Psyllid ID: psy14311


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------20
MKGIYRRNSIWDKLVFKKVQEDMGGNLRLMLAGSAPLAGNVLTFLRCALGCLVIEGYGQTECVAPITLTIQGDYVPEHVGPPICCCSVKLVDVPEMDYFAHEGKGEVCVRGNNVFLGYFKDPELNSIDELGWHHTGDVGMWLPTLFFFFIPMLVIMLMYTRIGLRIRSRSRHSLGKRVEGTVHGETKRSQSRKSIIRML
ccccccccHHHHHHHHHHHHHHccccEEEEEEccccccHHHHHHHHHHHcccEEEEccHHcccccccccccccccccccccccccEEEEEEEcccccccccccccEEEEccccccccccccccccccccccccccccEEEEcccccEEEEcccccEEEEccccEEEccHHHHHHHHcccEEEEEEEEccccccEEEEEc
cccEEcccHHHHHHHHHHHHHHHcccEEEEEEccccccHHHHHHHHHHHccEEEEcccccccccEEEEccccccccccccccccccEEEEEEcccccccccccccEEEEEcccEEEEccccHHHccccccccEEccccccEccccEEEEEEccHcHEEEcccccEccccccccccEEEEEEEccccHHHHEEEEEEEcc
mkgiyrrnsiwDKLVFKKVQEDmggnlrlmlagsaplagNVLTFLRCALGCLviegygqtecvapitltiqgdyvpehvgppicccsvklvdvpemdyfahegkgevcvrgnnvflgyfkdpelnsidelgwhhtgdvgmwlptLFFFFIPMLVIMLMYTRIGlrirsrsrhslgkrvegtvhgetkrsqSRKSIIRML
mkgiyrrnsiwdklvFKKVQEDMGGNLRLMLAGSAPLAGNVLTFLRCALGCLVIEGYGQTECVAPITLTIQGDYVPEHVGPPICCCSVKLVDVPEMDYFAHEGKGEVCVRGNNVFLGYFKDPELNSIDELGWHHTGDVGMWLPTLFFFFIPMLVIMLMYTRIGLRirsrsrhslgkrvegtvhgetkrsqsrksiirml
MKGIYRRNSIWDKLVFKKVQEDMGGNLRLMLAGSAPLAGNVLTFLRCALGCLVIEGYGQTECVAPITLTIQGDYVPEHVGPPICCCSVKLVDVPEMDYFAHEGKGEVCVRGNNVFLGYFKDPELNSIDELGWHHTGDVGMWLPTLFFFFIPMLVIMLMYTRIGLRIRSRSRHSLGKRVEGTVHGETKRSQSRKSIIRML
***IYRRNSIWDKLVFKKVQEDMGGNLRLMLAGSAPLAGNVLTFLRCALGCLVIEGYGQTECVAPITLTIQGDYVPEHVGPPICCCSVKLVDVPEMDYFAHEGKGEVCVRGNNVFLGYFKDPELNSIDELGWHHTGDVGMWLPTLFFFFIPMLVIMLMYTRIGLRIR********************************
****YRRNSIWDKLVFKKVQEDMGGNLRLMLAGSAPLAGNVLTFLRCALGCLVIEGYGQTECVAPITLTIQGDYVPEHVGPPICCCSVKLVDVPEMDYFAHEGKGEVCVRGNNVFLGYFKDPELNSIDELGWHHTGDVGMWLPTLFFFFIPMLVIMLMYTRIGLRIRSRSRHSLGKRVEGTVHGETKRSQSRKSIIRML
MKGIYRRNSIWDKLVFKKVQEDMGGNLRLMLAGSAPLAGNVLTFLRCALGCLVIEGYGQTECVAPITLTIQGDYVPEHVGPPICCCSVKLVDVPEMDYFAHEGKGEVCVRGNNVFLGYFKDPELNSIDELGWHHTGDVGMWLPTLFFFFIPMLVIMLMYTRIGLRIRSRSR****************************
*KGIYRRNSIWDKLVFKKVQEDMGGNLRLMLAGSAPLAGNVLTFLRCALGCLVIEGYGQTECVAPITLTIQGDYVPEHVGPPICCCSVKLVDVPEMDYFAHEGKGEVCVRGNNVFLGYFKDPELNSIDELGWHHTGDVGMWLPTLFFFFIPMLVIMLMYTRIGLRIRSRSRHSLGKRVEGTVHGETKRSQSRKSIIRML
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKGIYRRNSIWDKLVFKKVQEDMGGNLRLMLAGSAPLAGNVLTFLRCALGCLVIEGYGQTECVAPITLTIQGDYVPEHVGPPICCCSVKLVDVPEMDYFAHEGKGEVCVRGNNVFLGYFKDPELNSIDELGWHHTGDVGMWLPTLFFFFIPMLVIMLMYTRIGLRIRSRSRHSLGKRVEGTVHGETKRSQSRKSIIRML
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query199 2.2.26 [Sep-21-2011]
Q9JID6698 Long-chain-fatty-acid--Co yes N/A 0.713 0.203 0.569 3e-45
P41216699 Long-chain-fatty-acid--Co yes N/A 0.713 0.203 0.576 3e-45
P33121698 Long-chain-fatty-acid--Co yes N/A 0.713 0.203 0.583 4e-45
O88813683 Long-chain-fatty-acid--Co yes N/A 0.713 0.207 0.555 1e-44
P18163699 Long-chain-fatty-acid--Co no N/A 0.713 0.203 0.562 3e-44
Q8JZR0683 Long-chain-fatty-acid--Co no N/A 0.713 0.207 0.541 2e-43
Q9ULC5683 Long-chain-fatty-acid--Co no N/A 0.723 0.210 0.513 3e-42
Q9UKU0697 Long-chain-fatty-acid--Co no N/A 0.713 0.203 0.548 3e-42
P33124697 Long-chain-fatty-acid--Co no N/A 0.708 0.202 0.531 4e-41
Q91WC3697 Long-chain-fatty-acid--Co no N/A 0.708 0.202 0.531 8e-41
>sp|Q9JID6|ACSL1_CAVPO Long-chain-fatty-acid--CoA ligase 1 OS=Cavia porcellus GN=ACSL1 PE=2 SV=1 Back     alignment and function desciption
 Score =  181 bits (459), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 82/144 (56%), Positives = 104/144 (72%), Gaps = 2/144 (1%)

Query: 3   GIYRRNSIWDKLVFKKVQEDMGGNLRLMLAGSAPLAGNVLTFLRCALGCLVIEGYGQTEC 62
           GI R NS+WDKL+F K+Q  +GG +RLM+ G+AP++  VLTFLR ALGC   EGYGQTEC
Sbjct: 404 GIIRNNSVWDKLIFHKIQSSLGGKVRLMVTGAAPVSATVLTFLRAALGCQFYEGYGQTEC 463

Query: 63  VAPITLTIQGDYVPEHVGPPICCCSVKLVDVPEMDYFAHEGKGEVCVRGNNVFLGYFKDP 122
            A  +L++ GD+   HVG P+ C  +KLVDV EM+Y A  G+GEVCV+G NVF GY KDP
Sbjct: 464 TAGCSLSVPGDWTAGHVGAPMPCNFIKLVDVEEMNYMAAMGEGEVCVKGPNVFKGYLKDP 523

Query: 123 E--LNSIDELGWHHTGDVGMWLPT 144
                ++D+ GW HTGD+G WLP 
Sbjct: 524 AKTAEALDKDGWLHTGDIGKWLPN 547




Activation of long-chain fatty acids for both synthesis of cellular lipids, and degradation via beta-oxidation. Preferentially uses palmitoleate, oleate and linoleate.
Cavia porcellus (taxid: 10141)
EC: 6EC: .EC: 2EC: .EC: 1EC: .EC: 3
>sp|P41216|ACSL1_MOUSE Long-chain-fatty-acid--CoA ligase 1 OS=Mus musculus GN=Acsl1 PE=1 SV=2 Back     alignment and function description
>sp|P33121|ACSL1_HUMAN Long-chain-fatty-acid--CoA ligase 1 OS=Homo sapiens GN=ACSL1 PE=1 SV=1 Back     alignment and function description
>sp|O88813|ACSL5_RAT Long-chain-fatty-acid--CoA ligase 5 OS=Rattus norvegicus GN=Acsl5 PE=2 SV=1 Back     alignment and function description
>sp|P18163|ACSL1_RAT Long-chain-fatty-acid--CoA ligase 1 OS=Rattus norvegicus GN=Acsl1 PE=1 SV=1 Back     alignment and function description
>sp|Q8JZR0|ACSL5_MOUSE Long-chain-fatty-acid--CoA ligase 5 OS=Mus musculus GN=Acsl5 PE=2 SV=1 Back     alignment and function description
>sp|Q9ULC5|ACSL5_HUMAN Long-chain-fatty-acid--CoA ligase 5 OS=Homo sapiens GN=ACSL5 PE=1 SV=1 Back     alignment and function description
>sp|Q9UKU0|ACSL6_HUMAN Long-chain-fatty-acid--CoA ligase 6 OS=Homo sapiens GN=ACSL6 PE=2 SV=4 Back     alignment and function description
>sp|P33124|ACSL6_RAT Long-chain-fatty-acid--CoA ligase 6 OS=Rattus norvegicus GN=Acsl6 PE=1 SV=1 Back     alignment and function description
>sp|Q91WC3|ACSL6_MOUSE Long-chain-fatty-acid--CoA ligase 6 OS=Mus musculus GN=Acsl6 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query199
332026916 623 Long-chain-fatty-acid--CoA ligase 1 [Acr 0.718 0.229 0.765 4e-63
242009014 681 Long-chain-fatty-acid--CoA ligase, putat 0.718 0.209 0.731 9e-63
380021425 657 PREDICTED: long-chain-fatty-acid--CoA li 0.718 0.217 0.744 3e-62
48105753 657 PREDICTED: long-chain-fatty-acid--CoA li 0.718 0.217 0.744 3e-62
350422663 657 PREDICTED: long-chain-fatty-acid--CoA li 0.718 0.217 0.744 6e-62
340723943 619 PREDICTED: long-chain-fatty-acid--CoA li 0.718 0.231 0.744 7e-62
91088831 721 PREDICTED: similar to CG3961 CG3961-PA [ 0.718 0.198 0.758 1e-61
383857835 657 PREDICTED: long-chain-fatty-acid--CoA li 0.718 0.217 0.724 1e-61
307211960 681 Long-chain-fatty-acid--CoA ligase 1 [Har 0.718 0.209 0.765 1e-61
307178356 633 Long-chain-fatty-acid--CoA ligase 1 [Cam 0.718 0.225 0.731 5e-61
>gi|332026916|gb|EGI67017.1| Long-chain-fatty-acid--CoA ligase 1 [Acromyrmex echinatior] Back     alignment and taxonomy information
 Score =  246 bits (628), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 111/145 (76%), Positives = 125/145 (86%), Gaps = 2/145 (1%)

Query: 2   KGIYRRNSIWDKLVFKKVQEDMGGNLRLMLAGSAPLAGNVLTFLRCALGCLVIEGYGQTE 61
           K I R NSIWDK+VFKK+QE MGG LRLML GSAPLAGNVLTF+RCALGC+V+EGYGQTE
Sbjct: 329 KSIVRMNSIWDKIVFKKIQESMGGKLRLMLVGSAPLAGNVLTFIRCALGCVVVEGYGQTE 388

Query: 62  CVAPITLTIQGDYVPEHVGPPICCCSVKLVDVPEMDYFAHEGKGEVCVRGNNVFLGYFKD 121
           C APITLTIQGD+VPEHVGPP+ CC VKLVDVPEM+YFA   +GEVCV+G NVF+GY+KD
Sbjct: 389 CTAPITLTIQGDHVPEHVGPPVACCCVKLVDVPEMEYFATNNQGEVCVKGANVFMGYYKD 448

Query: 122 PELNS--IDELGWHHTGDVGMWLPT 144
           PE  +  IDE GWHHTGD+GMW P 
Sbjct: 449 PEKTAEVIDEQGWHHTGDIGMWQPN 473




Source: Acromyrmex echinatior

Species: Acromyrmex echinatior

Genus: Acromyrmex

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|242009014|ref|XP_002425288.1| Long-chain-fatty-acid--CoA ligase, putative [Pediculus humanus corporis] gi|212509053|gb|EEB12550.1| Long-chain-fatty-acid--CoA ligase, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|380021425|ref|XP_003694566.1| PREDICTED: long-chain-fatty-acid--CoA ligase 1-like [Apis florea] Back     alignment and taxonomy information
>gi|48105753|ref|XP_395996.1| PREDICTED: long-chain-fatty-acid--CoA ligase 1-like [Apis mellifera] Back     alignment and taxonomy information
>gi|350422663|ref|XP_003493242.1| PREDICTED: long-chain-fatty-acid--CoA ligase 1-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340723943|ref|XP_003400346.1| PREDICTED: long-chain-fatty-acid--CoA ligase 1-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|91088831|ref|XP_970461.1| PREDICTED: similar to CG3961 CG3961-PA [Tribolium castaneum] gi|270012333|gb|EFA08781.1| hypothetical protein TcasGA2_TC006471 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|383857835|ref|XP_003704409.1| PREDICTED: long-chain-fatty-acid--CoA ligase 1-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|307211960|gb|EFN87872.1| Long-chain-fatty-acid--CoA ligase 1 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|307178356|gb|EFN67105.1| Long-chain-fatty-acid--CoA ligase 1 [Camponotus floridanus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query199
FB|FBgn0036821704 CG3961 [Drosophila melanogaste 0.713 0.201 0.736 1.9e-58
UNIPROTKB|Q1LZF6683 ACSL5 "Acyl-CoA synthetase lon 0.713 0.207 0.576 6.8e-45
UNIPROTKB|Q0VCZ8699 ACSL1 "Acyl-CoA synthetase lon 0.708 0.201 0.587 7.3e-45
ZFIN|ZDB-GENE-050809-115697 acsl1 "acyl-CoA synthetase lon 0.708 0.202 0.594 9.2e-45
ZFIN|ZDB-GENE-040912-169681 acsl5 "acyl-CoA synthetase lon 0.718 0.209 0.572 2e-44
ZFIN|ZDB-GENE-040801-88 729 zgc:101071 "zgc:101071" [Danio 0.718 0.196 0.602 2.4e-44
UNIPROTKB|Q5F420699 ACSL1 "Uncharacterized protein 0.708 0.201 0.580 3.6e-44
UNIPROTKB|F1RSZ3699 ACSL1 "Uncharacterized protein 0.708 0.201 0.580 1e-43
UNIPROTKB|B7Z3Z9527 ACSL1 "Long-chain-fatty-acid-- 0.708 0.267 0.587 1.3e-43
UNIPROTKB|E7EPM6664 ACSL1 "Long-chain-fatty-acid-- 0.708 0.212 0.587 1.6e-43
FB|FBgn0036821 CG3961 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 600 (216.3 bits), Expect = 1.9e-58, P = 1.9e-58
 Identities = 106/144 (73%), Positives = 122/144 (84%)

Query:     2 KGIYRRNSIWDKLVFKKVQEDMGGNLRLMLAGSAPLAGNVLTFLRCALGCLVIEGYGQTE 61
             +G+ RRN  WDKLVFKKV +  GGNLRLM+ GSAPLAGNVLTF+RCALGCLV+EGYGQTE
Sbjct:   410 RGVLRRNGCWDKLVFKKVHQAFGGNLRLMVVGSAPLAGNVLTFMRCALGCLVLEGYGQTE 469

Query:    62 CVAPITLTIQGDYVPEHVGPPICCCSVKLVDVPEMDYFAHEGKGEVCVRGNNVFLGYFKD 121
             C   ITLT+QGD+VP HVGPP+ C +VKLVDVPEM+YFA++  GEVCVRG+NVF GY+KD
Sbjct:   470 CTGAITLTVQGDHVPNHVGPPVSCNAVKLVDVPEMEYFANQNTGEVCVRGSNVFHGYYKD 529

Query:   122 PE--LNSIDELGWHHTGDVGMWLP 143
             PE    +ID  GWHHTGDVGMWLP
Sbjct:   530 PEKTAEAIDSEGWHHTGDVGMWLP 553




GO:0004467 "long-chain fatty acid-CoA ligase activity" evidence=ISS
GO:0008152 "metabolic process" evidence=IEA
UNIPROTKB|Q1LZF6 ACSL5 "Acyl-CoA synthetase long-chain family member 5" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q0VCZ8 ACSL1 "Acyl-CoA synthetase long-chain family member 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050809-115 acsl1 "acyl-CoA synthetase long-chain family member 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040912-169 acsl5 "acyl-CoA synthetase long-chain family member 5" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040801-88 zgc:101071 "zgc:101071" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q5F420 ACSL1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1RSZ3 ACSL1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|B7Z3Z9 ACSL1 "Long-chain-fatty-acid--CoA ligase 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E7EPM6 ACSL1 "Long-chain-fatty-acid--CoA ligase 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9JID6ACSL1_CAVPO6, ., 2, ., 1, ., 30.56940.71350.2034yesN/A
P41216ACSL1_MOUSE6, ., 2, ., 1, ., 30.57630.71350.2031yesN/A
O88813ACSL5_RAT6, ., 2, ., 1, ., 30.55550.71350.2079yesN/A
P33121ACSL1_HUMAN6, ., 2, ., 1, ., 30.58330.71350.2034yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer6.2.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query199
cd05927539 cd05927, LC-FACS_euk, Eukaryotic long-chain fatty 6e-71
PLN02736651 PLN02736, PLN02736, long-chain acyl-CoA synthetase 5e-51
COG1022613 COG1022, FAA1, Long-chain acyl-CoA synthetases (AM 7e-36
cd05907456 cd05907, VL_LC_FACS_like, Long-chain fatty acid Co 5e-35
PLN02614 666 PLN02614, PLN02614, long-chain acyl-CoA synthetase 2e-32
PTZ00216700 PTZ00216, PTZ00216, acyl-CoA synthetase; Provision 5e-32
PLN02861660 PLN02861, PLN02861, long-chain-fatty-acid-CoA liga 1e-30
PLN02430660 PLN02430, PLN02430, long-chain-fatty-acid-CoA liga 4e-30
PLN02387696 PLN02387, PLN02387, long-chain-fatty-acid-CoA liga 2e-29
COG0318534 COG0318, CaiC, Acyl-CoA synthetases (AMP-forming)/ 1e-22
cd05911487 cd05911, Firefly_Luc_like, Firefly luciferase of l 8e-22
pfam00501412 pfam00501, AMP-binding, AMP-binding enzyme 1e-21
cd05909489 cd05909, AAS_C, C-terminal domain of the acyl-acyl 9e-21
cd05932504 cd05932, LC_FACS_bac, Bacterial long-chain fatty a 6e-20
cd04433338 cd04433, AFD_class_I, Adenylate forming domain, Cl 4e-19
cd05941430 cd05941, MCS, Malonyl-CoA synthetase (MCS) 5e-19
cd05917347 cd05917, FACL_like_2, Uncharacterized subfamily of 3e-18
cd05933 594 cd05933, ACSBG_like, Bubblegum-like very long-chai 1e-17
cd05936468 cd05936, FC-FACS_FadD_like, Prokaryotic long-chain 3e-17
cd05926345 cd05926, FACL_fum10p_like, Subfamily of fatty acid 1e-16
PRK07656513 PRK07656, PRK07656, long-chain-fatty-acid--CoA lig 2e-16
PRK06187521 PRK06187, PRK06187, long-chain-fatty-acid--CoA lig 2e-16
cd05929342 cd05929, BACL_like, Bacterial Bile acid CoA ligase 2e-16
cd05904504 cd05904, 4CL, 4-Coumarate-CoA Ligase (4CL) 5e-16
cd05935430 cd05935, LC_FACS_like, Putative long-chain fatty a 1e-13
cd05903437 cd05903, CHC_CoA_lg, Cyclohexanecarboxylate-CoA li 1e-13
PRK07787471 PRK07787, PRK07787, acyl-CoA synthetase; Validated 2e-13
cd12118520 cd12118, ttLC_FACS_AEE21_like, Fatty acyl-CoA synt 1e-12
cd05912407 cd05912, OSB_CoA_lg, O-succinylbenzoate-CoA ligase 2e-12
cd05945447 cd05945, DltA, D-alanine:D-alanyl carrier protein 6e-12
PRK086331146 PRK08633, PRK08633, 2-acyl-glycerophospho-ethanola 6e-12
PRK13295547 PRK13295, PRK13295, cyclohexanecarboxylate-CoA lig 9e-12
cd05944359 cd05944, FACL_like_4, Uncharacterized subfamily of 1e-11
cd12119517 cd12119, ttLC_FACS_AlkK_like, Fatty acyl-CoA synth 1e-11
TIGR01923436 TIGR01923, menE, O-succinylbenzoate-CoA ligase 2e-11
TIGR03208538 TIGR03208, cyc_hxne_CoA_lg, cyclohexanecarboxylate 3e-11
PLN02246537 PLN02246, PLN02246, 4-coumarate--CoA ligase 7e-11
PRK06188524 PRK06188, PRK06188, acyl-CoA synthetase; Validated 9e-11
PLN02330546 PLN02330, PLN02330, 4-coumarate--CoA ligase-like 1 9e-11
PRK12583558 PRK12583, PRK12583, acyl-CoA synthetase; Provision 1e-10
cd05921559 cd05921, FCS, Feruloyl-CoA synthetase (FCS) 2e-10
PRK08180 614 PRK08180, PRK08180, feruloyl-CoA synthase; Reviewe 2e-10
cd05920483 cd05920, 23DHB-AMP_lg, 2,3-dihydroxybenzoate-AMP l 4e-10
PTZ00342 746 PTZ00342, PTZ00342, acyl-CoA synthetase; Provision 6e-10
PRK07514504 PRK07514, PRK07514, malonyl-CoA synthase; Validate 1e-09
PRK05677562 PRK05677, PRK05677, long-chain-fatty-acid--CoA lig 2e-09
PRK07529 632 PRK07529, PRK07529, AMP-binding domain protein; Va 3e-09
PRK06710563 PRK06710, PRK06710, long-chain-fatty-acid--CoA lig 3e-09
PRK08315559 PRK08315, PRK08315, AMP-binding domain protein; Va 3e-09
PRK06087547 PRK06087, PRK06087, short chain acyl-CoA synthetas 4e-09
cd05934421 cd05934, FACL_DitJ_like, Uncharacterized subfamily 4e-09
PRK08974560 PRK08974, PRK08974, long-chain-fatty-acid--CoA lig 4e-09
PRK05605573 PRK05605, PRK05605, long-chain-fatty-acid--CoA lig 1e-08
TIGR01733409 TIGR01733, AA-adenyl-dom, amino acid adenylation d 2e-08
cd05971439 cd05971, MACS_like_3, Uncharacterized subfamily of 1e-07
PRK12492562 PRK12492, PRK12492, long-chain-fatty-acid--CoA lig 2e-07
cd05908499 cd05908, A_NRPS_MycA_like, The adenylation domain 2e-07
PRK068141140 PRK06814, PRK06814, acylglycerophosphoethanolamine 3e-07
cd05914448 cd05914, FACL_like_3, Uncharacterized subfamily of 3e-07
PRK12582 624 PRK12582, PRK12582, acyl-CoA synthetase; Provision 4e-07
PRK08751560 PRK08751, PRK08751, putative long-chain fatty acyl 4e-07
cd05972430 cd05972, MACS_like, Medium-chain acyl-CoA syntheta 5e-07
PRK03640483 PRK03640, PRK03640, O-succinylbenzoic acid--CoA li 5e-07
cd05930445 cd05930, A_NRPS, The adenylation domain of nonribo 5e-07
PRK06839496 PRK06839, PRK06839, acyl-CoA synthetase; Validated 1e-06
PRK09088488 PRK09088, PRK09088, acyl-CoA synthetase; Validated 2e-06
PRK07786542 PRK07786, PRK07786, long-chain-fatty-acid--CoA lig 2e-06
cd05906560 cd05906, A_NRPS_TubE_like, The adenylation domain 2e-06
cd05974433 cd05974, MACS_like_1, Uncharacterized subfamily of 3e-06
PRK07470528 PRK07470, PRK07470, acyl-CoA synthetase; Validated 5e-06
COG1020642 COG1020, EntF, Non-ribosomal peptide synthetase mo 8e-06
PRK08162545 PRK08162, PRK08162, acyl-CoA synthetase; Validated 9e-06
PLN02479567 PLN02479, PLN02479, acetate-CoA ligase 1e-05
PLN02574560 PLN02574, PLN02574, 4-coumarate--CoA ligase-like 1e-05
PRK06145497 PRK06145, PRK06145, acyl-CoA synthetase; Validated 1e-05
PRK06178567 PRK06178, PRK06178, acyl-CoA synthetase; Validated 1e-05
cd05973440 cd05973, MACS_like_2, Uncharacterized subfamily of 2e-05
PRK05852534 PRK05852, PRK05852, acyl-CoA synthetase; Validated 2e-05
PLN03102579 PLN03102, PLN03102, acyl-activating enzyme; Provis 3e-05
COG0365528 COG0365, Acs, Acyl-coenzyme A synthetases/AMP-(fat 4e-05
cd05970537 cd05970, MACS_AAE_MA_like, Medium-chain acyl-CoA s 5e-05
PRK07867529 PRK07867, PRK07867, acyl-CoA synthetase; Validated 8e-05
cd12117474 cd12117, A_NRPS_Srf_like, The adenylation domain o 8e-05
PRK06334539 PRK06334, PRK06334, long chain fatty acid--[acyl-c 9e-05
PRK08314546 PRK08314, PRK08314, long-chain-fatty-acid--CoA lig 9e-05
PRK09029458 PRK09029, PRK09029, O-succinylbenzoic acid--CoA li 1e-04
cd05931547 cd05931, FAAL, Fatty acyl-AMP ligase (FAAL) 3e-04
PRK09274552 PRK09274, PRK09274, peptide synthase; Provisional 4e-04
PRK08008517 PRK08008, caiC, putative crotonobetaine/carnitine- 4e-04
cd12114476 cd12114, A_NRPS_TlmIV_like, The adenylation domain 0.001
cd05928530 cd05928, MACS_euk, Eukaryotic Medium-chain acyl-Co 0.001
PRK08316523 PRK08316, PRK08316, acyl-CoA synthetase; Validated 0.001
PRK08043718 PRK08043, PRK08043, bifunctional acyl-[acyl carrie 0.002
cd05918447 cd05918, A_NRPS_SidN3_like, The adenylation (A) do 0.002
PRK07768545 PRK07768, PRK07768, long-chain-fatty-acid--CoA lig 0.002
pfam00001251 pfam00001, 7tm_1, 7 transmembrane receptor (rhodop 0.002
cd05922350 cd05922, FACL_like_6, Uncharacterized subfamily of 0.002
PRK04813503 PRK04813, PRK04813, D-alanine--poly(phosphoribitol 0.002
PRK06164540 PRK06164, PRK06164, acyl-CoA synthetase; Validated 0.002
PRK07008539 PRK07008, PRK07008, long-chain-fatty-acid--CoA lig 0.004
PRK09192579 PRK09192, PRK09192, acyl-CoA synthetase; Validated 0.004
cd12116438 cd12116, A_NRPS_Ta1_like, The adenylation domain o 0.004
>gnl|CDD|213293 cd05927, LC-FACS_euk, Eukaryotic long-chain fatty acid CoA synthetase (LC-FACS) Back     alignment and domain information
 Score =  223 bits (572), Expect = 6e-71
 Identities = 80/146 (54%), Positives = 102/146 (69%), Gaps = 4/146 (2%)

Query: 2   KGIYRRNSIWDKLVFKKVQEDMGGNLRLMLAGSAPLAGNVLTFLRCALGCLVIEGYGQTE 61
           +G    + +WDKLVFKK++  +GG +RLML+G APL+ +   FLR ALGC V++GYG TE
Sbjct: 246 RGHGYASPLWDKLVFKKIKAALGGRVRLMLSGGAPLSPDTQEFLRVALGCPVLQGYGLTE 305

Query: 62  CVAPITLTIQGDYVPEHVGPPICCCSVKLVDVPEMDYFA--HEGKGEVCVRGNNVFLGYF 119
             A  TL+  GD    HVGPP+ CC +KLVDVPEM YFA     +GE+C+RG NVF GY+
Sbjct: 306 TCAGGTLSDPGDTTTGHVGPPLPCCEIKLVDVPEMGYFAKDDPPRGEICIRGPNVFKGYY 365

Query: 120 KDPELNS--IDELGWHHTGDVGMWLP 143
           K+PE  +   DE GW HTGD+G WLP
Sbjct: 366 KNPEKTAEAFDEDGWFHTGDIGEWLP 391


The members of this family are eukaryotic fatty acid CoA synthetases that activate fatty acids with chain lengths of 12 to 20. LC-FACS catalyzes the formation of fatty acyl-CoA in a two-step reaction: the formation of a fatty acyl-AMP molecule as an intermediate, and the formation of a fatty acyl-CoA. This is a required step before free fatty acids can participate in most catabolic and anabolic reactions. Organisms tend to have multiple isoforms of LC-FACS genes with multiple splice variants. For example, nine genes are found in Arabidopsis and six genes are expressed in mammalian cells. Length = 539

>gnl|CDD|178337 PLN02736, PLN02736, long-chain acyl-CoA synthetase Back     alignment and domain information
>gnl|CDD|223953 COG1022, FAA1, Long-chain acyl-CoA synthetases (AMP-forming) [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|213275 cd05907, VL_LC_FACS_like, Long-chain fatty acid CoA synthetases and Bubblegum-like very long-chain fatty acid CoA synthetases Back     alignment and domain information
>gnl|CDD|166255 PLN02614, PLN02614, long-chain acyl-CoA synthetase Back     alignment and domain information
>gnl|CDD|240316 PTZ00216, PTZ00216, acyl-CoA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|178452 PLN02861, PLN02861, long-chain-fatty-acid-CoA ligase Back     alignment and domain information
>gnl|CDD|178049 PLN02430, PLN02430, long-chain-fatty-acid-CoA ligase Back     alignment and domain information
>gnl|CDD|215217 PLN02387, PLN02387, long-chain-fatty-acid-CoA ligase family protein Back     alignment and domain information
>gnl|CDD|223395 COG0318, CaiC, Acyl-CoA synthetases (AMP-forming)/AMP-acid ligases II [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|213279 cd05911, Firefly_Luc_like, Firefly luciferase of light emitting insects and 4-Coumarate-CoA Ligase (4CL) Back     alignment and domain information
>gnl|CDD|215954 pfam00501, AMP-binding, AMP-binding enzyme Back     alignment and domain information
>gnl|CDD|213277 cd05909, AAS_C, C-terminal domain of the acyl-acyl carrier protein synthetase (also called 2-acylglycerophosphoethanolamine acyltransferase, Aas) Back     alignment and domain information
>gnl|CDD|213298 cd05932, LC_FACS_bac, Bacterial long-chain fatty acid CoA synthetase (LC-FACS), including Marinobacter hydrocarbonoclasticus isoprenoid Coenzyme A synthetase Back     alignment and domain information
>gnl|CDD|213270 cd04433, AFD_class_I, Adenylate forming domain, Class I Back     alignment and domain information
>gnl|CDD|213307 cd05941, MCS, Malonyl-CoA synthetase (MCS) Back     alignment and domain information
>gnl|CDD|213284 cd05917, FACL_like_2, Uncharacterized subfamily of fatty acid CoA ligase (FACL) Back     alignment and domain information
>gnl|CDD|213299 cd05933, ACSBG_like, Bubblegum-like very long-chain fatty acid CoA synthetase (VL-FACS) Back     alignment and domain information
>gnl|CDD|213302 cd05936, FC-FACS_FadD_like, Prokaryotic long-chain fatty acid CoA synthetases similar to Escherichia coli FadD Back     alignment and domain information
>gnl|CDD|213292 cd05926, FACL_fum10p_like, Subfamily of fatty acid CoA ligase (FACL) similar to Fum10p of Gibberella moniliformis Back     alignment and domain information
>gnl|CDD|236072 PRK07656, PRK07656, long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|235730 PRK06187, PRK06187, long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|213295 cd05929, BACL_like, Bacterial Bile acid CoA ligases and similar proteins Back     alignment and domain information
>gnl|CDD|213272 cd05904, 4CL, 4-Coumarate-CoA Ligase (4CL) Back     alignment and domain information
>gnl|CDD|213301 cd05935, LC_FACS_like, Putative long-chain fatty acid CoA ligase Back     alignment and domain information
>gnl|CDD|213271 cd05903, CHC_CoA_lg, Cyclohexanecarboxylate-CoA ligase (also called cyclohex-1-ene-1-carboxylate:CoA ligase) Back     alignment and domain information
>gnl|CDD|236096 PRK07787, PRK07787, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|213326 cd12118, ttLC_FACS_AEE21_like, Fatty acyl-CoA synthetases similar to LC-FACS from Thermus thermophiles and Arabidopsis Back     alignment and domain information
>gnl|CDD|213280 cd05912, OSB_CoA_lg, O-succinylbenzoate-CoA ligase (also known as O-succinylbenzoate-CoA synthase, OSB-CoA synthetase, or MenE) Back     alignment and domain information
>gnl|CDD|213310 cd05945, DltA, D-alanine:D-alanyl carrier protein ligase (DltA) Back     alignment and domain information
>gnl|CDD|236315 PRK08633, PRK08633, 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>gnl|CDD|171961 PRK13295, PRK13295, cyclohexanecarboxylate-CoA ligase; Reviewed Back     alignment and domain information
>gnl|CDD|213309 cd05944, FACL_like_4, Uncharacterized subfamily of fatty acid CoA ligase (FACL) Back     alignment and domain information
>gnl|CDD|213327 cd12119, ttLC_FACS_AlkK_like, Fatty acyl-CoA synthetases similar to LC-FACS from Thermus thermophiles Back     alignment and domain information
>gnl|CDD|162605 TIGR01923, menE, O-succinylbenzoate-CoA ligase Back     alignment and domain information
>gnl|CDD|132252 TIGR03208, cyc_hxne_CoA_lg, cyclohexanecarboxylate-CoA ligase Back     alignment and domain information
>gnl|CDD|215137 PLN02246, PLN02246, 4-coumarate--CoA ligase Back     alignment and domain information
>gnl|CDD|235731 PRK06188, PRK06188, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|215189 PLN02330, PLN02330, 4-coumarate--CoA ligase-like 1 Back     alignment and domain information
>gnl|CDD|237145 PRK12583, PRK12583, acyl-CoA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|213288 cd05921, FCS, Feruloyl-CoA synthetase (FCS) Back     alignment and domain information
>gnl|CDD|236175 PRK08180, PRK08180, feruloyl-CoA synthase; Reviewed Back     alignment and domain information
>gnl|CDD|213287 cd05920, 23DHB-AMP_lg, 2,3-dihydroxybenzoate-AMP ligase Back     alignment and domain information
>gnl|CDD|240370 PTZ00342, PTZ00342, acyl-CoA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|181011 PRK07514, PRK07514, malonyl-CoA synthase; Validated Back     alignment and domain information
>gnl|CDD|168170 PRK05677, PRK05677, long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|236043 PRK07529, PRK07529, AMP-binding domain protein; Validated Back     alignment and domain information
>gnl|CDD|180666 PRK06710, PRK06710, long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|236236 PRK08315, PRK08315, AMP-binding domain protein; Validated Back     alignment and domain information
>gnl|CDD|180393 PRK06087, PRK06087, short chain acyl-CoA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|213300 cd05934, FACL_DitJ_like, Uncharacterized subfamily of fatty acid CoA ligase (FACL) Back     alignment and domain information
>gnl|CDD|236359 PRK08974, PRK08974, long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|235531 PRK05605, PRK05605, long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|233550 TIGR01733, AA-adenyl-dom, amino acid adenylation domain Back     alignment and domain information
>gnl|CDD|213318 cd05971, MACS_like_3, Uncharacterized subfamily of medium-chain acyl-CoA synthetase (MACS) Back     alignment and domain information
>gnl|CDD|171539 PRK12492, PRK12492, long-chain-fatty-acid--CoA ligase; Provisional Back     alignment and domain information
>gnl|CDD|213276 cd05908, A_NRPS_MycA_like, The adenylation domain of nonribosomal peptide synthetases (NRPS) similar to mycosubtilin synthase subunit A (MycA) Back     alignment and domain information
>gnl|CDD|235865 PRK06814, PRK06814, acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|213282 cd05914, FACL_like_3, Uncharacterized subfamily of fatty acid CoA ligase (FACL) Back     alignment and domain information
>gnl|CDD|237144 PRK12582, PRK12582, acyl-CoA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|181546 PRK08751, PRK08751, putative long-chain fatty acyl CoA ligase; Provisional Back     alignment and domain information
>gnl|CDD|213319 cd05972, MACS_like, Medium-chain acyl-CoA synthetase (MACS or ACSM) Back     alignment and domain information
>gnl|CDD|235146 PRK03640, PRK03640, O-succinylbenzoic acid--CoA ligase; Provisional Back     alignment and domain information
>gnl|CDD|213296 cd05930, A_NRPS, The adenylation domain of nonribosomal peptide synthetases (NRPS) Back     alignment and domain information
>gnl|CDD|168698 PRK06839, PRK06839, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|181644 PRK09088, PRK09088, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|169098 PRK07786, PRK07786, long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|213274 cd05906, A_NRPS_TubE_like, The adenylation domain (A domain) of a family of nonribosomal peptide synthetases (NRPSs) synthesizing toxins and antitumor agents Back     alignment and domain information
>gnl|CDD|213321 cd05974, MACS_like_1, Uncharacterized subfamily of medium-chain acyl-CoA synthetase (MACS) Back     alignment and domain information
>gnl|CDD|180988 PRK07470, PRK07470, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|223951 COG1020, EntF, Non-ribosomal peptide synthetase modules and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|236169 PRK08162, PRK08162, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|178097 PLN02479, PLN02479, acetate-CoA ligase Back     alignment and domain information
>gnl|CDD|215312 PLN02574, PLN02574, 4-coumarate--CoA ligase-like Back     alignment and domain information
>gnl|CDD|102207 PRK06145, PRK06145, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|235724 PRK06178, PRK06178, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|213320 cd05973, MACS_like_2, Uncharacterized subfamily of medium-chain acyl-CoA synthetase (MACS) Back     alignment and domain information
>gnl|CDD|235625 PRK05852, PRK05852, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|215576 PLN03102, PLN03102, acyl-activating enzyme; Provisional Back     alignment and domain information
>gnl|CDD|223442 COG0365, Acs, Acyl-coenzyme A synthetases/AMP-(fatty) acid ligases [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|213317 cd05970, MACS_AAE_MA_like, Medium-chain acyl-CoA synthetase (MACS) of AAE_MA like Back     alignment and domain information
>gnl|CDD|236120 PRK07867, PRK07867, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|213325 cd12117, A_NRPS_Srf_like, The adenylation domain of nonribosomal peptide synthetases (NRPS), including Bacillus subtilis termination module Surfactin (SrfA-C) Back     alignment and domain information
>gnl|CDD|180533 PRK06334, PRK06334, long chain fatty acid--[acyl-carrier-protein] ligase; Validated Back     alignment and domain information
>gnl|CDD|236235 PRK08314, PRK08314, long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|236363 PRK09029, PRK09029, O-succinylbenzoic acid--CoA ligase; Provisional Back     alignment and domain information
>gnl|CDD|213297 cd05931, FAAL, Fatty acyl-AMP ligase (FAAL) Back     alignment and domain information
>gnl|CDD|236443 PRK09274, PRK09274, peptide synthase; Provisional Back     alignment and domain information
>gnl|CDD|181195 PRK08008, caiC, putative crotonobetaine/carnitine-CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|213322 cd12114, A_NRPS_TlmIV_like, The adenylation domain of nonribosomal peptide synthetases (NRPS), including Streptoalloteichus tallysomycin biosynthesis genes Back     alignment and domain information
>gnl|CDD|213294 cd05928, MACS_euk, Eukaryotic Medium-chain acyl-CoA synthetase (MACS or ACSM) Back     alignment and domain information
>gnl|CDD|181381 PRK08316, PRK08316, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|181207 PRK08043, PRK08043, bifunctional acyl-[acyl carrier protein] synthetase/2-acylglycerophosphoethanolamine acyltransferase; Validated Back     alignment and domain information
>gnl|CDD|213285 cd05918, A_NRPS_SidN3_like, The adenylation (A) domain of siderophore-synthesizing nonribosomal peptide synthetases (NRPS) Back     alignment and domain information
>gnl|CDD|236091 PRK07768, PRK07768, long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|215646 pfam00001, 7tm_1, 7 transmembrane receptor (rhodopsin family) Back     alignment and domain information
>gnl|CDD|213289 cd05922, FACL_like_6, Uncharacterized subfamily of fatty acid CoA ligase (FACL) Back     alignment and domain information
>gnl|CDD|235313 PRK04813, PRK04813, D-alanine--poly(phosphoribitol) ligase subunit 1; Provisional Back     alignment and domain information
>gnl|CDD|235722 PRK06164, PRK06164, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|235908 PRK07008, PRK07008, long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|236403 PRK09192, PRK09192, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|213324 cd12116, A_NRPS_Ta1_like, The adenylation domain of nonribosomal peptide synthetases (NRPS), including salinosporamide A polyketide synthase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 199
KOG1176|consensus537 100.0
COG0365528 Acs Acyl-coenzyme A synthetases/AMP-(fatty) acid l 100.0
COG0318534 CaiC Acyl-CoA synthetases (AMP-forming)/AMP-acid l 100.0
PTZ00342 746 acyl-CoA synthetase; Provisional 100.0
PRK06334539 long chain fatty acid--[acyl-carrier-protein] liga 100.0
PLN02614 666 long-chain acyl-CoA synthetase 100.0
PTZ00237647 acetyl-CoA synthetase; Provisional 100.0
PLN02736 651 long-chain acyl-CoA synthetase 100.0
PLN02387 696 long-chain-fatty-acid-CoA ligase family protein 100.0
PRK07529 632 AMP-binding domain protein; Validated 100.0
PRK09274552 peptide synthase; Provisional 100.0
PTZ00216 700 acyl-CoA synthetase; Provisional 100.0
PLN02574560 4-coumarate--CoA ligase-like 100.0
PLN02861 660 long-chain-fatty-acid-CoA ligase 100.0
TIGR02316628 propion_prpE propionate--CoA ligase. This family c 100.0
PLN02654666 acetate-CoA ligase 100.0
KOG1177|consensus596 100.0
PRK05677562 long-chain-fatty-acid--CoA ligase; Validated 100.0
KOG1256|consensus 691 100.0
TIGR02188625 Ac_CoA_lig_AcsA acetate--CoA ligase. This model de 100.0
PRK00174637 acetyl-CoA synthetase; Provisional 100.0
COG1022 613 FAA1 Long-chain acyl-CoA synthetases (AMP-forming) 100.0
PRK07788549 acyl-CoA synthetase; Validated 100.0
PRK06060 705 acyl-CoA synthetase; Validated 100.0
PRK086331146 2-acyl-glycerophospho-ethanolamine acyltransferase 100.0
PLN03051499 acyl-activating enzyme; Provisional 100.0
PRK04319570 acetyl-CoA synthetase; Provisional 100.0
PRK12492562 long-chain-fatty-acid--CoA ligase; Provisional 100.0
PRK10524629 prpE propionyl-CoA synthetase; Provisional 100.0
PLN02860563 o-succinylbenzoate-CoA ligase 100.0
PRK07787471 acyl-CoA synthetase; Validated 100.0
PRK13295547 cyclohexanecarboxylate-CoA ligase; Reviewed 100.0
PRK08314546 long-chain-fatty-acid--CoA ligase; Validated 100.0
PRK13382537 acyl-CoA synthetase; Provisional 100.0
PRK07769 631 long-chain-fatty-acid--CoA ligase; Validated 99.98
PRK05851525 long-chain-fatty-acid--[acyl-carrier-protein] liga 99.98
PRK07514504 malonyl-CoA synthase; Validated 99.98
TIGR03208538 cyc_hxne_CoA_lg cyclohexanecarboxylate-CoA ligase. 99.98
PLN02246537 4-coumarate--CoA ligase 99.98
PRK06839496 acyl-CoA synthetase; Validated 99.98
PRK07638487 acyl-CoA synthetase; Validated 99.98
PLN02430 660 long-chain-fatty-acid-CoA ligase 99.98
PRK09088488 acyl-CoA synthetase; Validated 99.97
PLN02330546 4-coumarate--CoA ligase-like 1 99.97
PRK12476612 putative fatty-acid--CoA ligase; Provisional 99.97
PRK03584655 acetoacetyl-CoA synthetase; Provisional 99.97
TIGR02275527 DHB_AMP_lig 2,3-dihydroxybenzoate-AMP ligase. Prot 99.97
PRK07656513 long-chain-fatty-acid--CoA ligase; Validated 99.97
PRK05857540 acyl-CoA synthetase; Validated 99.97
PRK05852534 acyl-CoA synthetase; Validated 99.97
PRK08315559 AMP-binding domain protein; Validated 99.97
TIGR01733408 AA-adenyl-dom amino acid adenylation domain. This 99.97
PRK10946536 entE enterobactin synthase subunit E; Provisional 99.97
PRK08043718 bifunctional acyl-[acyl carrier protein] synthetas 99.97
PRK06145497 acyl-CoA synthetase; Validated 99.97
PRK07059557 Long-chain-fatty-acid--CoA ligase; Validated 99.97
PRK07470528 acyl-CoA synthetase; Validated 99.97
PRK13390501 acyl-CoA synthetase; Provisional 99.97
PRK10252 1296 entF enterobactin synthase subunit F; Provisional 99.97
TIGR03443 1389 alpha_am_amid L-aminoadipate-semialdehyde dehydrog 99.97
PRK06710563 long-chain-fatty-acid--CoA ligase; Validated 99.97
PF00501417 AMP-binding: AMP-binding enzyme; InterPro: IPR0008 99.97
PRK05605573 long-chain-fatty-acid--CoA ligase; Validated 99.97
PRK08751560 putative long-chain fatty acyl CoA ligase; Provisi 99.97
TIGR02262508 benz_CoA_lig benzoate-CoA ligase family. Character 99.97
KOG1175|consensus626 99.97
PRK13383516 acyl-CoA synthetase; Provisional 99.97
TIGR01217652 ac_ac_CoA_syn acetoacetyl-CoA synthase. This enzym 99.97
PRK08180 614 feruloyl-CoA synthase; Reviewed 99.97
PRK12406509 long-chain-fatty-acid--CoA ligase; Provisional 99.97
PRK12582 624 acyl-CoA synthetase; Provisional 99.97
PRK12467 3956 peptide synthase; Provisional 99.97
PRK06188524 acyl-CoA synthetase; Validated 99.97
PRK03640483 O-succinylbenzoic acid--CoA ligase; Provisional 99.97
PRK07786542 long-chain-fatty-acid--CoA ligase; Validated 99.97
PRK12583558 acyl-CoA synthetase; Provisional 99.97
PRK12316 5163 peptide synthase; Provisional 99.97
PRK08974560 long-chain-fatty-acid--CoA ligase; Validated 99.97
PRK06164540 acyl-CoA synthetase; Validated 99.97
PRK06155542 crotonobetaine/carnitine-CoA ligase; Provisional 99.97
TIGR03205541 pimA dicarboxylate--CoA ligase PimA. PimA, a membe 99.97
PRK07445452 O-succinylbenzoic acid--CoA ligase; Reviewed 99.97
PRK08316523 acyl-CoA synthetase; Validated 99.97
TIGR01734502 D-ala-DACP-lig D-alanine--poly(phosphoribitol) lig 99.97
PRK08008517 caiC putative crotonobetaine/carnitine-CoA ligase; 99.97
PRK08276502 long-chain-fatty-acid--CoA ligase; Validated 99.97
PRK12467 3956 peptide synthase; Provisional 99.97
PRK13391511 acyl-CoA synthetase; Provisional 99.97
TIGR03098515 ligase_PEP_1 acyl-CoA ligase (AMP-forming), exosor 99.97
PRK12316 5163 peptide synthase; Provisional 99.97
PRK06087547 short chain acyl-CoA synthetase; Reviewed 99.96
PRK068141140 acylglycerophosphoethanolamine acyltransferase; Pr 99.96
PRK07008539 long-chain-fatty-acid--CoA ligase; Validated 99.96
PRK06187521 long-chain-fatty-acid--CoA ligase; Validated 99.96
PRK05691 4334 peptide synthase; Validated 99.96
COG1021542 EntE Peptide arylation enzymes [Secondary metaboli 99.96
PLN02479567 acetate-CoA ligase 99.96
PRK05620576 long-chain-fatty-acid--CoA ligase; Validated 99.96
PRK05691 4334 peptide synthase; Validated 99.96
PRK04813503 D-alanine--poly(phosphoribitol) ligase subunit 1; 99.96
PRK07867529 acyl-CoA synthetase; Validated 99.96
PLN03102579 acyl-activating enzyme; Provisional 99.96
PRK06018542 putative acyl-CoA synthetase; Provisional 99.96
KOG1180|consensus 678 99.96
PRK09192579 acyl-CoA synthetase; Validated 99.96
PRK06178567 acyl-CoA synthetase; Validated 99.96
PLN03052728 acetate--CoA ligase; Provisional 99.96
PRK05850578 acyl-CoA synthetase; Validated 99.95
PRK09029458 O-succinylbenzoic acid--CoA ligase; Provisional 99.95
PRK07768545 long-chain-fatty-acid--CoA ligase; Validated 99.95
PRK13388 540 acyl-CoA synthetase; Provisional 99.95
PRK07824358 O-succinylbenzoic acid--CoA ligase; Provisional 99.95
TIGR01923436 menE O-succinylbenzoate-CoA ligase. This model rep 99.95
PRK08162545 acyl-CoA synthetase; Validated 99.95
PRK07868994 acyl-CoA synthetase; Validated 99.95
PRK08279 600 long-chain-acyl-CoA synthetase; Validated 99.93
PRK07798533 acyl-CoA synthetase; Validated 99.93
TIGR02155422 PA_CoA_ligase phenylacetate-CoA ligase. Phenylacet 99.91
PRK08308414 acyl-CoA synthetase; Validated 99.91
COG1020642 EntF Non-ribosomal peptide synthetase modules and 99.84
KOG1179|consensus 649 99.84
TIGR02372386 4_coum_CoA_lig 4-coumarate--CoA ligase, photoactiv 99.82
TIGR03335445 F390_ftsA coenzyme F390 synthetase. This enzyme, c 99.8
COG1541438 PaaK Coenzyme F390 synthetase [Coenzyme metabolism 99.79
PTZ00297 1452 pantothenate kinase; Provisional 99.35
TIGR02304430 aden_form_hyp probable adenylate-forming enzyme. M 99.34
PRK09188365 serine/threonine protein kinase; Provisional 99.04
KOG1178|consensus 1032 98.63
KOG3628|consensus1363 98.41
PF04443365 LuxE: Acyl-protein synthetase, LuxE; InterPro: IPR 98.19
PF03321528 GH3: GH3 auxin-responsive promoter; InterPro: IPR0 97.48
PLN02620 612 indole-3-acetic acid-amido synthetase 96.79
PLN02247 606 indole-3-acetic acid-amido synthetase 96.68
PLN02249 597 indole-3-acetic acid-amido synthetase 96.26
KOG3628|consensus 1363 95.8
>KOG1176|consensus Back     alignment and domain information
Probab=100.00  E-value=6.3e-41  Score=282.32  Aligned_cols=181  Identities=28%  Similarity=0.419  Sum_probs=165.5

Q ss_pred             ccccchhHHHHHHHhh-hhhccCCceeEEEEecCCCCHHHHHHHHHHhC-CcEEeecccccCCCceeecccCC-ccCCCC
Q psy14311          3 GIYRRNSIWDKLVFKK-VQEDMGGNLRLMLAGSAPLAGNVLTFLRCALG-CLVIEGYGQTECVAPITLTIQGD-YVPEHV   79 (199)
Q Consensus         3 ~~~~~P~~~~~l~~~~-~~~~~~~slr~i~~~G~~~~~~~~~~~~~~~~-~~i~~~yG~tE~~~~~~~~~~~~-~~~~~~   79 (199)
                      .+.++|+++..|++.+ ....+++++|.+.++|+++++++.++++++++ ..+.+.||+||+++.++.+...+ .+++++
T Consensus       276 ~~~~vP~~~~~l~~~p~~~~~~l~sl~~v~~gga~~~~~~~~~~~~~l~~~~v~q~YGmTE~~~~~~~~~~~~e~k~~sv  355 (537)
T KOG1176|consen  276 HLFLVPPVLNMLAKSPIVKKYDLSSLRSVLSGGAPLSPATLEKVKERLPNVTVIQGYGMTEAGGLITSNDWGPERKPGSV  355 (537)
T ss_pred             EEEcChHHHHHHhcCCccCcccCCccEEEEecCCCCCHHHHHHHHHhCCCceEEEeeccccccCceeecCCCccCccccc
Confidence            5679999999999886 44577799999999999999999999999998 88999999999997777665544 488999


Q ss_pred             CccccCcEEEEEeCCCCcccCCCCcceEEEecCcccccccCCCcCCC--CCCCCeeecCceEEEcCCCeEEEEeeeeeee
Q psy14311         80 GPPICCCSVKLVDVPEMDYFAHEGKGEVCVRGNNVFLGYFKDPELNS--IDELGWHHTGDVGMWLPTLFFFFIPMLVIML  157 (199)
Q Consensus        80 G~p~~~~~~~v~d~~~~~~~~~g~~Gel~i~~~~~~~gy~~~~~~~~--~~~~g~~~TGD~~~~d~~g~l~~~~r~~~~~  157 (199)
                      |+++++++..+.+ ++|+.+++++.||||++|+.++.||++||++|.  ++.+|||+|||+|++|+||+|+|+       
T Consensus       356 G~~~~g~~~~v~~-e~g~~l~~~~~GEI~vrg~~imkGY~~NpeaT~~~~~~~GW~~TGDiGy~D~DG~l~Iv-------  427 (537)
T KOG1176|consen  356 GRLLPGVRVKVLD-ETGVSLGPNQTGEICVRGPQVMKGYLKNPEATKEAFDDDGWFHTGDLGYFDEDGYLYIV-------  427 (537)
T ss_pred             CccccceEEEeeC-CCCCCCCCCCceEEEEECcccchhhcCChHHHHhhcccCCccccCceEEEcCCCeEEEe-------
Confidence            9999988888888 999999999999999999999999999999998  555699999999999999999999       


Q ss_pred             EeeecCeEEEecceecccccccccccCCcccccccc
Q psy14311        158 MYTRIGLRIRSRSRHSLGKRVEGTVHGETKRSQSRK  193 (199)
Q Consensus       158 ~~gR~~~~i~~~g~~v~~~eiE~~l~~~~~~~~~~~  193 (199)
                        +|.+|+||.+|++|+|.|||++|.+||+|.++..
T Consensus       428 --dR~KdlIk~~G~qv~P~EiE~vL~~hP~V~eaaV  461 (537)
T KOG1176|consen  428 --DRSKDLIKYGGEQVSPAEIEAVLLTHPDVLEAAV  461 (537)
T ss_pred             --cchhhheeeCCEEeCHHHHHHHHHhCCCccEEEE
Confidence              9999999999999999999999999999997643



>COG0365 Acs Acyl-coenzyme A synthetases/AMP-(fatty) acid ligases [Lipid metabolism] Back     alignment and domain information
>COG0318 CaiC Acyl-CoA synthetases (AMP-forming)/AMP-acid ligases II [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PTZ00342 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK06334 long chain fatty acid--[acyl-carrier-protein] ligase; Validated Back     alignment and domain information
>PLN02614 long-chain acyl-CoA synthetase Back     alignment and domain information
>PTZ00237 acetyl-CoA synthetase; Provisional Back     alignment and domain information
>PLN02736 long-chain acyl-CoA synthetase Back     alignment and domain information
>PLN02387 long-chain-fatty-acid-CoA ligase family protein Back     alignment and domain information
>PRK07529 AMP-binding domain protein; Validated Back     alignment and domain information
>PRK09274 peptide synthase; Provisional Back     alignment and domain information
>PTZ00216 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PLN02574 4-coumarate--CoA ligase-like Back     alignment and domain information
>PLN02861 long-chain-fatty-acid-CoA ligase Back     alignment and domain information
>TIGR02316 propion_prpE propionate--CoA ligase Back     alignment and domain information
>PLN02654 acetate-CoA ligase Back     alignment and domain information
>KOG1177|consensus Back     alignment and domain information
>PRK05677 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>KOG1256|consensus Back     alignment and domain information
>TIGR02188 Ac_CoA_lig_AcsA acetate--CoA ligase Back     alignment and domain information
>PRK00174 acetyl-CoA synthetase; Provisional Back     alignment and domain information
>COG1022 FAA1 Long-chain acyl-CoA synthetases (AMP-forming) [Lipid metabolism] Back     alignment and domain information
>PRK07788 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK06060 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>PLN03051 acyl-activating enzyme; Provisional Back     alignment and domain information
>PRK04319 acetyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK12492 long-chain-fatty-acid--CoA ligase; Provisional Back     alignment and domain information
>PRK10524 prpE propionyl-CoA synthetase; Provisional Back     alignment and domain information
>PLN02860 o-succinylbenzoate-CoA ligase Back     alignment and domain information
>PRK07787 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK13295 cyclohexanecarboxylate-CoA ligase; Reviewed Back     alignment and domain information
>PRK08314 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK13382 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK07769 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK05851 long-chain-fatty-acid--[acyl-carrier-protein] ligase; Validated Back     alignment and domain information
>PRK07514 malonyl-CoA synthase; Validated Back     alignment and domain information
>TIGR03208 cyc_hxne_CoA_lg cyclohexanecarboxylate-CoA ligase Back     alignment and domain information
>PLN02246 4-coumarate--CoA ligase Back     alignment and domain information
>PRK06839 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK07638 acyl-CoA synthetase; Validated Back     alignment and domain information
>PLN02430 long-chain-fatty-acid-CoA ligase Back     alignment and domain information
>PRK09088 acyl-CoA synthetase; Validated Back     alignment and domain information
>PLN02330 4-coumarate--CoA ligase-like 1 Back     alignment and domain information
>PRK12476 putative fatty-acid--CoA ligase; Provisional Back     alignment and domain information
>PRK03584 acetoacetyl-CoA synthetase; Provisional Back     alignment and domain information
>TIGR02275 DHB_AMP_lig 2,3-dihydroxybenzoate-AMP ligase Back     alignment and domain information
>PRK07656 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK05857 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK05852 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK08315 AMP-binding domain protein; Validated Back     alignment and domain information
>TIGR01733 AA-adenyl-dom amino acid adenylation domain Back     alignment and domain information
>PRK10946 entE enterobactin synthase subunit E; Provisional Back     alignment and domain information
>PRK08043 bifunctional acyl-[acyl carrier protein] synthetase/2-acylglycerophosphoethanolamine acyltransferase; Validated Back     alignment and domain information
>PRK06145 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK07059 Long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK07470 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK13390 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK10252 entF enterobactin synthase subunit F; Provisional Back     alignment and domain information
>TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase Back     alignment and domain information
>PRK06710 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PF00501 AMP-binding: AMP-binding enzyme; InterPro: IPR000873 A number of prokaryotic and eukaryotic enzymes, which appear to act via an ATP-dependent covalent binding of AMP to their substrate, share a region of sequence similarity [, , ] Back     alignment and domain information
>PRK05605 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK08751 putative long-chain fatty acyl CoA ligase; Provisional Back     alignment and domain information
>TIGR02262 benz_CoA_lig benzoate-CoA ligase family Back     alignment and domain information
>KOG1175|consensus Back     alignment and domain information
>PRK13383 acyl-CoA synthetase; Provisional Back     alignment and domain information
>TIGR01217 ac_ac_CoA_syn acetoacetyl-CoA synthase Back     alignment and domain information
>PRK08180 feruloyl-CoA synthase; Reviewed Back     alignment and domain information
>PRK12406 long-chain-fatty-acid--CoA ligase; Provisional Back     alignment and domain information
>PRK12582 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK12467 peptide synthase; Provisional Back     alignment and domain information
>PRK06188 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK03640 O-succinylbenzoic acid--CoA ligase; Provisional Back     alignment and domain information
>PRK07786 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK12583 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK12316 peptide synthase; Provisional Back     alignment and domain information
>PRK08974 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK06164 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK06155 crotonobetaine/carnitine-CoA ligase; Provisional Back     alignment and domain information
>TIGR03205 pimA dicarboxylate--CoA ligase PimA Back     alignment and domain information
>PRK07445 O-succinylbenzoic acid--CoA ligase; Reviewed Back     alignment and domain information
>PRK08316 acyl-CoA synthetase; Validated Back     alignment and domain information
>TIGR01734 D-ala-DACP-lig D-alanine--poly(phosphoribitol) ligase, subunit 1 Back     alignment and domain information
>PRK08008 caiC putative crotonobetaine/carnitine-CoA ligase; Validated Back     alignment and domain information
>PRK08276 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK12467 peptide synthase; Provisional Back     alignment and domain information
>PRK13391 acyl-CoA synthetase; Provisional Back     alignment and domain information
>TIGR03098 ligase_PEP_1 acyl-CoA ligase (AMP-forming), exosortase system type 1 associated Back     alignment and domain information
>PRK12316 peptide synthase; Provisional Back     alignment and domain information
>PRK06087 short chain acyl-CoA synthetase; Reviewed Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>PRK07008 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK06187 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK05691 peptide synthase; Validated Back     alignment and domain information
>COG1021 EntE Peptide arylation enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02479 acetate-CoA ligase Back     alignment and domain information
>PRK05620 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK05691 peptide synthase; Validated Back     alignment and domain information
>PRK04813 D-alanine--poly(phosphoribitol) ligase subunit 1; Provisional Back     alignment and domain information
>PRK07867 acyl-CoA synthetase; Validated Back     alignment and domain information
>PLN03102 acyl-activating enzyme; Provisional Back     alignment and domain information
>PRK06018 putative acyl-CoA synthetase; Provisional Back     alignment and domain information
>KOG1180|consensus Back     alignment and domain information
>PRK09192 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK06178 acyl-CoA synthetase; Validated Back     alignment and domain information
>PLN03052 acetate--CoA ligase; Provisional Back     alignment and domain information
>PRK05850 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK09029 O-succinylbenzoic acid--CoA ligase; Provisional Back     alignment and domain information
>PRK07768 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK13388 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK07824 O-succinylbenzoic acid--CoA ligase; Provisional Back     alignment and domain information
>TIGR01923 menE O-succinylbenzoate-CoA ligase Back     alignment and domain information
>PRK08162 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK07868 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK08279 long-chain-acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK07798 acyl-CoA synthetase; Validated Back     alignment and domain information
>TIGR02155 PA_CoA_ligase phenylacetate-CoA ligase Back     alignment and domain information
>PRK08308 acyl-CoA synthetase; Validated Back     alignment and domain information
>COG1020 EntF Non-ribosomal peptide synthetase modules and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG1179|consensus Back     alignment and domain information
>TIGR02372 4_coum_CoA_lig 4-coumarate--CoA ligase, photoactive yellow protein activation family Back     alignment and domain information
>TIGR03335 F390_ftsA coenzyme F390 synthetase Back     alignment and domain information
>COG1541 PaaK Coenzyme F390 synthetase [Coenzyme metabolism] Back     alignment and domain information
>PTZ00297 pantothenate kinase; Provisional Back     alignment and domain information
>TIGR02304 aden_form_hyp probable adenylate-forming enzyme Back     alignment and domain information
>PRK09188 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG1178|consensus Back     alignment and domain information
>KOG3628|consensus Back     alignment and domain information
>PF04443 LuxE: Acyl-protein synthetase, LuxE; InterPro: IPR007534 LuxE is an acyl-protein synthetase found in bioluminescent bacteria Back     alignment and domain information
>PF03321 GH3: GH3 auxin-responsive promoter; InterPro: IPR004993 Transcription of the gene family, GH3, has been shown to be specifically induced by the plant hormone auxin Back     alignment and domain information
>PLN02620 indole-3-acetic acid-amido synthetase Back     alignment and domain information
>PLN02247 indole-3-acetic acid-amido synthetase Back     alignment and domain information
>PLN02249 indole-3-acetic acid-amido synthetase Back     alignment and domain information
>KOG3628|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query199
2d1q_A548 Crystal Structure Of The Thermostable Japanese Fire 1e-13
4g36_A555 Photinus Pyralis Luciferase In The Adenylate-Formin 1e-13
2d1t_A548 Crystal Structure Of The Thermostable Japanese Fire 1e-13
2d1s_A548 Crystal Structure Of The Thermostable Japanese Fire 1e-13
3iep_A551 Firefly Luciferase Apo Structure (P41 Form) Length 1e-13
1ba3_A550 Firefly Luciferase In Complex With Bromoform Length 1e-13
4g37_A555 Structure Of Cross-Linked Firefly Luciferase In Sec 1e-12
3qya_A582 Crystal Structure Of A Red-Emitter Mutant Of Lampyr 6e-12
4fuq_A503 Crystal Structure Of Apo Matb From Rhodopseudomonas 1e-10
4gxr_A503 Structure Of Atp Bound Rpmatb-Bxbclm Chimera B3 Len 7e-10
4gxq_A506 Crystal Structure Of Atp Bound Rpmatb-Bxbclm Chimer 8e-10
4fut_A503 Crystal Structure Of Atp Bound Matb From Rhodopseud 8e-10
3a9u_A536 Crystal Structures And Enzymatic Mechanisms Of A Po 2e-08
3nyq_A505 Malonyl-Coa Ligase Ternary Product Complex With Met 3e-07
3tsy_A 979 4-Coumaroyl-Coa Ligase::stilbene Synthase Fusion Pr 2e-06
3ivr_A509 Crystal Structure Of Putative Long-Chain-Fatty-Acid 9e-05
3ipl_A501 Crystal Structure Of O-Succinylbenzoic Acid-Coa Lig 1e-04
>pdb|2D1Q|A Chain A, Crystal Structure Of The Thermostable Japanese Firefly Luciferase Complexed With Mgatp Length = 548 Back     alignment and structure

Iteration: 1

Score = 72.4 bits (176), Expect = 1e-13, Method: Compositional matrix adjust. Identities = 45/137 (32%), Positives = 66/137 (48%), Gaps = 3/137 (2%) Query: 26 NLRLMLAGSAPLAGNVLTFLRCALGCL-VIEGYGQTECVAPITLTIQGDYVPEHVGPPIC 84 NL + +G APL+ V + V +GYG TE + I +T +GD P G + Sbjct: 310 NLVEIASGGAPLSKEVGEAVARRFNLPGVRQGYGLTETTSAIIITPEGDDKPGASGKVVP 369 Query: 85 CCSVKLVDVPEMDYFAHEGKGEVCVRGNNVFLGYFKDPELNS--IDELGWHHTGDVGMWL 142 K++D+ +GEVCV+G + GY +PE IDE GW HTGD+G + Sbjct: 370 LFKAKVIDLDTKKSLGPNRRGEVCVKGPMLMKGYVNNPEATKELIDEEGWLHTGDIGYYD 429 Query: 143 PTLFFFFIPMLVIMLMY 159 FF + L ++ Y Sbjct: 430 EEKHFFIVDRLKSLIKY 446
>pdb|4G36|A Chain A, Photinus Pyralis Luciferase In The Adenylate-Forming Conformation Bound To Dlsa Length = 555 Back     alignment and structure
>pdb|2D1T|A Chain A, Crystal Structure Of The Thermostable Japanese Firefly Luciferase Red-Color Emission S286n Mutant Complexed With High-Energy Intermediate Analogue Length = 548 Back     alignment and structure
>pdb|2D1S|A Chain A, Crystal Structure Of The Thermostable Japanese Firefly Luciferase Complexed With High-Energy Intermediate Analogue Length = 548 Back     alignment and structure
>pdb|3IEP|A Chain A, Firefly Luciferase Apo Structure (P41 Form) Length = 551 Back     alignment and structure
>pdb|1BA3|A Chain A, Firefly Luciferase In Complex With Bromoform Length = 550 Back     alignment and structure
>pdb|4G37|A Chain A, Structure Of Cross-Linked Firefly Luciferase In Second Catalytic Conformation Length = 555 Back     alignment and structure
>pdb|3QYA|A Chain A, Crystal Structure Of A Red-Emitter Mutant Of Lampyris Turkestanicus Luciferase Length = 582 Back     alignment and structure
>pdb|4FUQ|A Chain A, Crystal Structure Of Apo Matb From Rhodopseudomonas Palustris Length = 503 Back     alignment and structure
>pdb|4GXR|A Chain A, Structure Of Atp Bound Rpmatb-Bxbclm Chimera B3 Length = 503 Back     alignment and structure
>pdb|4GXQ|A Chain A, Crystal Structure Of Atp Bound Rpmatb-Bxbclm Chimera B1 Length = 506 Back     alignment and structure
>pdb|4FUT|A Chain A, Crystal Structure Of Atp Bound Matb From Rhodopseudomonas Palustris Length = 503 Back     alignment and structure
>pdb|3A9U|A Chain A, Crystal Structures And Enzymatic Mechanisms Of A Populus Tomentosa 4- Coumarate--Coa Ligase Length = 536 Back     alignment and structure
>pdb|3NYQ|A Chain A, Malonyl-Coa Ligase Ternary Product Complex With Methylmalonyl-Coa And Amp Bound Length = 505 Back     alignment and structure
>pdb|3TSY|A Chain A, 4-Coumaroyl-Coa Ligase::stilbene Synthase Fusion Protein Length = 979 Back     alignment and structure
>pdb|3IVR|A Chain A, Crystal Structure Of Putative Long-Chain-Fatty-Acid Coa Ligase From Rhodopseudomonas Palustris Cga009 Length = 509 Back     alignment and structure
>pdb|3IPL|A Chain A, Crystal Structure Of O-Succinylbenzoic Acid-Coa Ligase From Staphylococcus Aureus Subsp. Aureus Mu50 Length = 501 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query199
3nyq_A505 Malonyl-COA ligase; A/B topology ababa sandwich be 1e-26
4fuq_A503 Malonyl COA synthetase; ANL superfamily, methylma 1e-24
3ipl_A501 2-succinylbenzoate--COA ligase; structural genomic 3e-24
3r44_A517 Fatty acyl COA synthetase FADD13 (fatty-acyl-COA s 5e-24
3ivr_A509 Putative long-chain-fatty-acid COA ligase; structu 1e-22
3rg2_A 617 Enterobactin synthase component E (ENTE), 2,3-DIH 8e-22
2d1s_A548 Luciferase, luciferin 4-monooxygenase; alpha/beta, 1e-21
3rix_A550 Luciferase, luciferin 4-monooxygenase; oxidoreduct 2e-21
3ni2_A536 4-coumarate:COA ligase; 4CL, phenylpropanoid biosy 4e-21
1mdb_A539 2,3-dihydroxybenzoate-AMP ligase; adenylation doma 1e-20
3o83_A544 Peptide arylation enzyme; ligase, adenylation of 2 1e-20
1t5h_X504 4-chlorobenzoyl COA ligase; adenylate-forming coen 5e-20
3tsy_A 979 Fusion protein 4-coumarate--COA ligase 1, resvera 6e-20
3g7s_A549 Long-chain-fatty-acid--COA ligase (FADD-1); protei 2e-18
2v7b_A529 Benzoate-coenzyme A ligase; benzoate oxidation, be 3e-16
1v25_A541 Long-chain-fatty-acid-COA synthetase; ligase, stru 4e-15
3c5e_A570 Acyl-coenzyme A synthetase ACSM2A, mitochondrial; 3e-10
3gqw_A576 Fatty acid AMP ligase; FAAL, E. coli, ATP-dependen 9e-08
3etc_A580 AMP-binding protein; adenylate-forming acyl-COA sy 2e-07
2ks9_A 364 Substance-P receptor; water, autodock, NK1, neurop 5e-07
3kxw_A590 Saframycin MX1 synthetase B; fatty acid AMP ligase 3e-06
3t5a_A480 Long-chain-fatty-acid--AMP ligase FADD28; acetyl-C 1e-05
3pbl_A 481 D(3) dopamine receptor, lysozyme chimera; structur 2e-04
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis, 2e-04
3uon_A 467 Human M2 muscarinic acetylcholine, receptor T4 LY 4e-04
3eml_A 488 Human adenosine A2A receptor/T4 lysozyme chimera; 7e-04
>3nyq_A Malonyl-COA ligase; A/B topology ababa sandwich beta-barrel adenylate-forming EN fold; HET: MCA AMP; 1.43A {Streptomyces coelicolor} PDB: 3nyr_A* Length = 505 Back     alignment and structure
 Score =  105 bits (263), Expect = 1e-26
 Identities = 37/121 (30%), Positives = 58/121 (47%), Gaps = 10/121 (8%)

Query: 26  NLRLMLAGSAPLAGNVLTFLRCALGCLVIEGYGQTECVAPITLTIQGDYVPEHVGPPICC 85
             RL+++GSA L  +    +  A G  VIE YG TE +   ++   G+     VG P+  
Sbjct: 273 GARLLVSGSAALPVHDHERIAAATGRRVIERYGMTETLMNTSVRADGEPRAGTVGVPLPG 332

Query: 86  CSVKLVD-----VPEMDYFAHEGKGEVCVRGNNVFLGYFKDPELN--SIDELGWHHTGDV 138
             ++LV+     +  +D    E  GE+ VRG N+F  Y   P+    +  E G+  TGD+
Sbjct: 333 VELRLVEEDGTPIAALD---GESVGEIQVRGPNLFTEYLNRPDATAAAFTEDGFFRTGDM 389

Query: 139 G 139
            
Sbjct: 390 A 390


>4fuq_A Malonyl COA synthetase; ANL superfamily, methylma malonate, ligase; HET: MSE; 1.70A {Rhodopseudomonas palustris} PDB: 4fut_A* Length = 503 Back     alignment and structure
>3ipl_A 2-succinylbenzoate--COA ligase; structural genomics, acyl-protein synthetase, PSI-2, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Length = 501 Back     alignment and structure
>3r44_A Fatty acyl COA synthetase FADD13 (fatty-acyl-COA synthetase); ligase; HET: HIS; 1.80A {Mycobacterium tuberculosis} PDB: 3t5c_A 3t5b_A Length = 517 Back     alignment and structure
>3ivr_A Putative long-chain-fatty-acid COA ligase; structural genomics, PSI-2, protein S initiative, fatty acid synthesis; HET: GOL; 2.00A {Rhodopseudomonas palustris} Length = 509 Back     alignment and structure
>3rg2_A Enterobactin synthase component E (ENTE), 2,3-DIH dihydroxybenzoate synthetase, isochroismatase...; adenylate-forming enzymes, ANL superfamily; HET: SVS PNS; 3.10A {Escherichia coli} Length = 617 Back     alignment and structure
>2d1s_A Luciferase, luciferin 4-monooxygenase; alpha/beta, beta barrel, alpha+beta, riken structural genomics/proteomics initiative, RSGI; HET: SLU; 1.30A {Luciola cruciata} PDB: 2d1q_A* 2d1r_A* 2d1t_A* Length = 548 Back     alignment and structure
>3rix_A Luciferase, luciferin 4-monooxygenase; oxidoreductase, photoprotein, luminescence, aspulvinone, natural product extracts; HET: 923; 1.70A {Photinus pyralis} PDB: 1ba3_A 1lci_A* 3ies_A* 3iep_A* 3ier_A* 3qya_A Length = 550 Back     alignment and structure
>3ni2_A 4-coumarate:COA ligase; 4CL, phenylpropanoid biosynthesis; HET: AYL EPE; 1.90A {Populus tomentosa} PDB: 3a9v_A* 3a9u_A* Length = 536 Back     alignment and structure
>1mdb_A 2,3-dihydroxybenzoate-AMP ligase; adenylation domain, peptide synthetase, antibiotic biosynthesis, siderophore formation; HET: AMP DBH; 2.15A {Bacillus subtilis} SCOP: e.23.1.1 PDB: 1md9_A* 1mdf_A Length = 539 Back     alignment and structure
>3o83_A Peptide arylation enzyme; ligase, adenylation of 2,3-dihydroxybenzoate and transfer to pantetheine cofactor of BASF; HET: IXN; 1.90A {Acinetobacter baumannii} PDB: 3o82_A* 3o84_A* Length = 544 Back     alignment and structure
>1t5h_X 4-chlorobenzoyl COA ligase; adenylate-forming coenzyme A ligase domain alternation confo change; 2.00A {Alcaligenes SP} SCOP: e.23.1.1 PDB: 1t5d_X 3cw9_A* 3cw8_X* 2qvz_X* 2qw0_X* 3dlp_X* 2qvx_X* 2qvy_X* Length = 504 Back     alignment and structure
>3tsy_A Fusion protein 4-coumarate--COA ligase 1, resvera synthase; transferase; 3.10A {Arabidospis thaliana} Length = 979 Back     alignment and structure
>3g7s_A Long-chain-fatty-acid--COA ligase (FADD-1); protein structure initiative, PSI-II, NYSGXRC, 11193J, structural genomics; 2.15A {Archaeoglobus fulgidus dsm 4304} Length = 549 Back     alignment and structure
>2v7b_A Benzoate-coenzyme A ligase; benzoate oxidation, benzoate COA ligase; 1.84A {Burkholderia xenovorans} Length = 529 Back     alignment and structure
>1v25_A Long-chain-fatty-acid-COA synthetase; ligase, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.30A {Thermus thermophilus} SCOP: e.23.1.1 PDB: 1ult_A* 1v26_A* Length = 541 Back     alignment and structure
>3c5e_A Acyl-coenzyme A synthetase ACSM2A, mitochondrial; middle-chain acyl-COA synthetase, xenobiotic/medium-chain FA COA ligase; HET: ATP; 1.60A {Homo sapiens} PDB: 2vze_A 3b7w_A* 3day_A* 3eq6_A* 3eyn_A* 3gpc_A* 2wd9_A* Length = 570 Back     alignment and structure
>3etc_A AMP-binding protein; adenylate-forming acyl-COA synthetase ligase, ligase; HET: PGE 1PE EPE; 2.10A {Methanosarcina acetivorans} Length = 580 Back     alignment and structure
>2ks9_A Substance-P receptor; water, autodock, NK1, neuropeptide receptor-NEU complex; NMR {Homo sapiens} PDB: 2ksa_A 2ksb_A Length = 364 Back     alignment and structure
>3kxw_A Saframycin MX1 synthetase B; fatty acid AMP ligase, SGX, acyl adenylate, structural genom 2, protein structure initiative; HET: 1ZZ; 1.85A {Legionella pneumophila subsp} PDB: 3lnv_A* Length = 590 Back     alignment and structure
>3t5a_A Long-chain-fatty-acid--AMP ligase FADD28; acetyl-COA synthetase like fold, AMP-binding; 2.05A {Mycobacterium tuberculosis} PDB: 3e53_A Length = 480 Back     alignment and structure
>3pbl_A D(3) dopamine receptor, lysozyme chimera; structural genomics, PSI-2, protein structure initiative, AC technologies center for gene to 3D structure; HET: ETQ MAL; 2.89A {Homo sapiens} Length = 481 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure
>3uon_A Human M2 muscarinic acetylcholine, receptor T4 LY fusion protein; G protein-coupled receptor, GPCR, SI protein-antagonist complex; HET: QNB BGC; 3.00A {Homo sapiens} PDB: 4daj_A* Length = 467 Back     alignment and structure
>3eml_A Human adenosine A2A receptor/T4 lysozyme chimera; caffeine, GPCR, membrane protein, LCP, mesophase, structural genomics, PSI-2; HET: ZMA STE; 2.60A {Homo sapiens} PDB: 3qak_A* Length = 488 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query199
3etc_A580 AMP-binding protein; adenylate-forming acyl-COA sy 100.0
4fuq_A503 Malonyl COA synthetase; ANL superfamily, methylma 100.0
3ni2_A536 4-coumarate:COA ligase; 4CL, phenylpropanoid biosy 100.0
3rix_A550 Luciferase, luciferin 4-monooxygenase; oxidoreduct 100.0
2d1s_A548 Luciferase, luciferin 4-monooxygenase; alpha/beta, 100.0
3c5e_A570 Acyl-coenzyme A synthetase ACSM2A, mitochondrial; 100.0
3g7s_A549 Long-chain-fatty-acid--COA ligase (FADD-1); protei 100.0
3nyq_A505 Malonyl-COA ligase; A/B topology ababa sandwich be 100.0
1v25_A541 Long-chain-fatty-acid-COA synthetase; ligase, stru 100.0
3o83_A544 Peptide arylation enzyme; ligase, adenylation of 2 100.0
1pg4_A652 Acetyl-COA synthetase; AMP-forming, adenylate-form 100.0
1mdb_A539 2,3-dihydroxybenzoate-AMP ligase; adenylation doma 100.0
2v7b_A529 Benzoate-coenzyme A ligase; benzoate oxidation, be 100.0
3ite_A562 SIDN siderophore synthetase; ligase, non-ribosomal 100.0
4gr5_A570 Non-ribosomal peptide synthetase; MBTH-like domain 100.0
3tsy_A 979 Fusion protein 4-coumarate--COA ligase 1, resvera 100.0
1t5h_X504 4-chlorobenzoyl COA ligase; adenylate-forming coen 100.0
3r44_A517 Fatty acyl COA synthetase FADD13 (fatty-acyl-COA s 100.0
3l8c_A521 D-alanine--poly(phosphoribitol) ligase subunit 1; 100.0
4dg8_A 620 PA1221; ANL superfamily, adenylation domain, pepti 100.0
1ry2_A 663 Acetyl-coenzyme A synthetase 1, acyl-activating en 100.0
3fce_A512 D-alanine--poly(phosphoribitol) ligase subunit 1; 100.0
3e7w_A511 D-alanine--poly(phosphoribitol) ligase subunit 1; 100.0
3rg2_A 617 Enterobactin synthase component E (ENTE), 2,3-DIH 100.0
1amu_A563 GRSA, gramicidin synthetase 1; peptide synthetase, 100.0
3gqw_A576 Fatty acid AMP ligase; FAAL, E. coli, ATP-dependen 100.0
3ivr_A509 Putative long-chain-fatty-acid COA ligase; structu 100.0
3ipl_A501 2-succinylbenzoate--COA ligase; structural genomic 100.0
3kxw_A590 Saframycin MX1 synthetase B; fatty acid AMP ligase 100.0
2vsq_A 1304 Surfactin synthetase subunit 3; ligase, peptidyl c 100.0
3qov_A436 Phenylacetate-coenzyme A ligase; acetyl-COA synthe 99.97
2y27_A437 Phenylacetate-coenzyme A ligase; phenylacetic acid 99.96
2y4o_A443 Phenylacetate-coenzyme A ligase; phenylacetic acid 99.96
3t5a_A480 Long-chain-fatty-acid--AMP ligase FADD28; acetyl-C 99.96
4gs5_A358 Acyl-COA synthetase (AMP-forming)/AMP-acid ligase 99.95
3hgu_A369 EHPF; phenazine, antibiotic, biosynthetic protein; 99.79
4eql_A 581 4-substituted benzoates-glutamate ligase GH3.12; f 98.61
4b2g_A 609 GH3-1 auxin conjugating enzyme; signaling protein, 98.59
4epl_A 581 Jasmonic acid-amido synthetase JAR1; ANL adenylati 98.36
3lax_A109 Phenylacetate-coenzyme A ligase; structural genomi 98.13
3gxs_A109 Phenylacetate-coenzyme A ligase; APC62324.1, struc 98.04
>3etc_A AMP-binding protein; adenylate-forming acyl-COA synthetase ligase, ligase; HET: PGE 1PE EPE; 2.10A {Methanosarcina acetivorans} Back     alignment and structure
Probab=100.00  E-value=1.2e-39  Score=279.83  Aligned_cols=182  Identities=21%  Similarity=0.267  Sum_probs=163.2

Q ss_pred             CccccchhHHHHHHHhhhhhccCCceeEEEEecCCCCHHHHHHHHHHhCCcEEeecccccCCCceeecccCCccCCCCCc
Q psy14311          2 KGIYRRNSIWDKLVFKKVQEDMGGNLRLMLAGSAPLAGNVLTFLRCALGCLVIEGYGQTECVAPITLTIQGDYVPEHVGP   81 (199)
Q Consensus         2 ~~~~~~P~~~~~l~~~~~~~~~~~slr~i~~~G~~~~~~~~~~~~~~~~~~i~~~yG~tE~~~~~~~~~~~~~~~~~~G~   81 (199)
                      +.++++|++++.|+........+++||.+++||+++++++.++|.+.+++++++.||+||++..++........++++|+
T Consensus       318 t~~~~~P~~~~~l~~~~~~~~~l~~lr~i~~gGe~l~~~~~~~~~~~~g~~i~~~YG~TE~~~~~~~~~~~~~~~~~~G~  397 (580)
T 3etc_A          318 TTFCAPPTIYRFLIKEDLSHYNFSTLKYAVVAGEPLNPEVFNRFLEFTGIKLMEGFGQTETVVTIATFPWMEPKPGSIGK  397 (580)
T ss_dssp             CEEEECHHHHHHHHTSCC---CCTTCCEEEECSSCCCHHHHHHHHHHHSCCCEEEECCTTSSCCEECCTTSCCCTTCCBE
T ss_pred             eEEEccHHHHHHHHhcccccCCCccceEEEEccCCCCHHHHHHHHHHhCCeEecccccccccceeecCCCCCCCCCcccc
Confidence            45678999999998765555667899999999999999999999999999999999999998877766555567789999


Q ss_pred             cccCcEEEEEeCCCCcccCCCCcceEEEec-----CcccccccCCCcCCC-CCCCCeeecCceEEEcCCCeEEEEeeeee
Q psy14311         82 PICCCSVKLVDVPEMDYFAHEGKGEVCVRG-----NNVFLGYFKDPELNS-IDELGWHHTGDVGMWLPTLFFFFIPMLVI  155 (199)
Q Consensus        82 p~~~~~~~v~d~~~~~~~~~g~~Gel~i~~-----~~~~~gy~~~~~~~~-~~~~g~~~TGD~~~~d~~g~l~~~~r~~~  155 (199)
                      |+++++++|+| ++++++++|+.|||++++     ++++.||+++|+.+. .+.+|||+|||+|++|+||+|+|+     
T Consensus       398 p~~~~~v~ivd-~~g~~~~~g~~GEl~v~~~~g~~~~~~~gY~~~p~~t~~~f~~gwy~TGDlg~~d~dG~l~~~-----  471 (580)
T 3etc_A          398 PTPGYKIELMD-RDGRLCEVGEEGEIVINTMEGKPVGLFVHYGKDPERTEETWHDGYYHTGDMAWMDEDGYLWFV-----  471 (580)
T ss_dssp             ECTTCEEEEEC-TTSCBCCTTCCEEEEEECTTCCCTTCCCEETTCHHHHHHHEETTEEEEEEEEEECTTSCEEEE-----
T ss_pred             CCCCCEEEEEC-CCCCCCCCCCceEEEEecCCCCCCeeeccccCCHhHHHhhcCCCEEecCcEEEECCCCcEEEE-----
Confidence            99999999999 779999999999999996     789999999999988 556899999999999999999999     


Q ss_pred             eeEeeecCeEEEecceecccccccccccCCcccccccc
Q psy14311        156 MLMYTRIGLRIRSRSRHSLGKRVEGTVHGETKRSQSRK  193 (199)
Q Consensus       156 ~~~~gR~~~~i~~~g~~v~~~eiE~~l~~~~~~~~~~~  193 (199)
                          ||.||+||++|++|+|.|||++|.+||.|.++..
T Consensus       472 ----GR~dd~Ik~~G~~I~p~eIE~~l~~~p~V~~a~V  505 (580)
T 3etc_A          472 ----GRADDIIKTSGYKVGPFEVESALIQHPAVLECAI  505 (580)
T ss_dssp             ----EESSSCEEETTEEECHHHHHHHHTTSTTEEEEEE
T ss_pred             ----ecCCCEEEECCEEECHHHHHHHHHhCCCeeeEEE
Confidence                9999999999999999999999999999987643



>4fuq_A Malonyl COA synthetase; ANL superfamily, methylma malonate, ligase; HET: MSE; 1.70A {Rhodopseudomonas palustris} PDB: 4fut_A* 4gxr_A* 4gxq_A* Back     alignment and structure
>3ni2_A 4-coumarate:COA ligase; 4CL, phenylpropanoid biosynthesis; HET: AYL EPE; 1.90A {Populus tomentosa} PDB: 3a9v_A* 3a9u_A* Back     alignment and structure
>3rix_A Luciferase, luciferin 4-monooxygenase; oxidoreductase, photoprotein, luminescence, aspulvinone, natural product extracts; HET: 923; 1.70A {Photinus pyralis} SCOP: e.23.1.1 PDB: 1ba3_A 1lci_A* 4e5d_A* 3ies_A* 3iep_A* 3ier_A* 4g36_A* 4g37_A* 3qya_A Back     alignment and structure
>2d1s_A Luciferase, luciferin 4-monooxygenase; alpha/beta, beta barrel, alpha+beta, riken structural genomics/proteomics initiative, RSGI; HET: SLU; 1.30A {Luciola cruciata} PDB: 2d1q_A* 2d1r_A* 2d1t_A* Back     alignment and structure
>3c5e_A Acyl-coenzyme A synthetase ACSM2A, mitochondrial; middle-chain acyl-COA synthetase, xenobiotic/medium-chain FA COA ligase; HET: ATP; 1.60A {Homo sapiens} PDB: 2vze_A 3b7w_A* 3day_A* 3eq6_A* 3eyn_A* 3gpc_A* 2wd9_A* Back     alignment and structure
>3g7s_A Long-chain-fatty-acid--COA ligase (FADD-1); protein structure initiative, PSI-II, NYSGXRC, 11193J, structural genomics; 2.15A {Archaeoglobus fulgidus dsm 4304} Back     alignment and structure
>3nyq_A Malonyl-COA ligase; A/B topology ababa sandwich beta-barrel adenylate-forming EN fold; HET: MCA AMP; 1.43A {Streptomyces coelicolor} PDB: 3nyr_A* Back     alignment and structure
>1v25_A Long-chain-fatty-acid-COA synthetase; ligase, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.30A {Thermus thermophilus} SCOP: e.23.1.1 PDB: 1ult_A* 1v26_A* Back     alignment and structure
>3o83_A Peptide arylation enzyme; ligase, adenylation of 2,3-dihydroxybenzoate and transfer to pantetheine cofactor of BASF; HET: IXN; 1.90A {Acinetobacter baumannii} SCOP: e.23.1.0 PDB: 3o82_A* 3o84_A* 3u16_A* 3u17_A* Back     alignment and structure
>1pg4_A Acetyl-COA synthetase; AMP-forming, adenylate-forming, thioester-forming, ligase; HET: COA PRX; 1.75A {Salmonella enterica} SCOP: e.23.1.1 PDB: 1pg3_A* 2p2f_A* 2p2b_A* 2p2q_A* 2p2j_A* 2p20_A* 2p2m_A* Back     alignment and structure
>1mdb_A 2,3-dihydroxybenzoate-AMP ligase; adenylation domain, peptide synthetase, antibiotic biosynthesis, siderophore formation; HET: AMP DBH; 2.15A {Bacillus subtilis} SCOP: e.23.1.1 PDB: 1md9_A* 1mdf_A Back     alignment and structure
>2v7b_A Benzoate-coenzyme A ligase; benzoate oxidation, benzoate COA ligase; 1.84A {Burkholderia xenovorans} Back     alignment and structure
>3ite_A SIDN siderophore synthetase; ligase, non-ribosomal peptide synthesis, NRPS, sidna3, fungal, endophyte; HET: MSE; 2.00A {Neotyphodium lolii} Back     alignment and structure
>4gr5_A Non-ribosomal peptide synthetase; MBTH-like domain, adenylation domain, ligase, rossmann fold, binding; HET: APC TLA; 1.92A {Streptomyces lydicus} PDB: 4gr4_A Back     alignment and structure
>3tsy_A Fusion protein 4-coumarate--COA ligase 1, resvera synthase; transferase; 3.10A {Arabidospis thaliana} Back     alignment and structure
>1t5h_X 4-chlorobenzoyl COA ligase; adenylate-forming coenzyme A ligase domain alternation confo change; 2.00A {Alcaligenes SP} SCOP: e.23.1.1 PDB: 1t5d_X 3cw9_A* 3cw8_X* 2qvz_X* 2qw0_X* 3dlp_X* 2qvx_X* 2qvy_X* Back     alignment and structure
>3r44_A Fatty acyl COA synthetase FADD13 (fatty-acyl-COA synthetase); ligase; HET: HIS; 1.80A {Mycobacterium tuberculosis} PDB: 3t5c_A 3t5b_A Back     alignment and structure
>3l8c_A D-alanine--poly(phosphoribitol) ligase subunit 1; structural genomics, DLTA, ATP-binding, cytoplasm, nucleotide-binding; 2.41A {Streptococcus pyogenes serotype M6} PDB: 3lgx_A* Back     alignment and structure
>4dg8_A PA1221; ANL superfamily, adenylation domain, peptidyl carrier protei ribosomal peptide synthetase, NRPS, valine adenylation, LIG; HET: AMP; 2.15A {Pseudomonas aeruginosa} PDB: 4dg9_A* Back     alignment and structure
>1ry2_A Acetyl-coenzyme A synthetase 1, acyl-activating enzyme 1; AMP forming, related to firefly luciferase, ligase; HET: AMP; 2.30A {Saccharomyces cerevisiae} SCOP: e.23.1.1 Back     alignment and structure
>3fce_A D-alanine--poly(phosphoribitol) ligase subunit 1; DLTA, AMP-forming domain, adenylation, D-alanine protein ligase, ATP complex; HET: ATP; 1.90A {Bacillus cereus} PDB: 3fcc_A* 3dhv_A* Back     alignment and structure
>3e7w_A D-alanine--poly(phosphoribitol) ligase subunit 1; DLTA, non-ribosomal peptide synthetase, NRPS, adenylation domain, D-alanylation; HET: AMP; 2.28A {Bacillus subtilis} PDB: 3e7x_A* Back     alignment and structure
>3rg2_A Enterobactin synthase component E (ENTE), 2,3-DIH dihydroxybenzoate synthetase, isochroismatase...; adenylate-forming enzymes, ANL superfamily; HET: SVS PNS; 3.10A {Escherichia coli} Back     alignment and structure
>1amu_A GRSA, gramicidin synthetase 1; peptide synthetase, adenylate forming; HET: PHE AMP; 1.90A {Brevibacillus brevis} SCOP: e.23.1.1 Back     alignment and structure
>3ivr_A Putative long-chain-fatty-acid COA ligase; structural genomics, PSI-2, protein S initiative, fatty acid synthesis; HET: GOL; 2.00A {Rhodopseudomonas palustris} SCOP: e.23.1.0 Back     alignment and structure
>3ipl_A 2-succinylbenzoate--COA ligase; structural genomics, acyl-protein synthetase, PSI-2, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>3kxw_A Saframycin MX1 synthetase B; fatty acid AMP ligase, SGX, acyl adenylate, structural genom 2, protein structure initiative; HET: 1ZZ; 1.85A {Legionella pneumophila subsp} PDB: 3lnv_A* Back     alignment and structure
>2vsq_A Surfactin synthetase subunit 3; ligase, peptidyl carrier protein, ligase phosphoprotein, TER module, phosphopantetheine; 2.60A {Bacillus subtilis} Back     alignment and structure
>3qov_A Phenylacetate-coenzyme A ligase; acetyl-COA synthetase-like, structural genomics, joint cente structural genomics, JCSG; HET: MSE ADP COA; 2.20A {Bacteroides thetaiotaomicron} PDB: 3s89_A* Back     alignment and structure
>2y27_A Phenylacetate-coenzyme A ligase; phenylacetic acid degradation pathway; HET: MSE PG4 ATP; 1.60A {Burkholderia cenocepacia} PDB: 2y4n_A* Back     alignment and structure
>2y4o_A Phenylacetate-coenzyme A ligase; phenylacetic acid degradation pathway; HET: DLL; 1.90A {Burkholderia cenocepacia} Back     alignment and structure
>3t5a_A Long-chain-fatty-acid--AMP ligase FADD28; acetyl-COA synthetase like fold, AMP-binding; 2.05A {Mycobacterium tuberculosis} PDB: 3e53_A Back     alignment and structure
>4gs5_A Acyl-COA synthetase (AMP-forming)/AMP-acid ligase protein; structural genomics, PSI-biology; 2.02A {Dyadobacter fermentans} Back     alignment and structure
>3hgu_A EHPF; phenazine, antibiotic, biosynthetic protein; 1.95A {Pantoea agglomerans} PDB: 3hgv_A 3l2k_A* Back     alignment and structure
>4eql_A 4-substituted benzoates-glutamate ligase GH3.12; firefly luciferase family, acyl adenylase, amino acid conjug ligase; HET: AMP SAL; 1.80A {Arabidopsis thaliana} PDB: 4epm_A* 4eq4_A* 4ewv_A* Back     alignment and structure
>4b2g_A GH3-1 auxin conjugating enzyme; signaling protein, ignaling protein, adenylate, amino acid conjugation, plant growth; HET: V1N; 2.40A {Vitis vinifera} Back     alignment and structure
>4epl_A Jasmonic acid-amido synthetase JAR1; ANL adenylating enzyme, acyl acid-amido synthetase, adenylat ligase; HET: JAI; 2.01A {Arabidopsis thaliana} Back     alignment and structure
>3lax_A Phenylacetate-coenzyme A ligase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 1.43A {Bacteroides vulgatus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 199
d1lcia_541 e.23.1.1 (A:) Luciferase {Firefly (Photinus pyrali 1e-20
d1pg4a_643 e.23.1.1 (A:) Acetyl-CoA synthetase {Salmonella en 2e-18
d1v25a_534 e.23.1.1 (A:) Long chain fatty acid-CoA ligase TT0 4e-18
d1ry2a_640 e.23.1.1 (A:) Acetyl-CoA synthetase {Baker's yeast 2e-14
d1amua_514 e.23.1.1 (A:) Phenylalanine activating domain of g 3e-10
d1mdba_536 e.23.1.1 (A:) Dihydroxybenzoate-AMP ligase DhbE {B 3e-07
d3cw9a1503 e.23.1.1 (A:1-503) 4-chlorobenzoyl CoA ligase {Alc 4e-07
>d1lcia_ e.23.1.1 (A:) Luciferase {Firefly (Photinus pyralis) [TaxId: 7054]} Length = 541 Back     information, alignment and structure

class: Multi-domain proteins (alpha and beta)
fold: Acetyl-CoA synthetase-like
superfamily: Acetyl-CoA synthetase-like
family: Acetyl-CoA synthetase-like
domain: Luciferase
species: Firefly (Photinus pyralis) [TaxId: 7054]
 Score = 86.9 bits (214), Expect = 1e-20
 Identities = 36/125 (28%), Positives = 55/125 (44%), Gaps = 2/125 (1%)

Query: 28  RLMLAGSAPLAGNVLTFLRCALGCLVIEGYGQTECVAPITLTIQGDYVPEHVGPPICCCS 87
            +   G+           +      + +GYG TE  + I +T +GD  P  VG  +    
Sbjct: 308 EIASGGAPLSKEVGEAVAKRFHLPGIRQGYGLTETTSAILITPEGDDKPGAVGKVVPFFE 367

Query: 88  VKLVDVPEMDYFAHEGKGEVCVRGNNVFLGYFKDPELN--SIDELGWHHTGDVGMWLPTL 145
            K+VD+          +GE+CVRG  +  GY  +PE     ID+ GW H+GD+  W    
Sbjct: 368 AKVVDLDTGKTLGVNQRGELCVRGPMIMSGYVNNPEATNALIDKDGWLHSGDIAYWDEDE 427

Query: 146 FFFFI 150
            FF +
Sbjct: 428 HFFIV 432


>d1pg4a_ e.23.1.1 (A:) Acetyl-CoA synthetase {Salmonella enterica [TaxId: 28901]} Length = 643 Back     information, alignment and structure
>d1v25a_ e.23.1.1 (A:) Long chain fatty acid-CoA ligase TT0168 {Thermus thermophilus [TaxId: 274]} Length = 534 Back     information, alignment and structure
>d1ry2a_ e.23.1.1 (A:) Acetyl-CoA synthetase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 640 Back     information, alignment and structure
>d1amua_ e.23.1.1 (A:) Phenylalanine activating domain of gramicidin synthetase 1 {Bacillus brevis [TaxId: 1393]} Length = 514 Back     information, alignment and structure
>d1mdba_ e.23.1.1 (A:) Dihydroxybenzoate-AMP ligase DhbE {Bacillus subtilis [TaxId: 1423]} Length = 536 Back     information, alignment and structure
>d3cw9a1 e.23.1.1 (A:1-503) 4-chlorobenzoyl CoA ligase {Alcaligenes sp. [TaxId: 512]} Length = 503 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query199
d1pg4a_643 Acetyl-CoA synthetase {Salmonella enterica [TaxId: 100.0
d1lcia_541 Luciferase {Firefly (Photinus pyralis) [TaxId: 705 100.0
d1v25a_534 Long chain fatty acid-CoA ligase TT0168 {Thermus t 100.0
d1ry2a_ 640 Acetyl-CoA synthetase {Baker's yeast (Saccharomyce 100.0
d1amua_514 Phenylalanine activating domain of gramicidin synt 99.96
d1mdba_536 Dihydroxybenzoate-AMP ligase DhbE {Bacillus subtil 99.95
d3cw9a1503 4-chlorobenzoyl CoA ligase {Alcaligenes sp. [TaxId 99.93
>d1pg4a_ e.23.1.1 (A:) Acetyl-CoA synthetase {Salmonella enterica [TaxId: 28901]} Back     information, alignment and structure
class: Multi-domain proteins (alpha and beta)
fold: Acetyl-CoA synthetase-like
superfamily: Acetyl-CoA synthetase-like
family: Acetyl-CoA synthetase-like
domain: Acetyl-CoA synthetase
species: Salmonella enterica [TaxId: 28901]
Probab=100.00  E-value=2.9e-36  Score=259.46  Aligned_cols=182  Identities=14%  Similarity=0.157  Sum_probs=159.4

Q ss_pred             CccccchhHHHHHHHhhh---hhccCCceeEEEEecCCCCHHHHHHHHHHhC---CcEEeecccccCCCceeecccC--C
Q psy14311          2 KGIYRRNSIWDKLVFKKV---QEDMGGNLRLMLAGSAPLAGNVLTFLRCALG---CLVIEGYGQTECVAPITLTIQG--D   73 (199)
Q Consensus         2 ~~~~~~P~~~~~l~~~~~---~~~~~~slr~i~~~G~~~~~~~~~~~~~~~~---~~i~~~yG~tE~~~~~~~~~~~--~   73 (199)
                      +.++++|++++.|+....   ...++++||.++++|+++++++++++.+.++   +.+++.||+||+++.++.....  .
T Consensus       348 t~~~~~P~~l~~l~~~~~~~~~~~dl~sLr~i~~~G~pl~~~~~~~~~~~~g~~~~~i~~~yG~TE~g~~~~~~~~~~~~  427 (643)
T d1pg4a_         348 NILYTAPTAIRALMAEGDKAIEGTDRSSLRILGSVGEPINPEAWEWYWKKIGKEKCPVVDTWWQTETGGFMITPLPGAIE  427 (643)
T ss_dssp             SEEEECHHHHHHHHTTGGGGTTTCCCTTCCEEEEESSCCCHHHHHHHHHHTTTTCSCEEEEBCCGGGSSCSBCCCTTTCC
T ss_pred             cEEEehHHHHHHHHhCcchhccccCCCceEEEEEEeCCCCHHHHHHHHHHhCCCCceEEEeechhhccceEEecCCCccC
Confidence            457789999999986543   3345689999999999999999999999984   6799999999999866654332  3


Q ss_pred             ccCCCCCccccCcEEEEEeCCCCcccCCCCcceEEEec--CcccccccCCCcCCC----CCCCCeeecCceEEEcCCCeE
Q psy14311         74 YVPEHVGPPICCCSVKLVDVPEMDYFAHEGKGEVCVRG--NNVFLGYFKDPELNS----IDELGWHHTGDVGMWLPTLFF  147 (199)
Q Consensus        74 ~~~~~~G~p~~~~~~~v~d~~~~~~~~~g~~Gel~i~~--~~~~~gy~~~~~~~~----~~~~g~~~TGD~~~~d~~g~l  147 (199)
                      ..++++|+|+++++++++| ++|++++.|+.|||++++  |+++.+||++++.+.    ...+|||+|||++++|++|+|
T Consensus       428 ~~~gs~G~p~~g~~v~ivd-~~g~~~~~g~~Gel~v~~~~p~~~~~~~~~~~~~~~~~~~~~~g~~~TGDl~~~d~dG~l  506 (643)
T d1pg4a_         428 LKAGSATRPFFGVQPALVD-NEGHPQEGATEGNLVITDSWPGQARTLFGDHERFEQTYFSTFKNMYFSGDGARRDEDGYY  506 (643)
T ss_dssp             BCTTCCBSBCTTCCEEEEC-TTCCBCCSSEEEEEEECSCCTTCCCEETTCHHHHHHHHHSSSTTSEEEEEEEEECTTSCE
T ss_pred             CCCCccccccCCCEEEEEC-CCCCCCCCCceEEEEEecCCCcccccccCChhhchhhhcccCCCeEEcCCEEEECCCceE
Confidence            4678999999999999999 789999999999999998  578999999998765    456899999999999999999


Q ss_pred             EEEeeeeeeeEeeecCeEEEecceecccccccccccCCcccccccc
Q psy14311        148 FFIPMLVIMLMYTRIGLRIRSRSRHSLGKRVEGTVHGETKRSQSRK  193 (199)
Q Consensus       148 ~~~~r~~~~~~~gR~~~~i~~~g~~v~~~eiE~~l~~~~~~~~~~~  193 (199)
                      +++         ||.+|+||.+|++|+|.|||++|.+||+|.++..
T Consensus       507 ~i~---------GR~dd~ik~~G~ri~p~eIE~~l~~~p~V~eaaV  543 (643)
T d1pg4a_         507 WIT---------GRVDDVLNVSGHRLGTAEIESALVAHPKIAEAAV  543 (643)
T ss_dssp             EEE---------EESSSEEEETTEEEEHHHHHHHHHHSTTEEEEEE
T ss_pred             EEe---------cccccEEEECCEEECHHHHHHHHHhCCCcceEEE
Confidence            999         9999999999999999999999999999987643



>d1lcia_ e.23.1.1 (A:) Luciferase {Firefly (Photinus pyralis) [TaxId: 7054]} Back     information, alignment and structure
>d1v25a_ e.23.1.1 (A:) Long chain fatty acid-CoA ligase TT0168 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ry2a_ e.23.1.1 (A:) Acetyl-CoA synthetase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1amua_ e.23.1.1 (A:) Phenylalanine activating domain of gramicidin synthetase 1 {Bacillus brevis [TaxId: 1393]} Back     information, alignment and structure
>d1mdba_ e.23.1.1 (A:) Dihydroxybenzoate-AMP ligase DhbE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d3cw9a1 e.23.1.1 (A:1-503) 4-chlorobenzoyl CoA ligase {Alcaligenes sp. [TaxId: 512]} Back     information, alignment and structure