structure |
|---|
| >1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 | Back alignment and structure |
|---|
| >4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} | Back alignment and structure |
|---|
| >3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} | Back alignment and structure |
|---|
| >2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} | Back alignment and structure |
|---|
| >3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* | Back alignment and structure |
|---|
| >2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A | Back alignment and structure |
|---|
| >1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 | Back alignment and structure |
|---|
| >3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 | Back alignment and structure |
|---|
| >1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* | Back alignment and structure |
|---|
| >3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} | Back alignment and structure |
|---|
| >3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} | Back alignment and structure |
|---|
| >1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* | Back alignment and structure |
|---|
| >1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* | Back alignment and structure |
|---|
| >3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A | Back alignment and structure |
|---|
| >3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} | Back alignment and structure |
|---|
| >1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A | Back alignment and structure |
|---|
| >2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 | Back alignment and structure |
|---|
| >2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} | Back alignment and structure |
|---|
| >1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* | Back alignment and structure |
|---|
| >2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 | Back alignment and structure |
|---|
| >1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A | Back alignment and structure |
|---|
| >2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* | Back alignment and structure |
|---|
| >1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 | Back alignment and structure |
|---|
| >1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 | Back alignment and structure |
|---|
| >3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A | Back alignment and structure |
|---|
| >3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A | Back alignment and structure |
|---|
| >3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A | Back alignment and structure |
|---|
| >2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A | Back alignment and structure |
|---|
| >2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* | Back alignment and structure |
|---|
| >2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} | Back alignment and structure |
|---|
| >1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 | Back alignment and structure |
|---|
| >2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A* | Back alignment and structure |
|---|
| >3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} | Back alignment and structure |
|---|
| >1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A | Back alignment and structure |
|---|
| >1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* | Back alignment and structure |
|---|
| >1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 | Back alignment and structure |
|---|
| >3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* | Back alignment and structure |
|---|
| >1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 | Back alignment and structure |
|---|
| >3g8y_A SUSD/RAGB-associated esterase-like protein; structural genom joint center for structural genomics, JCSG; HET: MSE; 1.90A {Bacteroides vulgatus atcc 8482} | Back alignment and structure |
|---|
| >3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A | Back alignment and structure |
|---|
| >3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A | Back alignment and structure |
|---|
| >2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* | Back alignment and structure |
|---|
| >3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* | Back alignment and structure |
|---|
| >2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* | Back alignment and structure |
|---|
| >4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp} | Back alignment and structure |
|---|
| >3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* | Back alignment and structure |
|---|
| >1sfr_A Antigen 85-A; alpha/beta hydrolase, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 2.70A {Mycobacterium tuberculosis} SCOP: c.69.1.3 | Back alignment and structure |
|---|
| >2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 | Back alignment and structure |
|---|
| >3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A | Back alignment and structure |
|---|
| >1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A | Back alignment and structure |
|---|
| >2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} | Back alignment and structure |
|---|
| >3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A | Back alignment and structure |
|---|
| >1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A | Back alignment and structure |
|---|
| >3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* | Back alignment and structure |
|---|
| >3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822} | Back alignment and structure |
|---|
| >3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} | Back alignment and structure |
|---|
| >1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 | Back alignment and structure |
|---|
| >3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum} | Back alignment and structure |
|---|
| >2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P | Back alignment and structure |
|---|
| >3nuz_A Putative acetyl xylan esterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; 2.30A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1r88_A MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBPC1, immune system; 1.71A {Mycobacterium tuberculosis} SCOP: c.69.1.3 | Back alignment and structure |
|---|
| >3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A | Back alignment and structure |
|---|
| >1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 | Back alignment and structure |
|---|
| >2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 | Back alignment and structure |
|---|
| >3g02_A Epoxide hydrolase; alpha/beta hydrolase fold, enantioselective, mutant, directed evolution; 1.50A {Aspergillus niger} SCOP: c.69.1.11 PDB: 1qo7_A 3g0i_A* | Back alignment and structure |
|---|
| >2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 | Back alignment and structure |
|---|
| >2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* | Back alignment and structure |
|---|
| >3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} | Back alignment and structure |
|---|
| >2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 | Back alignment and structure |
|---|
| >2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A | Back alignment and structure |
|---|
| >3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A* | Back alignment and structure |
|---|
| >2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A | Back alignment and structure |
|---|
| >2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* | Back alignment and structure |
|---|
| >3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} | Back alignment and structure |
|---|
| >2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 | Back alignment and structure |
|---|
| >3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} | Back alignment and structure |
|---|
| >3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A | Back alignment and structure |
|---|
| >2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* | Back alignment and structure |
|---|
| >1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 | Back alignment and structure |
|---|
| >2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A | Back alignment and structure |
|---|
| >3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A | Back alignment and structure |
|---|
| >3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* | Back alignment and structure |
|---|
| >3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... | Back alignment and structure |
|---|
| >4f21_A Carboxylesterase/phospholipase family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Francisella tularensis subsp} | Back alignment and structure |
|---|
| >4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A | Back alignment and structure |
|---|
| >3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* | Back alignment and structure |
|---|
| >2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} | Back alignment and structure |
|---|
| >1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} | Back alignment and structure |
|---|
| >1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* | Back alignment and structure |
|---|
| >1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* | Back alignment and structure |
|---|
| >1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 | Back alignment and structure |
|---|
| >3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A | Back alignment and structure |
|---|
| >1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 | Back alignment and structure |
|---|
| >3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* | Back alignment and structure |
|---|
| >3lp5_A Putative cell surface hydrolase; structural genom PSI2, MCSG, protein structure initiative, midwest center FO structural genomics; 2.00A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} | Back alignment and structure |
|---|
| >3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A | Back alignment and structure |
|---|
| >1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 | Back alignment and structure |
|---|
| >4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A | Back alignment and structure |
|---|
| >3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} | Back alignment and structure |
|---|
| >2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3ds8_A LIN2722 protein; unkonwn function, structural genomics, PSI, MCSG, P structure initiative; 1.80A {Listeria innocua} | Back alignment and structure |
|---|
| >3icv_A Lipase B, CALB; circular permutation, cleavage on PAIR of basic residues, glycoprotein, hydrolase, lipid degradation, zymogen, disulf; HET: NAG BTB; 1.49A {Candida antarctica} PDB: 3icw_A* | Back alignment and structure |
|---|
| >3fle_A SE_1780 protein; structural genomics, APC61035.1, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.01A {Staphylococcus epidermidis} | Back alignment and structure |
|---|
| >2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} | Back alignment and structure |
|---|
| >1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A | Back alignment and structure |
|---|
| >1gkl_A Endo-1,4-beta-xylanase Y; hydrolase, esterase family 1, inactive mutant; HET: FER; 1.4A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1wb4_A* 1wb5_A* 1wb6_A* 1gkk_A* | Back alignment and structure |
|---|
| >4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans} | Back alignment and structure |
|---|
| >3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} | Back alignment and structure |
|---|
| >3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* | Back alignment and structure |
|---|
| >3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 | Back alignment and structure |
|---|
| >3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} | Back alignment and structure |
|---|
| >3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A | Back alignment and structure |
|---|
| >4fle_A Esterase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein, rossmann fold, HY; 2.10A {Yersinia enterocolitica subsp} | Back alignment and structure |
|---|
| >2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A* | Back alignment and structure |
|---|
| >1ei9_A Palmitoyl protein thioesterase 1; alpha/beta hydrolase, glycoprotein, hydrolase; HET: NDG NAG; 2.25A {Bos taurus} SCOP: c.69.1.13 PDB: 1eh5_A* 1exw_A* 3gro_A | Back alignment and structure |
|---|
| >1dqz_A 85C, protein (antigen 85-C); fibronectin, structural genomics, PSI, protein structure initiative, TB structural genomics consortium; 1.50A {Mycobacterium tuberculosis} SCOP: c.69.1.3 PDB: 3hrh_A 1dqy_A 1va5_A* 1f0n_A* 1f0p_A* | Back alignment and structure |
|---|
| >1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 | Back alignment and structure |
|---|
| >3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A | Back alignment and structure |
|---|
| >1jjf_A Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-xylan; feruloyl esterase, ferulic acid esterase, FAE_XYNZ, XYNZ, structural genomics; 1.75A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1jt2_A* | Back alignment and structure |
|---|
| >1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A | Back alignment and structure |
|---|
| >3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A | Back alignment and structure |
|---|
| >3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 | Back alignment and structure |
|---|
| >1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 | Back alignment and structure |
|---|
| >3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* | Back alignment and structure |
|---|
| >3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >4hvt_A Ritya.17583.B, post-proline cleaving enzyme; ssgcid, structural genomics, S structural genomics center for infectious disease; 1.70A {Rickettsia typhi} | Back alignment and structure |
|---|
| >3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* | Back alignment and structure |
|---|
| >1ycd_A Hypothetical 27.3 kDa protein in AAP1-SMF2 intergenic region; esterase, lipase, serine hydrolase, structural genomics; HET: LI5; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} | Back alignment and structure |
|---|
| >1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} | Back alignment and structure |
|---|
| >4fhz_A Phospholipase/carboxylesterase; alpha/beta hydrolase superfamily, central beta-STR sheet, flanked alpha helices, hydrolase; 2.01A {Rhodobacter sphaeroides} PDB: 4ftw_A* | Back alignment and structure |
|---|
| >4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* | Back alignment and structure |
|---|
| >3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A | Back alignment and structure |
|---|
| >2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* | Back alignment and structure |
|---|
| >3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >4ao6_A Esterase; hydrolase, thermo label; 1.60A {Unidentified} PDB: 4ao7_A 4ao8_A | Back alignment and structure |
|---|
| >4go6_A HCF N-terminal chain 1; tandem fibronectin repeat, protein interaction, transcriptio protein binding; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3tjm_A Fatty acid synthase; thioesterase domain, fatty acid synthesis, hydrolase-hydrola inhibitor complex; HET: 7FA; 1.48A {Homo sapiens} PDB: 1xkt_A | Back alignment and structure |
|---|
| >3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A | Back alignment and structure |
|---|
| >1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 | Back alignment and structure |
|---|
| >3j20_A 30S ribosomal protein S3AE; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A* | Back alignment and structure |
|---|
| >2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens} | Back alignment and structure |
|---|
| >3bdv_A Uncharacterized protein DUF1234; DUF1234 family protein, alpha/beta-hydrolases fold, structur genomics; HET: MSE; 1.66A {Pectobacterium atrosepticum SCRI1043} | Back alignment and structure |
|---|
| >2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 64 | ||||
| d1k8qa_ | 377 | c.69.1.6 (A:) Gastric lipase {Dog (Canis familiari | 8e-18 | |
| d1azwa_ | 313 | c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas | 9e-05 | |
| d1wm1a_ | 313 | c.69.1.7 (A:) Proline aminopeptidase {Serratia mar | 1e-04 |
| >d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Length = 377 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: alpha/beta-Hydrolases superfamily: alpha/beta-Hydrolases family: Gastric lipase domain: Gastric lipase species: Dog (Canis familiaris) [TaxId: 9615]
Score = 72.8 bits (177), Expect = 8e-18
Identities = 25/72 (34%), Positives = 34/72 (47%), Gaps = 8/72 (11%)
Query: 1 MRTDDMIRFWNYPSEEHKILTEDGYILTVFRIPNP--------GGYPVLMLHGLTVSSDC 52
M MI +W YP+EE++++TEDGYIL + RIP + HGL S+
Sbjct: 14 MNISQMITYWGYPAEEYEVVTEDGYILGIDRIPYGRKNSENIGRRPVAFLQHGLLASATN 73
Query: 53 WFLRTPKEDLGR 64
W P L
Sbjct: 74 WISNLPNNSLAF 85
|
| >d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} Length = 313 | Back information, alignment and structure |
|---|
| >d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} Length = 313 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 64 | |||
| d1k8qa_ | 377 | Gastric lipase {Dog (Canis familiaris) [TaxId: 961 | 99.85 | |
| d1wm1a_ | 313 | Proline aminopeptidase {Serratia marcescens [TaxId | 98.35 | |
| d1bn7a_ | 291 | Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 | 98.09 | |
| d1azwa_ | 313 | Proline iminopeptidase {Xanthomonas campestris, pv | 97.91 | |
| d1a8qa_ | 274 | Bromoperoxidase A1 {Streptomyces aureofaciens [Tax | 97.89 | |
| d1a88a_ | 275 | Chloroperoxidase L {Streptomyces lividans [TaxId: | 97.68 | |
| d1thta_ | 302 | Myristoyl-ACP-specific thioesterase {Vibrio harvey | 97.6 | |
| d1b6ga_ | 310 | Haloalkane dehalogenase {Xanthobacter autotrophicu | 97.32 | |
| d1zd3a2 | 322 | Mammalian epoxide hydrolase, C-terminal domain {Hu | 97.31 | |
| d1a8sa_ | 273 | Chloroperoxidase F {Pseudomonas fluorescens [TaxId | 97.25 | |
| d1va4a_ | 271 | Arylesterase {Pseudomonas fluorescens [TaxId: 294] | 97.15 | |
| d1mj5a_ | 298 | Haloalkane dehalogenase {Sphingomonas paucimobilis | 97.09 | |
| d1ehya_ | 293 | Bacterial epoxide hydrolase {Agrobacterium radioba | 96.98 | |
| d2r8ba1 | 203 | Uncharacterized protein Atu2452 {Agrobacterium tum | 96.97 | |
| d1hkha_ | 279 | Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] | 96.97 | |
| d1brta_ | 277 | Bromoperoxidase A2 {Streptomyces aureofaciens [Tax | 96.92 | |
| d1l7aa_ | 318 | Cephalosporin C deacetylase {Bacillus subtilis [Ta | 96.84 | |
| d1j1ia_ | 268 | Meta cleavage compound hydrolase CarC {Janthinobac | 96.68 | |
| d2jbwa1 | 360 | 2,6-dihydropseudooxynicotine hydrolase {Arthrobact | 96.66 | |
| d1uk8a_ | 271 | Meta-cleavage product hydrolase CumD {Pseudomonas | 96.58 | |
| d1mtza_ | 290 | Tricorn interacting factor F1 {Archaeon Thermoplas | 96.5 | |
| d1xkta_ | 286 | Fatty acid synthase {Human (Homo sapiens) [TaxId: | 96.36 | |
| d1pjaa_ | 268 | Palmitoyl protein thioesterase 2 {Human (Homo sapi | 96.35 | |
| d1r3da_ | 264 | Hypothetical protein VC1974 {Vibrio cholerae [TaxI | 96.02 | |
| d1c4xa_ | 281 | 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas | 95.75 | |
| d1q0ra_ | 297 | Aclacinomycin methylesterase RdmC {Streptomyces pu | 95.55 | |
| d1qlwa_ | 318 | A novel bacterial esterase {Alcaligenes sp. [TaxId | 95.41 | |
| d1xkla_ | 258 | Salicylic acid-binding protein 2 (SABP2) {Common t | 95.2 | |
| d2hu7a2 | 260 | Acylamino-acid-releasing enzyme, C-terminal donain | 95.09 | |
| d2rhwa1 | 283 | 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas | 94.94 | |
| d1qo7a_ | 394 | Bacterial epoxide hydrolase {Aspergillus niger [Ta | 94.72 | |
| d1tqha_ | 242 | Carboxylesterase Est {Bacillus stearothermophilus | 94.69 | |
| d1vlqa_ | 322 | Acetyl xylan esterase TM0077 {Thermotoga maritima | 94.65 | |
| d1qfma2 | 280 | Prolyl oligopeptidase, C-terminal domain {Pig (Sus | 94.64 | |
| d1ispa_ | 179 | Lipase A {Bacillus subtilis [TaxId: 1423]} | 94.25 | |
| d1sfra_ | 288 | Antigen 85a {Mycobacterium tuberculosis [TaxId: 17 | 94.22 | |
| d1m33a_ | 256 | Biotin biosynthesis protein BioH {Escherichia coli | 94.0 | |
| d1cvla_ | 319 | Lipase {Chromobacterium viscosum [TaxId: 42739]} | 92.81 | |
| d2h1ia1 | 202 | Carboxylesterase {Bacillus cereus [TaxId: 1396]} | 92.72 | |
| d3b5ea1 | 209 | Uncharacterized protein Mll8374 {Mesorhizobium lot | 92.45 | |
| d1jmkc_ | 230 | Surfactin synthetase, SrfA {Bacillus subtilis [Tax | 92.42 | |
| d1imja_ | 208 | Ccg1/TafII250-interacting factor B (Cib) {Human (H | 92.01 | |
| d1ufoa_ | 238 | Hypothetical protein TT1662 {Thermus thermophilus | 91.62 | |
| d1dina_ | 233 | Dienelactone hydrolase {Pseudomonas sp., B13 [TaxI | 90.91 | |
| d1ex9a_ | 285 | Lipase {Pseudomonas aeruginosa [TaxId: 287]} | 90.9 | |
| d1auoa_ | 218 | Carboxylesterase {Pseudomonas fluorescens [TaxId: | 90.75 | |
| d2gzsa1 | 265 | Enterobactin and salmochelin hydrolase IroE {Esche | 89.81 | |
| d1ei9a_ | 279 | Palmitoyl protein thioesterase 1 {Cow (Bos taurus) | 89.24 | |
| d1r88a_ | 267 | Antigen pt51/mpb51 {Mycobacterium tuberculosis [Ta | 88.8 | |
| d1dqza_ | 280 | Antigen 85c {Mycobacterium tuberculosis [TaxId: 17 | 88.5 | |
| d1jkma_ | 358 | Carboxylesterase {Bacillus subtilis, brefeldin A e | 88.21 | |
| d1tcaa_ | 317 | Triacylglycerol lipase {Yeast (Candida antarctica) | 87.97 | |
| d1jjfa_ | 255 | Feruloyl esterase domain of the cellulosomal xylan | 86.41 | |
| d1zyla1 | 325 | RdoA {Escherichia coli [TaxId: 562]} | 86.01 | |
| d1lzla_ | 317 | Heroin esterase {Rhodococcus sp. [TaxId: 1831]} | 85.76 | |
| d1wb4a1 | 273 | Feruloyl esterase domain of the cellulosomal xylan | 85.49 | |
| d1ju3a2 | 347 | Bacterial cocaine esterase N-terminal domain {Rhod | 85.36 | |
| d2bgra2 | 258 | Dipeptidyl peptidase IV/CD26, C-terminal domain {P | 85.01 | |
| d1jjia_ | 311 | Carboxylesterase {Archaeon Archaeoglobus fulgidus | 84.16 | |
| d1uxoa_ | 186 | Hypothetical protein YdeN {Bacillus subtilis [TaxI | 83.98 | |
| d2dsta1 | 122 | Hypothetical protein TTHA1544 {Thermus thermophilu | 82.18 | |
| d2pbla1 | 261 | Uncharacterized protein TM1040_2492 {Silicibacter | 81.89 | |
| d1mpxa2 | 381 | Alpha-amino acid ester hydrolase {Xanthomonas citr | 81.54 | |
| d1fj2a_ | 229 | Acyl protein thioesterase 1 {Human (Homo sapiens) | 80.59 |
| >d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: alpha/beta-Hydrolases superfamily: alpha/beta-Hydrolases family: Gastric lipase domain: Gastric lipase species: Dog (Canis familiaris) [TaxId: 9615]
Probab=99.85 E-value=4e-22 Score=128.07 Aligned_cols=63 Identities=41% Similarity=0.821 Sum_probs=56.9
Q ss_pred CCHHHHHhhcCCcceEEEEecCCCcEEEEEEecCCC-------Ccc-EEEecccccCcccceecCCCCCCC
Q psy1426 1 MRTDDMIRFWNYPSEEHKILTEDGYILTVFRIPNPG-------GYP-VLMLHGLTVSSDCWFLRTPKEDLG 63 (64)
Q Consensus 1 ~~~~~~i~~~gy~~e~h~v~T~DGyiL~l~Ri~~~~-------~~p-VlL~HGl~~ss~~wv~~gp~~SLa 63 (64)
|+++|+|+.+|||.|+|.|+|+|||.|++|||+.++ +|| |||+||+.+|+.+|..+.+.+|||
T Consensus 14 ~~~~~~~~~~~y~~e~h~v~t~DG~~l~~~ri~~~~~~~~~~~~~~~vlllHG~~~~~~~~~~~~~~~sla 84 (377)
T d1k8qa_ 14 MNISQMITYWGYPAEEYEVVTEDGYILGIDRIPYGRKNSENIGRRPVAFLQHGLLASATNWISNLPNNSLA 84 (377)
T ss_dssp CCHHHHHHHTTCCCEEEEEECTTSEEEEEEEECSCSSCCTTTTTCCEEEEECCTTCCGGGGSSSCTTTCHH
T ss_pred CCHHHHHHHcCCCceEEEEEcCCCCEEEEEEecCCCCCCccCCCCCeEEEECCCccchhHHhhcCccchHH
Confidence 689999999999999999999999999999997542 345 999999999999999999888875
|
| >d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} | Back information, alignment and structure |
|---|
| >d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} | Back information, alignment and structure |
|---|
| >d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} | Back information, alignment and structure |
|---|
| >d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} | Back information, alignment and structure |
|---|
| >d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} | Back information, alignment and structure |
|---|
| >d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} | Back information, alignment and structure |
|---|
| >d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} | Back information, alignment and structure |
|---|
| >d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} | Back information, alignment and structure |
|---|
| >d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} | Back information, alignment and structure |
|---|
| >d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} | Back information, alignment and structure |
|---|
| >d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} | Back information, alignment and structure |
|---|
| >d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} | Back information, alignment and structure |
|---|
| >d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} | Back information, alignment and structure |
|---|
| >d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} | Back information, alignment and structure |
|---|
| >d1qlwa_ c.69.1.15 (A:) A novel bacterial esterase {Alcaligenes sp. [TaxId: 512]} | Back information, alignment and structure |
|---|
| >d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} | Back information, alignment and structure |
|---|
| >d1qo7a_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]} | Back information, alignment and structure |
|---|
| >d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1qfma2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1sfra_ c.69.1.3 (A:) Antigen 85a {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]} | Back information, alignment and structure |
|---|
| >d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} | Back information, alignment and structure |
|---|
| >d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1dina_ c.69.1.9 (A:) Dienelactone hydrolase {Pseudomonas sp., B13 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1auoa_ c.69.1.14 (A:) Carboxylesterase {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d2gzsa1 c.69.1.38 (A:41-305) Enterobactin and salmochelin hydrolase IroE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ei9a_ c.69.1.13 (A:) Palmitoyl protein thioesterase 1 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1r88a_ c.69.1.3 (A:) Antigen pt51/mpb51 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1dqza_ c.69.1.3 (A:) Antigen 85c {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1jkma_ c.69.1.2 (A:) Carboxylesterase {Bacillus subtilis, brefeldin A esterase [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]} | Back information, alignment and structure |
|---|
| >d1jjfa_ c.69.1.2 (A:) Feruloyl esterase domain of the cellulosomal xylanase z {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d1zyla1 d.144.1.6 (A:4-328) RdoA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1lzla_ c.69.1.2 (A:) Heroin esterase {Rhodococcus sp. [TaxId: 1831]} | Back information, alignment and structure |
|---|
| >d1wb4a1 c.69.1.2 (A:803-1075) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d1ju3a2 c.69.1.21 (A:5-351) Bacterial cocaine esterase N-terminal domain {Rhodococcus sp. mb1 [TaxId: 51612]} | Back information, alignment and structure |
|---|
| >d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1jjia_ c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2dsta1 c.69.1.39 (A:2-123) Hypothetical protein TTHA1544 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2pbla1 c.69.1.2 (A:1-261) Uncharacterized protein TM1040_2492 {Silicibacter sp. tm1040 [TaxId: 292414]} | Back information, alignment and structure |
|---|
| >d1mpxa2 c.69.1.21 (A:24-404) Alpha-amino acid ester hydrolase {Xanthomonas citri [TaxId: 346]} | Back information, alignment and structure |
|---|
| >d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|