Psyllid ID: psy14313

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------
MDKNDTRILFIGSGEILYESGFCGMLEVPRGVPMYELSFLFFFFIPMLVIMLMYTRIGLRIRSRSRHSLGKRVEGTVHGETKRSQSRKSIIRMLTAVVTTFFLCWAPFHAQRLIYLYARDSQYFASLNEWLFMIAGGFYYVSSTVNPILYNVMSVKYRQAFKQTLCCRGGSHGSFARDQSSFRETMVDVASPQWSRAMTWKRQPSRRPNNVSASADAHEGKTNYTSVLTIVAFSMERYLAICHPLLSYAMSGLRRAIRIIAVLWLFGFLCATPFAVYTTINYVDFPPGKYTTINYVDYPPPLAGLQESGVVVKPLTS
ccccccEEEEEcccEEEEcccEEEEEEccccccEEEEHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccEEEEEHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEcccccEEEEEEEcccccccccccccEEEEcccc
cccccEEEEEEEcccccccccEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHcHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEcHHHHcccccccccccccccHHHHHHHHHHHHHHHHHccccEEEEEEEEEEcccccEEEEEEccccccccccccccEEEEcccc
mdkndtrilfIGSGEILYESGfcgmlevprgvpmyeLSFLFFFFIPMLVIMLMYTRIGlrirsrsrhslgkrvegtvhgetkrsqSRKSIIRMLTAVVTTFFLCWAPFHAQRLIYLYARDSQYFASLNEWLFMIAGGFYYVSSTVNPILYNVMSVKYRQAFKQTlccrggshgsfardqssfretmvdvaspqwsramtwkrqpsrrpnnvsasadahegktnyTSVLTIVAFSMERYLAICHPLLSYAMSGLRRAIRIIAVLWLFGflcatpfavyttinyvdfppgkyttinyvdyppplaglqesgvvvkplts
MDKNDTRILFIGSGEILYESGFCGMLEVPRGVPMYELSFLFFFFIPMLVIMLMYTRIGLRirsrsrhslgkrvegtvhgetkrsqsrksIIRMLTAVVTTFFLCWAPFHAQRLIYLYARDSQYFASLNEWLFMIAGGFYYVSSTVNPILYNVMSVKYRQAFKQTLccrggshgsfardqssfrETMVDVaspqwsramtwkrqpsrrpnnvsasadahegktnYTSVLTIVAFSMERYLAICHPLLSYAMSGLRRAIRIIAVLWLFGFLCATPFAVYTTINYVDFPPGKYTTINYVDYPPPlaglqesgvvvkplts
MDKNDTRILFIGSGEILYESGFCGMLEVPRGVPMYELSFLFFFFIPMLVIMLMYTRIGLRIRSRSRHSLGKRVEGTVHGETKRSQSRKSIIRMLTAVVTTFFLCWAPFHAQRLIYLYARDSQYFASLNEWLFMIAGGFYYVSSTVNPILYNVMSVKYRQAFKQTLCCRGGSHGSFARDQSSFRETMVDVASPQWSRAMTWKRQPSRRPNNVSASADAHEGKTNYTSVLTIVAFSMERYLAICHPLLSYAMSGLRRAIRIIAVLWLFGFLCATPFAVYTTINYVDFPPGKYTTINYVDYPPPLAGLQESGVVVKPLTS
******RILFIGSGEILYESGFCGMLEVPRGVPMYELSFLFFFFIPMLVIMLMYTRIGLRIR**************************SIIRMLTAVVTTFFLCWAPFHAQRLIYLYARDSQYFASLNEWLFMIAGGFYYVSSTVNPILYNVMSVKYRQAFKQTLCCRGGSH**************************************************NYTSVLTIVAFSMERYLAICHPLLSYAMSGLRRAIRIIAVLWLFGFLCATPFAVYTTINYVDFPPGKYTTINYVDYPPPLAGLQ***********
***NDTRILFIGSGEILYESGFCGMLEVPRGVPMYELSFLFFFFIPMLVIMLMYTRIGLRI******************************RMLTAVVTTFFLCWAPFHAQRLIYLYARDSQYFASLNEWLFMIAGGFYYVSSTVNPILYNVMSVKYRQAFKQTLC*******************************MTWKRQPSRRPNNVSASADAHEGKTNYTSVLTIVAFSMERYLAICHPLLSYAMSGLRRAIRIIAVLWLFGFLCATPFAVYTTINYVDFPPGKYTTINYVDYPPPLAGLQESGVVVKPL**
MDKNDTRILFIGSGEILYESGFCGMLEVPRGVPMYELSFLFFFFIPMLVIMLMYTRIGLRIRSRSR*********************KSIIRMLTAVVTTFFLCWAPFHAQRLIYLYARDSQYFASLNEWLFMIAGGFYYVSSTVNPILYNVMSVKYRQAFKQTLCCRGGSHGSFARDQSSFRETMVDVASPQWSRA*******************AHEGKTNYTSVLTIVAFSMERYLAICHPLLSYAMSGLRRAIRIIAVLWLFGFLCATPFAVYTTINYVDFPPGKYTTINYVDYPPPLAGLQESGVVVKPLTS
***NDTRILFIGSGEILYESGFCGMLEVPRGVPMYELSFLFFFFIPMLVIMLMYTRIGLRIRSR*********************SRKSIIRMLTAVVTTFFLCWAPFHAQRLIYLYARDSQYFASLNEWLFMIAGGFYYVSSTVNPILYNVMSVKYRQAFKQTLCCRGG***************************************************TNYTSVLTIVAFSMERYLAICHPLLSYAMSGLRRAIRIIAVLWLFGFLCATPFAVYTTINYVDFPPGKYTTINYVDYPPPLAGLQESGVVVKPL**
ooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDKNDTRILFIGSGEILYESGFCGMLEVPRGVPMYELSFLFFFFIPMLVIMLMYTRIGLRIRSRSRHSLGKRVEGTVHGETKRSQSRKSIIRMLTAVVTTFFLCWAPFHAQRLIYLYARDSQYFASLNEWLFMIAGGFYYVSSTVNPILYNVMSVKYRQAFKQTLCCRGGSHGSFARDQSSFRETMVDVASPQWSRAMTWKRQPSRRPNNVSASADAHEGKTNYTSVLTIVAFSMERYLAICHPLLSYAMSGLRRAIRIIAVLWLFGFLCATPFAVYTTINYVDFPPGKYTTINYVDYPPPLAGLQESGVVVKPLTS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query317 2.2.26 [Sep-21-2011]
Q8ITC7477 Neuropeptides capa recept yes N/A 0.605 0.402 0.475 1e-44
Q58CW4407 Neuromedin-U receptor 2 O no N/A 0.570 0.444 0.287 6e-19
P30989418 Neurotensin receptor type yes N/A 0.406 0.308 0.352 6e-17
Q9ESQ4395 Neuromedin-U receptor 2 O yes N/A 0.381 0.306 0.348 1e-16
Q8BZ39395 Neuromedin-U receptor 2 O yes N/A 0.381 0.306 0.348 2e-16
A5A4K9366 Growth hormone secretagog no N/A 0.438 0.379 0.325 6e-16
Q95254366 Growth hormone secretagog yes N/A 0.413 0.357 0.349 7e-16
Q9GZQ4415 Neuromedin-U receptor 2 O no N/A 0.457 0.349 0.288 8e-16
A5A4L1366 Growth hormone secretagog N/A N/A 0.413 0.357 0.349 9e-16
O55040405 Neuromedin-U receptor 1 O no N/A 0.476 0.372 0.321 1e-15
>sp|Q8ITC7|CAPAR_DROME Neuropeptides capa receptor OS=Drosophila melanogaster GN=capaR PE=2 SV=3 Back     alignment and function desciption
 Score =  180 bits (456), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 97/204 (47%), Positives = 135/204 (66%), Gaps = 12/204 (5%)

Query: 19  ESGFCGML-EVPRGVPMYELSFLFFFFIPMLVIMLMYTRIGLRIRSRSRHSLGKRVEGTV 77
           ES FC M  ++   +P++E+SF  FF IPM++I+L+Y R+G +IRSR+   LG + +GT 
Sbjct: 224 ESAFCSMSPKIVNEIPVFEVSFCIFFVIPMILIILLYGRMGAKIRSRTNQKLGVQ-QGTN 282

Query: 78  HGETKRSQSRK-SIIRMLTAVVTTFFLCWAPFHAQRLIYLYARDSQYFASLNEWLFMIAG 136
           + ET+ SQ RK ++IRML AVV TFF+CW PFH QRLI+LYA++   +  +NE LF IAG
Sbjct: 283 NRETRNSQMRKKTVIRMLAAVVITFFVCWFPFHLQRLIFLYAKNMDNYLDINEALFSIAG 342

Query: 137 GFYYVSSTVNPILYNVMSVKYRQAFKQTLCCR--GGSHGS-FARDQSSFRETMVDVASPQ 193
             YYVS TVNPI+Y+VMS +YR AF++ LC +  G  + S FARD SSFRE      S  
Sbjct: 343 FAYYVSCTVNPIVYSVMSRRYRVAFRELLCGKAVGAYYNSGFARDHSSFRE------SSA 396

Query: 194 WSRAMTWKRQPSRRPNNVSASADA 217
           + R  +   + S+ PN     + +
Sbjct: 397 YDRVHSVHVRASQHPNKFETDSSS 420
Acts as a receptor for the neuropeptides CAP-1 and CAP-2, but not CAP-3. Probably a component of signal transduction pathway that leads to Malpighian tubule fluid secretion in response to these ligands.
Drosophila melanogaster (taxid: 7227)
>sp|Q58CW4|NMUR2_BOVIN Neuromedin-U receptor 2 OS=Bos taurus GN=NMUR2 PE=2 SV=1 Back     alignment and function description
>sp|P30989|NTR1_HUMAN Neurotensin receptor type 1 OS=Homo sapiens GN=NTSR1 PE=1 SV=2 Back     alignment and function description
>sp|Q9ESQ4|NMUR2_RAT Neuromedin-U receptor 2 OS=Rattus norvegicus GN=Nmur2 PE=1 SV=2 Back     alignment and function description
>sp|Q8BZ39|NMUR2_MOUSE Neuromedin-U receptor 2 OS=Mus musculus GN=Nmur2 PE=2 SV=1 Back     alignment and function description
>sp|A5A4K9|GHSR_RABIT Growth hormone secretagogue receptor type 1 OS=Oryctolagus cuniculus GN=GHSR PE=2 SV=1 Back     alignment and function description
>sp|Q95254|GHSR_PIG Growth hormone secretagogue receptor type 1 OS=Sus scrofa GN=GHSR PE=2 SV=1 Back     alignment and function description
>sp|Q9GZQ4|NMUR2_HUMAN Neuromedin-U receptor 2 OS=Homo sapiens GN=NMUR2 PE=2 SV=2 Back     alignment and function description
>sp|A5A4L1|GHSR_MUSPF Growth hormone secretagogue receptor type 1 OS=Mustela putorius furo GN=GHSR PE=2 SV=1 Back     alignment and function description
>sp|O55040|NMUR1_MOUSE Neuromedin-U receptor 1 OS=Mus musculus GN=Nmur1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query317
328710440 502 PREDICTED: neuropeptides capa receptor-l 0.548 0.346 0.646 1e-60
62528997 473 CAPA-like receptor [Anopheles gambiae] 0.555 0.372 0.583 9e-54
307207300 533 Neuropeptides capa receptor [Harpegnatho 0.504 0.300 0.589 2e-51
148277568381 capa receptor-like GPCR [Apis mellifera] 0.460 0.383 0.544 8e-51
307172982 466 Neuropeptides capa receptor [Camponotus 0.488 0.332 0.578 9e-51
383853616 456 PREDICTED: neuropeptides capa receptor-l 0.529 0.368 0.520 2e-49
350415577 465 PREDICTED: neuropeptides capa receptor-l 0.507 0.346 0.548 2e-49
380026186382 PREDICTED: neuropeptides capa receptor-l 0.488 0.405 0.537 1e-48
357610257 741 neuropeptide receptor A27 [Danaus plexip 0.561 0.240 0.545 2e-48
340710406 465 PREDICTED: neuropeptides capa receptor-l 0.492 0.335 0.553 5e-48
>gi|328710440|ref|XP_001950333.2| PREDICTED: neuropeptides capa receptor-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  239 bits (610), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 115/178 (64%), Positives = 141/178 (79%), Gaps = 4/178 (2%)

Query: 12  GSGEILYESGFCGMLE--VPRGVPMYELSFLFFFFIPMLVIMLMYTRIGLRIRSRSRHSL 69
           GSG  LYES FC ML+  VP GVP+YELS L FF +PM++I+++Y  IGL+IR  SRHSL
Sbjct: 189 GSGYPLYESAFCAMLDKNVPTGVPVYELSSLLFFLVPMMIIIVLYVLIGLQIRQSSRHSL 248

Query: 70  GKRVEGTVHGETKRSQSRKSIIRMLTAVVTTFFLCWAPFHAQRLIYLYARDSQYFASLNE 129
           GK+++G VHGETK+ QS+KSI+RML AVV  FFLCWAPFHAQRL+YLYA+DS Y+   NE
Sbjct: 249 GKQMQGNVHGETKQIQSKKSIVRMLAAVVIAFFLCWAPFHAQRLLYLYAKDSPYYTQANE 308

Query: 130 WLFMIAGGFYYVSSTVNPILYNVMSVKYRQAFKQTLCCRGGS-HGSFARD-QSSFRET 185
            L+ IAG FYY SSTVNPILYN+MS+KYR+AF++TLC   G      +RD QSSFR+T
Sbjct: 309 LLYTIAGCFYYFSSTVNPILYNLMSMKYRRAFRETLCGYSGDRRNRMSRDLQSSFRDT 366

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|62528997|gb|AAX84796.1| CAPA-like receptor [Anopheles gambiae] Back     alignment and taxonomy information
>gi|307207300|gb|EFN85050.1| Neuropeptides capa receptor [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|148277568|ref|NP_001091702.1| capa receptor-like GPCR [Apis mellifera] gi|77921736|gb|ABB05503.1| capa receptor-like GPCR [Apis mellifera] Back     alignment and taxonomy information
>gi|307172982|gb|EFN64124.1| Neuropeptides capa receptor [Camponotus floridanus] Back     alignment and taxonomy information
>gi|383853616|ref|XP_003702318.1| PREDICTED: neuropeptides capa receptor-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|350415577|ref|XP_003490685.1| PREDICTED: neuropeptides capa receptor-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|380026186|ref|XP_003696837.1| PREDICTED: neuropeptides capa receptor-like [Apis florea] Back     alignment and taxonomy information
>gi|357610257|gb|EHJ66899.1| neuropeptide receptor A27 [Danaus plexippus] Back     alignment and taxonomy information
>gi|340710406|ref|XP_003393782.1| PREDICTED: neuropeptides capa receptor-like [Bombus terrestris] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query317
FB|FBgn0037100477 capaR "capa receptor" [Drosoph 0.523 0.348 0.534 1.9e-42
ZFIN|ZDB-GENE-081104-220395 si:ch211-276k2.5 "si:ch211-276 0.473 0.379 0.343 4.6e-22
UNIPROTKB|J9P651333 NMUR1 "Uncharacterized protein 0.533 0.507 0.321 3e-21
FB|FBgn0038139599 CG8795 [Drosophila melanogaste 0.429 0.227 0.406 5.3e-21
UNIPROTKB|E1BWP2404 NMUR1 "Uncharacterized protein 0.501 0.393 0.319 1.7e-20
UNIPROTKB|F1MY53423 NMUR1 "Uncharacterized protein 0.479 0.359 0.317 4.7e-20
WB|WBGene00019616403 nmur-2 [Caenorhabditis elegans 0.463 0.364 0.35 6.3e-20
FB|FBgn0038140 660 CG8784 [Drosophila melanogaste 0.520 0.25 0.348 1.7e-19
UNIPROTKB|Q58CW4407 NMUR2 "Neuromedin-U receptor 2 0.501 0.390 0.290 1.9e-19
MGI|MGI:1341898405 Nmur1 "neuromedin U receptor 1 0.470 0.367 0.339 4e-19
FB|FBgn0037100 capaR "capa receptor" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 449 (163.1 bits), Expect = 1.9e-42, P = 1.9e-42
 Identities = 92/172 (53%), Positives = 125/172 (72%)

Query:    19 ESGFCGML-EVPRGVPMYELSFLFFFFIPMLVIMLMYTRIGLRIRSRSRHSLGKRVEGTV 77
             ES FC M  ++   +P++E+SF  FF IPM++I+L+Y R+G +IRSR+   LG + +GT 
Sbjct:   224 ESAFCSMSPKIVNEIPVFEVSFCIFFVIPMILIILLYGRMGAKIRSRTNQKLGVQ-QGTN 282

Query:    78 HGETKRSQSRK-SIIRMLTAVVTTFFLCWAPFHAQRLIYLYARDSQYFASLNEWLFMIAG 136
             + ET+ SQ RK ++IRML AVV TFF+CW PFH QRLI+LYA++   +  +NE LF IAG
Sbjct:   283 NRETRNSQMRKKTVIRMLAAVVITFFVCWFPFHLQRLIFLYAKNMDNYLDINEALFSIAG 342

Query:   137 GFYYVSSTVNPILYNVMSVKYRQAFKQTLCCR--GGSHGS-FARDQSSFRET 185
               YYVS TVNPI+Y+VMS +YR AF++ LC +  G  + S FARD SSFRE+
Sbjct:   343 FAYYVSCTVNPIVYSVMSRRYRVAFRELLCGKAVGAYYNSGFARDHSSFRES 394
GO:0004930 "G-protein coupled receptor activity" evidence=ISS;IDA
GO:0008188 "neuropeptide receptor activity" evidence=ISS;NAS;IDA
GO:0007186 "G-protein coupled receptor signaling pathway" evidence=IEA;ISS;NAS
GO:0016021 "integral to membrane" evidence=IEA;ISS;NAS
GO:0005887 "integral to plasma membrane" evidence=ISS
GO:0007589 "body fluid secretion" evidence=TAS
GO:0001607 "neuromedin U receptor activity" evidence=IEA
GO:0051928 "positive regulation of calcium ion transport" evidence=IMP
GO:0016323 "basolateral plasma membrane" evidence=IDA
GO:0071465 "cellular response to desiccation" evidence=IMP
ZFIN|ZDB-GENE-081104-220 si:ch211-276k2.5 "si:ch211-276k2.5" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|J9P651 NMUR1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
FB|FBgn0038139 CG8795 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|E1BWP2 NMUR1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1MY53 NMUR1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
WB|WBGene00019616 nmur-2 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
FB|FBgn0038140 CG8784 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q58CW4 NMUR2 "Neuromedin-U receptor 2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1341898 Nmur1 "neuromedin U receptor 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query317
pfam00001251 pfam00001, 7tm_1, 7 transmembrane receptor (rhodop 2e-16
pfam00001251 pfam00001, 7tm_1, 7 transmembrane receptor (rhodop 7e-12
PHA03235 409 PHA03235, PHA03235, DNA packaging protein UL33; Pr 0.003
>gnl|CDD|215646 pfam00001, 7tm_1, 7 transmembrane receptor (rhodopsin family) Back     alignment and domain information 
 Score = 77.0 bits (190), Expect = 2e-16
 Identities = 35/114 (30%), Positives = 53/114 (46%), Gaps = 8/114 (7%)

Query: 37  LSFLFFFFIPMLVIMLMYTRIGLRIRSRSRHSLGKRVEGTVHGETKRSQSRKSIIRMLTA 96
           LS L  F +P+LVI++ YT I   +R R+R    +          + S   +   +ML  
Sbjct: 146 LSTLLGFVLPLLVILVCYTLILRTLRKRARSGASQARA------KRSSSKERKAAKMLLV 199

Query: 97  VVTTFFLCWAPFHAQRLIYLYARDSQYFASLNEWLFMIAGGFYYVSSTVNPILY 150
           VV  F LCW P+H   ++ L +        L     +I     YV+S +NPI+Y
Sbjct: 200 VVVVFVLCWLPYHI--VLLLDSLCPLSIWRLLPTALLITLWLAYVNSCLNPIIY 251

This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins. Length = 251
>gnl|CDD|215646 pfam00001, 7tm_1, 7 transmembrane receptor (rhodopsin family) Back     alignment and domain information
>gnl|CDD|223017 PHA03235, PHA03235, DNA packaging protein UL33; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 317
KOG4219|consensus423 99.86
PHA03235409 DNA packaging protein UL33; Provisional 99.85
PHA03234338 DNA packaging protein UL33; Provisional 99.83
PHA02834323 chemokine receptor-like protein; Provisional 99.8
PHA02638417 CC chemokine receptor-like protein; Provisional 99.73
PHA03087335 G protein-coupled chemokine receptor-like protein; 99.68
KOG4220|consensus503 99.61
PF00001257 7tm_1: 7 transmembrane receptor (rhodopsin family) 99.49
KOG4219|consensus 423 99.22
KOG2087|consensus363 99.21
PF10324318 7TM_GPCR_Srw: Serpentine type 7TM GPCR chemorecept 99.07
KOG4220|consensus 503 98.89
PHA03234 338 DNA packaging protein UL33; Provisional 98.89
PHA02638 417 CC chemokine receptor-like protein; Provisional 98.8
PHA03087 335 G protein-coupled chemokine receptor-like protein; 98.79
PHA03235 409 DNA packaging protein UL33; Provisional 98.79
PHA02834 323 chemokine receptor-like protein; Provisional 98.75
PF00001257 7tm_1: 7 transmembrane receptor (rhodopsin family) 98.75
PF05296303 TAS2R: Mammalian taste receptor protein (TAS2R); I 98.52
PF10320257 7TM_GPCR_Srsx: Serpentine type 7TM GPCR chemorecep 98.25
PF10323283 7TM_GPCR_Srv: Serpentine type 7TM GPCR chemorecept 98.07
PF10321313 7TM_GPCR_Srt: Serpentine type 7TM GPCR chemorecept 97.86
PF05462303 Dicty_CAR: Slime mold cyclic AMP receptor 97.54
KOG2087|consensus 363 97.54
KOG4193|consensus610 97.02
PF10328 274 7TM_GPCR_Srx: Serpentine type 7TM GPCR chemorecept 96.81
PF10320257 7TM_GPCR_Srsx: Serpentine type 7TM GPCR chemorecep 96.8
PF10327303 7TM_GPCR_Sri: Serpentine type 7TM GPCR chemorecept 96.72
PF10328274 7TM_GPCR_Srx: Serpentine type 7TM GPCR chemorecept 96.67
PF10317292 7TM_GPCR_Srd: Serpentine type 7TM GPCR chemorecept 96.48
PF03402265 V1R: Vomeronasal organ pheromone receptor family, 96.42
PF1197076 Git3_C: G protein-coupled glucose receptor regulat 96.27
KOG4564|consensus473 96.08
PF10318302 7TM_GPCR_Srh: Serpentine type 7TM GPCR chemorecept 95.88
PF02101405 Ocular_alb: Ocular albinism type 1 protein; InterP 95.83
PF03383153 Serpentine_r_xa: Caenorhabditis serpentine recepto 95.51
PF10326307 7TM_GPCR_Str: Serpentine type 7TM GPCR chemorecept 93.03
PF10323 283 7TM_GPCR_Srv: Serpentine type 7TM GPCR chemorecept 92.51
PF03125365 Sre: C. elegans Sre G protein-coupled chemorecepto 91.36
PF10324 318 7TM_GPCR_Srw: Serpentine type 7TM GPCR chemorecept 90.89
PF02118275 Srg: Srg family chemoreceptor; InterPro: IPR000609 90.16
PF10319310 7TM_GPCR_Srj: Serpentine type 7TM GPCR chemorecept 88.35
PF04789305 DUF621: Protein of unknown function (DUF621); Inte 88.17
PF13853144 7tm_4: Olfactory receptor 87.91
PF10316273 7TM_GPCR_Srbc: Serpentine type 7TM GPCR chemorecep 82.72
>KOG4219|consensus Back     alignment and domain information 
Probab=99.86  E-value=2.2e-21  Score=168.87  Aligned_cols=131  Identities=19%  Similarity=0.416  Sum_probs=109.0

Q ss_pred             cceehhhHHHHHHHHHHHHHHHHHHHHHHHhhccccccCccccccccccchhhhhhhhHHHHHHHHHHHHHHhhHHHHHH
Q psy14313         32 VPMYELSFLFFFFIPMLVIMLMYTRIGLRIRSRSRHSLGKRVEGTVHGETKRSQSRKSIIRMLTAVVTTFFLCWAPFHAQ  111 (317)
Q Consensus        32 ~~~~~~~~~~~~~~P~~ii~~~Y~~I~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~k~~~~l~~vv~~f~icw~P~~i~  111 (317)
                      ..|...++++.+++|++++..+|..|.+++|..+..      .+.+.++.+..++++|+.||+++|++.|.+||+||++.
T Consensus       207 ~~y~~vl~~lqYflPliVl~~~Yt~iav~LW~~~~~------gd~~d~~~~~~kak~K~vkmliiVV~~FaicWlPyh~y  280 (423)
T KOG4219|consen  207 QGYNYVLLFLQYFLPLIVLGLAYTVIAVTLWGRRIP------GDQQDRKHEQLKAKKKVVKMLIIVVVIFAICWLPYHIY  280 (423)
T ss_pred             cceeeeehhHHHHHHHHHHHHHHHHHHHHHHhccCc------cchhchhhHHHHHHHHHHHHHHHHHHHHHHhccChhHH
Confidence            448889999999999999999999999999987742      11122445567788999999999999999999999999


Q ss_pred             HHHHHHhcCchhhhhHHHHHHHHHHHHHHhhhhhhHHHhhhcCHHHHHHHHHHhCCCC
Q psy14313        112 RLIYLYARDSQYFASLNEWLFMIAGGFYYVSSTVNPILYNVMSVKYRQAFKQTLCCRG  169 (317)
Q Consensus       112 ~l~~~~~~~~~~~~~~~~~~~~~~~~l~~~ns~~NP~IY~~~~~~fR~~~~~~l~~~~  169 (317)
                      .++....++-. .......++....||+++|+|+||+||+++|+.||.+|++.++|+.
T Consensus       281 ~il~~~~~~i~-~~k~i~~vyl~~~WLaMSst~yNPiIY~~lN~Rfr~gf~~~fr~cp  337 (423)
T KOG4219|consen  281 FILNATNPEIN-RKKFIQQVYLAIYWLAMSSTCYNPIIYCFLNKRFRGGFRRAFRWCP  337 (423)
T ss_pred             HHHHHhHHHHH-HHHHHHHHHHHHHHHHHHHhhhccHhhhhhHHHHHHHHhhhhheee
Confidence            98876554322 2344556888999999999999999999999999999999997763

>PHA03235 DNA packaging protein UL33; Provisional Back     alignment and domain information
>PHA03234 DNA packaging protein UL33; Provisional Back     alignment and domain information
>PHA02834 chemokine receptor-like protein; Provisional Back     alignment and domain information
>PHA02638 CC chemokine receptor-like protein; Provisional Back     alignment and domain information
>PHA03087 G protein-coupled chemokine receptor-like protein; Provisional Back     alignment and domain information
>KOG4220|consensus Back     alignment and domain information
>PF00001 7tm_1: 7 transmembrane receptor (rhodopsin family) Rhodopsin-like GPCR superfamily signature 5-hydroxytryptamine 7 receptor signature bradykinin receptor signature gastrin receptor signature melatonin receptor signature olfactory receptor signature; InterPro: IPR000276 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>KOG4219|consensus Back     alignment and domain information
>KOG2087|consensus Back     alignment and domain information
>PF10324 7TM_GPCR_Srw: Serpentine type 7TM GPCR chemoreceptor Srw; InterPro: IPR019427 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>KOG4220|consensus Back     alignment and domain information
>PHA03234 DNA packaging protein UL33; Provisional Back     alignment and domain information
>PHA02638 CC chemokine receptor-like protein; Provisional Back     alignment and domain information
>PHA03087 G protein-coupled chemokine receptor-like protein; Provisional Back     alignment and domain information
>PHA03235 DNA packaging protein UL33; Provisional Back     alignment and domain information
>PHA02834 chemokine receptor-like protein; Provisional Back     alignment and domain information
>PF00001 7tm_1: 7 transmembrane receptor (rhodopsin family) Rhodopsin-like GPCR superfamily signature 5-hydroxytryptamine 7 receptor signature bradykinin receptor signature gastrin receptor signature melatonin receptor signature olfactory receptor signature; InterPro: IPR000276 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF05296 TAS2R: Mammalian taste receptor protein (TAS2R); InterPro: IPR007960 This family consists of several forms of mammalian taste receptor proteins (TAS2Rs) Back     alignment and domain information
>PF10320 7TM_GPCR_Srsx: Serpentine type 7TM GPCR chemoreceptor Srsx; InterPro: IPR019424 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF10323 7TM_GPCR_Srv: Serpentine type 7TM GPCR chemoreceptor Srv; InterPro: IPR019426 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF10321 7TM_GPCR_Srt: Serpentine type 7TM GPCR chemoreceptor Srt; InterPro: IPR019425 Chemoreception is mediated in Caenorhabditis elegans by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs) of proteins which are of the serpentine type [] Back     alignment and domain information
>PF05462 Dicty_CAR: Slime mold cyclic AMP receptor Back     alignment and domain information
>KOG2087|consensus Back     alignment and domain information
>KOG4193|consensus Back     alignment and domain information
>PF10328 7TM_GPCR_Srx: Serpentine type 7TM GPCR chemoreceptor Srx; InterPro: IPR019430 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF10320 7TM_GPCR_Srsx: Serpentine type 7TM GPCR chemoreceptor Srsx; InterPro: IPR019424 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF10327 7TM_GPCR_Sri: Serpentine type 7TM GPCR chemoreceptor Sri; InterPro: IPR019429 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF10328 7TM_GPCR_Srx: Serpentine type 7TM GPCR chemoreceptor Srx; InterPro: IPR019430 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF10317 7TM_GPCR_Srd: Serpentine type 7TM GPCR chemoreceptor Srd; InterPro: IPR019421 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF03402 V1R: Vomeronasal organ pheromone receptor family, V1R; InterPro: IPR004072 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF11970 Git3_C: G protein-coupled glucose receptor regulating Gpa2 C-term; InterPro: IPR022596 This entry contains a functionally uncharacterised region belonging to the Git3 G-protein coupled receptor Back     alignment and domain information
>KOG4564|consensus Back     alignment and domain information
>PF10318 7TM_GPCR_Srh: Serpentine type 7TM GPCR chemoreceptor Srh; InterPro: IPR019422 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF02101 Ocular_alb: Ocular albinism type 1 protein; InterPro: IPR001414 Ocular albinism type 1 (OA1) is an X-linked disorder characterised by severe impairment of visual acuity, retinal hypopigmentation and the presence of macromelanosomes Back     alignment and domain information
>PF03383 Serpentine_r_xa: Caenorhabditis serpentine receptor-like protein, class xa; InterPro: IPR005047 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF10326 7TM_GPCR_Str: Serpentine type 7TM GPCR chemoreceptor Str; InterPro: IPR019428 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF10323 7TM_GPCR_Srv: Serpentine type 7TM GPCR chemoreceptor Srv; InterPro: IPR019426 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF03125 Sre: C Back     alignment and domain information
>PF10324 7TM_GPCR_Srw: Serpentine type 7TM GPCR chemoreceptor Srw; InterPro: IPR019427 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF02118 Srg: Srg family chemoreceptor; InterPro: IPR000609 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF10319 7TM_GPCR_Srj: Serpentine type 7TM GPCR chemoreceptor Srj; InterPro: IPR019423 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF04789 DUF621: Protein of unknown function (DUF621); InterPro: IPR006874 This is a conserved region found in uncharacterised proteins from Caenorhabditis elegans, and is noted to have possible G-protein-coupled receptor-like activity Back     alignment and domain information
>PF13853 7tm_4: Olfactory receptor Back     alignment and domain information
>PF10316 7TM_GPCR_Srbc: Serpentine type 7TM GPCR chemoreceptor Srbc ; InterPro: IPR019420 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query317
4grv_A510 The Crystal Structure Of The Neurotensin Receptor N 1e-12
4grv_A 510 The Crystal Structure Of The Neurotensin Receptor N 4e-04
2j4y_A349 Crystal Structure Of A Rhodopsin Stabilizing Mutant 2e-08
3c9m_A348 Structure Of A Mutant Bovine Rhodopsin In Hexagonal 2e-08
2x72_A349 Crystal Structure Of The Constitutively Active E113 2e-08
3oax_A349 Crystal Structure Of Bovine Rhodopsin With Beta-Ion 3e-08
1jfp_A348 Structure Of Bovine Rhodopsin (Dark Adapted) Length 3e-08
4a4m_A349 Crystal Structure Of The Light-Activated Constituti 4e-08
2ydo_A325 Thermostabilised Human A2a Receptor With Adenosine 5e-08
3vg9_A326 Crystal Structure Of Human Adenosine A2a Receptor W 5e-08
3pwh_A329 Thermostabilised Adenosine A2a Receptor Length = 32 1e-07
2y00_B315 Turkey Beta1 Adrenergic Receptor With Stabilising M 2e-07
2vt4_A313 Turkey Beta1 Adrenergic Receptor With Stabilising M 7e-07
4ea3_B434 Structure Of The NOFQ OPIOID RECEPTOR IN COMPLEX WI 2e-05
2r4r_A365 Crystal Structure Of The Human Beta2 Adrenoceptor L 2e-05
3sn6_R514 Crystal Structure Of The Beta2 Adrenergic Receptor- 2e-05
3kj6_A366 Crystal Structure Of A Methylated Beta2 Adrenergic 2e-05
2r4s_A342 Crystal Structure Of The Human Beta2 Adrenoceptor L 3e-05
3rze_A452 Structure Of The Human Histamine H1 Receptor In Com 4e-05
4gbr_A309 N-terminal T4 Lysozyme Fusion Facilitates Crystalli 8e-05
4djh_A480 Structure Of The Human Kappa Opioid Receptor In Com 9e-05
3pbl_A481 Structure Of The Human Dopamine D3 Receptor In Comp 1e-04
2z73_A448 Crystal Structure Of Squid Rhodopsin Length = 448 2e-04
2ks9_A364 Solution Conformation Of Substance P In Water Compl 2e-04
2ziy_A372 Crystal Structure Of Squid Rhodopsin Length = 372 2e-04
4ej4_A461 Structure Of The Delta Opioid Receptor Bound To Nal 4e-04
3uon_A467 Structure Of The Human M2 Muscarinic Acetylcholine 6e-04
>pdb|4GRV|A Chain A, The Crystal Structure Of The Neurotensin Receptor Nts1 In Complex With Neurotensin (8-13) Length = 510 Back     alignment and structure 
Iteration: 1

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 50/86 (58%), Gaps = 3/86 (3%)
Query: 85  QSRKSIIRMLTAVVTTFFLCWAPFHAQRLIYLYARDSQYFASLNE---WLFMIAGGFYYV 141
           Q+ +  + +  AVV  F +CW P+H +RL++ Y  D Q+   L +   + +M+     Y 
Sbjct: 402 QALRHGVLVARAVVIAFVVCWLPYHVRRLMFCYISDEQWTTFLFDFYHYFYMLTNALAYA 461
Query: 142 SSTVNPILYNVMSVKYRQAFKQTLCC 167
           SS +NPILYN++S  +RQ F  TL C
Sbjct: 462 SSAINPILYNLVSANFRQVFLSTLAC 487
>pdb|4GRV|A Chain A, The Crystal Structure Of The Neurotensin Receptor Nts1 In Complex With Neurotensin (8-13) Length = 510 Back     alignment and structure
>pdb|2J4Y|A Chain A, Crystal Structure Of A Rhodopsin Stabilizing Mutant Expressed In Mammalian Cells Length = 349 Back     alignment and structure
>pdb|3C9M|A Chain A, Structure Of A Mutant Bovine Rhodopsin In Hexagonal Crystal Form Length = 348 Back     alignment and structure
>pdb|2X72|A Chain A, Crystal Structure Of The Constitutively Active E113q,N2c, D282c Rhodopsin Mutant With Bound Galphact Peptide Length = 349 Back     alignment and structure
>pdb|3OAX|A Chain A, Crystal Structure Of Bovine Rhodopsin With Beta-Ionone Length = 349 Back     alignment and structure
>pdb|1JFP|A Chain A, Structure Of Bovine Rhodopsin (Dark Adapted) Length = 348 Back     alignment and structure
>pdb|4A4M|A Chain A, Crystal Structure Of The Light-Activated Constitutively Active N2c,M257y,D282c Rhodopsin Mutant In Complex With A Peptide Resembling The C-Terminus Of The Galpha-Protein Subunit (Gact) Length = 349 Back     alignment and structure
>pdb|2YDO|A Chain A, Thermostabilised Human A2a Receptor With Adenosine Bound Length = 325 Back     alignment and structure
>pdb|3VG9|A Chain A, Crystal Structure Of Human Adenosine A2a Receptor With An Allosteric Inverse-Agonist Antibody At 2.7 A Resolution Length = 326 Back     alignment and structure
>pdb|3PWH|A Chain A, Thermostabilised Adenosine A2a Receptor Length = 329 Back     alignment and structure
>pdb|2Y00|B Chain B, Turkey Beta1 Adrenergic Receptor With Stabilising Mutations And Bound Partial Agonist Dobutamine (Crystal Dob92) Length = 315 Back     alignment and structure
>pdb|2VT4|A Chain A, Turkey Beta1 Adrenergic Receptor With Stabilising Mutations And Bound Cyanopindolol Length = 313 Back     alignment and structure
>pdb|4EA3|B Chain B, Structure Of The NOFQ OPIOID RECEPTOR IN COMPLEX WITH A PEPTIDE Mimetic Length = 434 Back     alignment and structure
>pdb|2R4R|A Chain A, Crystal Structure Of The Human Beta2 Adrenoceptor Length = 365 Back     alignment and structure
>pdb|3SN6|R Chain R, Crystal Structure Of The Beta2 Adrenergic Receptor-Gs Protein Complex Length = 514 Back     alignment and structure
>pdb|3KJ6|A Chain A, Crystal Structure Of A Methylated Beta2 Adrenergic Receptor- Fab Complex Length = 366 Back     alignment and structure
>pdb|2R4S|A Chain A, Crystal Structure Of The Human Beta2 Adrenoceptor Length = 342 Back     alignment and structure
>pdb|3RZE|A Chain A, Structure Of The Human Histamine H1 Receptor In Complex With Doxepin Length = 452 Back     alignment and structure
>pdb|4GBR|A Chain A, N-terminal T4 Lysozyme Fusion Facilitates Crystallization Of A G Protein Coupled Receptor Length = 309 Back     alignment and structure
>pdb|4DJH|A Chain A, Structure Of The Human Kappa Opioid Receptor In Complex With Jdtic Length = 480 Back     alignment and structure
>pdb|3PBL|A Chain A, Structure Of The Human Dopamine D3 Receptor In Complex With Eticlopride Length = 481 Back     alignment and structure
>pdb|2Z73|A Chain A, Crystal Structure Of Squid Rhodopsin Length = 448 Back     alignment and structure
>pdb|2KS9|A Chain A, Solution Conformation Of Substance P In Water Complexed With Nk1r Length = 364 Back     alignment and structure
>pdb|2ZIY|A Chain A, Crystal Structure Of Squid Rhodopsin Length = 372 Back     alignment and structure
>pdb|4EJ4|A Chain A, Structure Of The Delta Opioid Receptor Bound To Naltrindole Length = 461 Back     alignment and structure
>pdb|3UON|A Chain A, Structure Of The Human M2 Muscarinic Acetylcholine Receptor Bound To An Antagonist Length = 467 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query317
2ks9_A364 Substance-P receptor; water, autodock, NK1, neurop 5e-28
2ks9_A 364 Substance-P receptor; water, autodock, NK1, neurop 5e-11
4ea3_A434 Fusion protein of nociceptin receptor and cytochr; 6e-24
4ea3_A 434 Fusion protein of nociceptin receptor and cytochr; 1e-11
2z73_A448 Rhodopsin; visual pigment, GQ-type, G-protein coup 9e-19
2z73_A 448 Rhodopsin; visual pigment, GQ-type, G-protein coup 4e-06
4amj_A315 Beta-1 adrenergic receptor; membrane protein, 7TMR 3e-18
4amj_A 315 Beta-1 adrenergic receptor; membrane protein, 7TMR 2e-05
1u19_A349 Rhodopsin; G protein-coupled receptor, membrane pr 7e-18
1u19_A 349 Rhodopsin; G protein-coupled receptor, membrane pr 4e-09
3sn6_R514 Lysozyme, beta-2 adrenergic receptor; seven transm 2e-16
3sn6_R 514 Lysozyme, beta-2 adrenergic receptor; seven transm 5e-06
3eml_A488 Human adenosine A2A receptor/T4 lysozyme chimera; 9e-15
3eml_A 488 Human adenosine A2A receptor/T4 lysozyme chimera; 4e-05
3eml_A488 Human adenosine A2A receptor/T4 lysozyme chimera; 3e-04
4dkl_A464 MU-type opioid receptor, lysozyme chimera; G-prote 4e-14
4dkl_A 464 MU-type opioid receptor, lysozyme chimera; G-prote 4e-10
4dkl_A464 MU-type opioid receptor, lysozyme chimera; G-prote 1e-09
4eiy_A447 Adenosine receptor A2A/soluble cytochrome B562 CH; 1e-12
4eiy_A 447 Adenosine receptor A2A/soluble cytochrome B562 CH; 5e-07
3pbl_A481 D(3) dopamine receptor, lysozyme chimera; structur 3e-12
3pbl_A481 D(3) dopamine receptor, lysozyme chimera; structur 2e-04
3pbl_A 481 D(3) dopamine receptor, lysozyme chimera; structur 3e-04
3v2y_A520 Sphingosine 1-phosphate receptor 1, lysozyme CHIM; 5e-12
3v2y_A 520 Sphingosine 1-phosphate receptor 1, lysozyme CHIM; 1e-04
3uon_A467 Human M2 muscarinic acetylcholine, receptor T4 LY 5e-12
3uon_A 467 Human M2 muscarinic acetylcholine, receptor T4 LY 2e-05
3rze_A452 Histamine H1 receptor, lysozyme chimera; structura 2e-11
3rze_A 452 Histamine H1 receptor, lysozyme chimera; structura 3e-05
2rh1_A500 Beta-2-adrenergic receptor/T4-lysozyme chimera; GP 1e-10
2rh1_A 500 Beta-2-adrenergic receptor/T4-lysozyme chimera; GP 2e-04
3odu_A502 C-X-C chemokine receptor type 4, lysozyme chimera; 1e-09
3odu_A 502 C-X-C chemokine receptor type 4, lysozyme chimera; 2e-09
3odu_A502 C-X-C chemokine receptor type 4, lysozyme chimera; 6e-05
>2ks9_A Substance-P receptor; water, autodock, NK1, neuropeptide receptor-NEU complex; NMR {Homo sapiens} PDB: 2ksa_A 2ksb_A Length = 364 Back     alignment and structure
 Score =  110 bits (277), Expect = 5e-28
 Identities = 30/155 (19%), Positives = 62/155 (40%), Gaps = 8/155 (5%)

Query: 37  LSFLFFFFIPMLVIMLMYTRIGLRIRSRSRHSLGKRVEGTVHGETKRSQSRKSIIRMLTA 96
              +  +F+P+LVI   YT +G+ + +            +     ++  +++ +++M+  
Sbjct: 199 CVTVLIYFLPLLVIGYAYTVVGITLWASEIPG------DSSDRYHEQVSAKRKVVKMMIV 252

Query: 97  VVTTFFLCWAPFHAQRLIYLYARDSQYFASLNEWLFMIAGGFYYVSSTVNPILYNVMSVK 156
           VV TF +CW PFH   L+     D        + +++        S+  NPI+Y  ++ +
Sbjct: 253 VVCTFAICWLPFHIFFLLPYINPDLYL-KKFIQQVYLAIMWLAMSSTMYNPIIYCCLNDR 311

Query: 157 YRQAFKQTLCCRGGSHGSFARDQSSFRETMVDVAS 191
           +R  FK    C          +    + T      
Sbjct: 312 FRLGFKHAFRCCPFISAG-DYEGLEMKSTRYLQTQ 345
>2ks9_A Substance-P receptor; water, autodock, NK1, neuropeptide receptor-NEU complex; NMR {Homo sapiens} PDB: 2ksa_A 2ksb_A Length = 364 Back     alignment and structure
>2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Length = 448 Back     alignment and structure
>2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Length = 448 Back     alignment and structure
>4amj_A Beta-1 adrenergic receptor; membrane protein, 7TMR BETA1-adrenoceptor, stabilising mutat biased agonist; HET: CVD 2CV; 2.30A {Meleagris gallopavo} PDB: 2y01_A* 2y02_A* 2y03_A* 2y04_A* 4ami_A* 2y00_A* 2vt4_A* 2ycw_A* 2ycx_A* 2ycy_A* 2ycz_A* Length = 315 Back     alignment and structure
>4amj_A Beta-1 adrenergic receptor; membrane protein, 7TMR BETA1-adrenoceptor, stabilising mutat biased agonist; HET: CVD 2CV; 2.30A {Meleagris gallopavo} PDB: 2y01_A* 2y02_A* 2y03_A* 2y04_A* 4ami_A* 2y00_A* 2vt4_A* 2ycw_A* 2ycx_A* 2ycy_A* 2ycz_A* Length = 315 Back     alignment and structure
>1u19_A Rhodopsin; G protein-coupled receptor, membrane protein, retinal protei photoreceptor, signaling protein; HET: MAN NAG BMA RET PLM HTO HTG; 2.20A {Bos taurus} SCOP: f.13.1.2 PDB: 1hzx_A* 1gzm_A* 1l9h_A* 2g87_A* 2hpy_A* 2i35_A* 2i36_A* 2i37_A* 2ped_A* 3oax_A* 3c9l_A* 1jfp_A* 1ln6_A* 1f88_A* 3cap_A* 3dqb_A* 3pqr_A* 3pxo_A* 3c9m_A* 2x72_A* ... Length = 349 Back     alignment and structure
>1u19_A Rhodopsin; G protein-coupled receptor, membrane protein, retinal protei photoreceptor, signaling protein; HET: MAN NAG BMA RET PLM HTO HTG; 2.20A {Bos taurus} SCOP: f.13.1.2 PDB: 1hzx_A* 1gzm_A* 1l9h_A* 2g87_A* 2hpy_A* 2i35_A* 2i36_A* 2i37_A* 2ped_A* 3oax_A* 3c9l_A* 1jfp_A* 1ln6_A* 1f88_A* 3cap_A* 3dqb_A* 3pqr_A* 3pxo_A* 3c9m_A* 2x72_A* ... Length = 349 Back     alignment and structure
>3sn6_R Lysozyme, beta-2 adrenergic receptor; seven transmembrane receptor, nanobody, G protein-coupled RE GPCR, signal transduction, G protein signaling; HET: P0G; 3.20A {Enterobacteria phage T4} PDB: 3kj6_A 2r4s_A 2r4r_A Length = 514 Back     alignment and structure
>3sn6_R Lysozyme, beta-2 adrenergic receptor; seven transmembrane receptor, nanobody, G protein-coupled RE GPCR, signal transduction, G protein signaling; HET: P0G; 3.20A {Enterobacteria phage T4} PDB: 3kj6_A 2r4s_A 2r4r_A Length = 514 Back     alignment and structure
>3eml_A Human adenosine A2A receptor/T4 lysozyme chimera; caffeine, GPCR, membrane protein, LCP, mesophase, structural genomics, PSI-2; HET: ZMA STE; 2.60A {Homo sapiens} PDB: 3qak_A* Length = 488 Back     alignment and structure
>3eml_A Human adenosine A2A receptor/T4 lysozyme chimera; caffeine, GPCR, membrane protein, LCP, mesophase, structural genomics, PSI-2; HET: ZMA STE; 2.60A {Homo sapiens} PDB: 3qak_A* Length = 488 Back     alignment and structure
>3eml_A Human adenosine A2A receptor/T4 lysozyme chimera; caffeine, GPCR, membrane protein, LCP, mesophase, structural genomics, PSI-2; HET: ZMA STE; 2.60A {Homo sapiens} PDB: 3qak_A* Length = 488 Back     alignment and structure
>4dkl_A MU-type opioid receptor, lysozyme chimera; G-protein coupled receptor, 7 transmembrane receptor, signal protein-antagonist complex; HET: BF0 CLR MPG 1PE; 2.80A {Mus musculus} PDB: 4ej4_A* 4djh_A* Length = 464 Back     alignment and structure
>4dkl_A MU-type opioid receptor, lysozyme chimera; G-protein coupled receptor, 7 transmembrane receptor, signal protein-antagonist complex; HET: BF0 CLR MPG 1PE; 2.80A {Mus musculus} PDB: 4ej4_A* 4djh_A* Length = 464 Back     alignment and structure
>4dkl_A MU-type opioid receptor, lysozyme chimera; G-protein coupled receptor, 7 transmembrane receptor, signal protein-antagonist complex; HET: BF0 CLR MPG 1PE; 2.80A {Mus musculus} PDB: 4ej4_A* 4djh_A* Length = 464 Back     alignment and structure
>4eiy_A Adenosine receptor A2A/soluble cytochrome B562 CH; novel protein engineering, GPCR network, PSI-biology, struct genomics, membrane protein, GPCR; HET: ZMA CLR OLA OLC OLB; 1.80A {Homo sapiens} PDB: 3vg9_A* 3vga_A* 2ydv_A* 2ydo_A* 3uza_A* 3rey_A* 3rfm_A* 3pwh_A* 3uzc_A* 4er9_A Length = 447 Back     alignment and structure
>4eiy_A Adenosine receptor A2A/soluble cytochrome B562 CH; novel protein engineering, GPCR network, PSI-biology, struct genomics, membrane protein, GPCR; HET: ZMA CLR OLA OLC OLB; 1.80A {Homo sapiens} PDB: 3vg9_A* 3vga_A* 2ydv_A* 2ydo_A* 3uza_A* 3rey_A* 3rfm_A* 3pwh_A* 3uzc_A* 4er9_A Length = 447 Back     alignment and structure
>3pbl_A D(3) dopamine receptor, lysozyme chimera; structural genomics, PSI-2, protein structure initiative, AC technologies center for gene to 3D structure; HET: ETQ MAL; 2.89A {Homo sapiens} Length = 481 Back     alignment and structure
>3pbl_A D(3) dopamine receptor, lysozyme chimera; structural genomics, PSI-2, protein structure initiative, AC technologies center for gene to 3D structure; HET: ETQ MAL; 2.89A {Homo sapiens} Length = 481 Back     alignment and structure
>3pbl_A D(3) dopamine receptor, lysozyme chimera; structural genomics, PSI-2, protein structure initiative, AC technologies center for gene to 3D structure; HET: ETQ MAL; 2.89A {Homo sapiens} Length = 481 Back     alignment and structure
>3v2y_A Sphingosine 1-phosphate receptor 1, lysozyme CHIM; EDG receptor, lipid receptor, multiple sclerosi autoimmunity, structural genomics, PSI-biology; HET: ML5 NAG; 2.80A {Homo sapiens} PDB: 3v2w_A* Length = 520 Back     alignment and structure
>3v2y_A Sphingosine 1-phosphate receptor 1, lysozyme CHIM; EDG receptor, lipid receptor, multiple sclerosi autoimmunity, structural genomics, PSI-biology; HET: ML5 NAG; 2.80A {Homo sapiens} PDB: 3v2w_A* Length = 520 Back     alignment and structure
>3uon_A Human M2 muscarinic acetylcholine, receptor T4 LY fusion protein; G protein-coupled receptor, GPCR, SI protein-antagonist complex; HET: QNB BGC; 3.00A {Homo sapiens} PDB: 4daj_A* Length = 467 Back     alignment and structure
>3uon_A Human M2 muscarinic acetylcholine, receptor T4 LY fusion protein; G protein-coupled receptor, GPCR, SI protein-antagonist complex; HET: QNB BGC; 3.00A {Homo sapiens} PDB: 4daj_A* Length = 467 Back     alignment and structure
>3rze_A Histamine H1 receptor, lysozyme chimera; structural genomics, PSI-biology, membrane protein, GPCR NET GPCR, hydrolase; HET: 5EH D7V OLC; 3.10A {Homo sapiens} Length = 452 Back     alignment and structure
>3rze_A Histamine H1 receptor, lysozyme chimera; structural genomics, PSI-biology, membrane protein, GPCR NET GPCR, hydrolase; HET: 5EH D7V OLC; 3.10A {Homo sapiens} Length = 452 Back     alignment and structure
>2rh1_A Beta-2-adrenergic receptor/T4-lysozyme chimera; GPCR, 7TM, fusion, lipidic cubic phase, lipidic, mesophase, cholesterol, membrane protein; HET: MAL CAU CLR PLM 12P; 2.40A {Homo sapiens} PDB: 3p0g_A* 3d4s_A* 3ny8_A* 3ny9_A* 3nya_A* 3pds_A* Length = 500 Back     alignment and structure
>2rh1_A Beta-2-adrenergic receptor/T4-lysozyme chimera; GPCR, 7TM, fusion, lipidic cubic phase, lipidic, mesophase, cholesterol, membrane protein; HET: MAL CAU CLR PLM 12P; 2.40A {Homo sapiens} PDB: 3p0g_A* 3d4s_A* 3ny8_A* 3ny9_A* 3nya_A* 3pds_A* Length = 500 Back     alignment and structure
>3odu_A C-X-C chemokine receptor type 4, lysozyme chimera; structural genomics, PSI-2, protein structure initiative; HET: ITD OLC OLA; 2.50A {Homo sapiens} PDB: 3oe8_A* 3oe6_A* 3oe0_A* 3oe9_A* 2k03_B* 2k04_B 2k05_B* Length = 502 Back     alignment and structure
>3odu_A C-X-C chemokine receptor type 4, lysozyme chimera; structural genomics, PSI-2, protein structure initiative; HET: ITD OLC OLA; 2.50A {Homo sapiens} PDB: 3oe8_A* 3oe6_A* 3oe0_A* 3oe9_A* 2k03_B* 2k04_B 2k05_B* Length = 502 Back     alignment and structure
>3odu_A C-X-C chemokine receptor type 4, lysozyme chimera; structural genomics, PSI-2, protein structure initiative; HET: ITD OLC OLA; 2.50A {Homo sapiens} PDB: 3oe8_A* 3oe6_A* 3oe0_A* 3oe9_A* 2k03_B* 2k04_B 2k05_B* Length = 502 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query317
4grv_A510 Neurotensin receptor type 1, lysozyme chimera; G-p 99.9
2rh1_A500 Beta-2-adrenergic receptor/T4-lysozyme chimera; GP 99.86
3vw7_A484 Proteinase-activated receptor 1, lysozyme; high re 99.86
3v2y_A520 Sphingosine 1-phosphate receptor 1, lysozyme CHIM; 99.85
2ks9_A364 Substance-P receptor; water, autodock, NK1, neurop 99.85
1u19_A349 Rhodopsin; G protein-coupled receptor, membrane pr 99.84
3uon_A467 Human M2 muscarinic acetylcholine, receptor T4 LY 99.83
3rze_A452 Histamine H1 receptor, lysozyme chimera; structura 99.83
3eml_A488 Human adenosine A2A receptor/T4 lysozyme chimera; 99.83
4amj_A315 Beta-1 adrenergic receptor; membrane protein, 7TMR 99.83
4eiy_A447 Adenosine receptor A2A/soluble cytochrome B562 CH; 99.82
4dkl_A464 MU-type opioid receptor, lysozyme chimera; G-prote 99.82
3odu_A502 C-X-C chemokine receptor type 4, lysozyme chimera; 99.81
3pbl_A481 D(3) dopamine receptor, lysozyme chimera; structur 99.81
2lnl_A296 C-X-C chemokine receptor type 1; G protein coupled 99.8
3sn6_R514 Lysozyme, beta-2 adrenergic receptor; seven transm 99.8
4ea3_A434 Fusion protein of nociceptin receptor and cytochr; 99.79
2z73_A448 Rhodopsin; visual pigment, GQ-type, G-protein coup 99.78
3vw7_A 484 Proteinase-activated receptor 1, lysozyme; high re 99.03
4grv_A 510 Neurotensin receptor type 1, lysozyme chimera; G-p 99.02
3odu_A 502 C-X-C chemokine receptor type 4, lysozyme chimera; 98.97
3uon_A 467 Human M2 muscarinic acetylcholine, receptor T4 LY 98.97
2koe_A40 Human cannabinoid receptor 1 - helix 7/8 peptide; 98.97
1u19_A 349 Rhodopsin; G protein-coupled receptor, membrane pr 98.89
2lnl_A 296 C-X-C chemokine receptor type 1; G protein coupled 98.87
4dkl_A 464 MU-type opioid receptor, lysozyme chimera; G-prote 98.86
3v2y_A 520 Sphingosine 1-phosphate receptor 1, lysozyme CHIM; 98.85
3eml_A 488 Human adenosine A2A receptor/T4 lysozyme chimera; 98.84
4amj_A 315 Beta-1 adrenergic receptor; membrane protein, 7TMR 98.83
3rze_A 452 Histamine H1 receptor, lysozyme chimera; structura 98.83
2ks9_A 364 Substance-P receptor; water, autodock, NK1, neurop 98.8
4ea3_A 434 Fusion protein of nociceptin receptor and cytochr; 98.8
2z73_A 448 Rhodopsin; visual pigment, GQ-type, G-protein coup 98.78
1hll_A32 Alpha-2A adrenergic receptor; helix-linker-helix, 98.77
4eiy_A 447 Adenosine receptor A2A/soluble cytochrome B562 CH; 98.69
3pbl_A 481 D(3) dopamine receptor, lysozyme chimera; structur 98.67
2rh1_A 500 Beta-2-adrenergic receptor/T4-lysozyme chimera; GP 98.65
3sn6_R 514 Lysozyme, beta-2 adrenergic receptor; seven transm 98.47
2ki9_A33 Cannabinoid receptor 2; GPCR, G-protein coupled re 98.2
>4grv_A Neurotensin receptor type 1, lysozyme chimera; G-protein coupled receptor, G-protein, signaling protein-agonist complex; HET: EPE; 2.80A {Rattus norvegicus} Back     alignment and structure
Probab=99.90  E-value=1.7e-24  Score=204.00  Aligned_cols=88  Identities=35%  Similarity=0.765  Sum_probs=64.9

Q ss_pred             hhhhhhHHHHHHHHHHHHHHhhHHHHHHHHHHHHhcCch---hhhhHHHHHHHHHHHHHHhhhhhhHHHhhhcCHHHHHH
Q psy14313         84 SQSRKSIIRMLTAVVTTFFLCWAPFHAQRLIYLYARDSQ---YFASLNEWLFMIAGGFYYVSSTVNPILYNVMSVKYRQA  160 (317)
Q Consensus        84 ~~~~~k~~~~l~~vv~~f~icw~P~~i~~l~~~~~~~~~---~~~~~~~~~~~~~~~l~~~ns~~NP~IY~~~~~~fR~~  160 (317)
                      .++++|++||+++|+++|++||+||+++.++..+.+...   ........+..++.||+|+||++||+||+++|++||++
T Consensus       401 ~~~erk~~k~L~iVv~~F~iCWlPf~i~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~L~Y~NS~iNPiIY~~~n~~FR~a  480 (510)
T 4grv_A          401 VQALRHGVLVARAVVIAFVVCWLPYHVRRLMFCYISDEQWTTFLFDFYHYFYMLTNALAYASSAINPILYNLVSANFRQV  480 (510)
T ss_dssp             TTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTTTCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSCCCCC
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCcccCChhHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCHHHHHH
Confidence            345779999999999999999999999999887765432   12234456778899999999999999999999999999


Q ss_pred             HHHHhCCCCCC
Q psy14313        161 FKQTLCCRGGS  171 (317)
Q Consensus       161 ~~~~l~~~~~~  171 (317)
                      |+++++|++++
T Consensus       481 Fk~iL~C~C~~  491 (510)
T 4grv_A          481 FLSTLACLCPG  491 (510)
T ss_dssp             -----------
T ss_pred             HHHHHhhcCCC
Confidence            99999876543
>2rh1_A Beta-2-adrenergic receptor/T4-lysozyme chimera; GPCR, 7TM, fusion, lipidic cubic phase, lipidic, mesophase, cholesterol, membrane protein; HET: MAL CAU CLR PLM 12P; 2.40A {Homo sapiens} PDB: 3p0g_A* 3d4s_A* 3ny8_A* 3ny9_A* 3nya_A* 3pds_A* Back     alignment and structure
>3vw7_A Proteinase-activated receptor 1, lysozyme; high resolution structure, protease-activated receptor 1, in conformation, antagonist vorapaxar; HET: VPX OLC; 2.20A {Homo sapiens} Back     alignment and structure
>3v2y_A Sphingosine 1-phosphate receptor 1, lysozyme CHIM; EDG receptor, lipid receptor, multiple sclerosi autoimmunity, structural genomics, PSI-biology; HET: ML5 NAG; 2.80A {Homo sapiens} PDB: 3v2w_A* Back     alignment and structure
>2ks9_A Substance-P receptor; water, autodock, NK1, neuropeptide receptor-NEU complex; NMR {Homo sapiens} PDB: 2ksa_A 2ksb_A Back     alignment and structure
>1u19_A Rhodopsin; G protein-coupled receptor, membrane protein, retinal protei photoreceptor, signaling protein; HET: MAN NAG BMA RET PLM HTO HTG; 2.20A {Bos taurus} SCOP: f.13.1.2 PDB: 1hzx_A* 1gzm_A* 1l9h_A* 2g87_A* 2hpy_A* 2i35_A* 2i36_A* 2i37_A* 2ped_A* 3oax_A* 3c9l_A* 1jfp_A* 1ln6_A* 1f88_A* 3cap_A* 3dqb_A* 3pqr_A* 3pxo_A* 3c9m_A* 2x72_A* ... Back     alignment and structure
>3uon_A Human M2 muscarinic acetylcholine, receptor T4 LY fusion protein; G protein-coupled receptor, GPCR, SI protein-antagonist complex; HET: QNB BGC; 3.00A {Homo sapiens} PDB: 4daj_A* Back     alignment and structure
>3rze_A Histamine H1 receptor, lysozyme chimera; structural genomics, PSI-biology, membrane protein, GPCR NET GPCR, hydrolase; HET: 5EH D7V OLC; 3.10A {Homo sapiens} Back     alignment and structure
>3eml_A Human adenosine A2A receptor/T4 lysozyme chimera; caffeine, GPCR, membrane protein, LCP, mesophase, structural genomics, PSI-2; HET: ZMA STE; 2.60A {Homo sapiens} PDB: 3qak_A* Back     alignment and structure
>4amj_A Beta-1 adrenergic receptor; membrane protein, 7TMR BETA1-adrenoceptor, stabilising mutat biased agonist; HET: CVD 2CV; 2.30A {Meleagris gallopavo} PDB: 2y01_A* 2y02_A* 2y03_A* 2y04_A* 4ami_A* 2y00_A* 2vt4_A* 2ycw_A* 2ycx_A* 2ycy_A* 2ycz_A* Back     alignment and structure
>4eiy_A Adenosine receptor A2A/soluble cytochrome B562 CH; novel protein engineering, GPCR network, PSI-biology, struct genomics, membrane protein, GPCR; HET: ZMA CLR OLA OLC OLB; 1.80A {Homo sapiens} PDB: 3vg9_A* 3vga_A* 2ydv_A* 2ydo_A* 3uza_A* 3rey_A* 3rfm_A* 3pwh_A* 3uzc_A* 4er9_A Back     alignment and structure
>4dkl_A MU-type opioid receptor, lysozyme chimera; G-protein coupled receptor, 7 transmembrane receptor, signal protein-antagonist complex; HET: BF0 CLR MPG 1PE; 2.80A {Mus musculus} PDB: 4ej4_A* 4djh_A* Back     alignment and structure
>3odu_A C-X-C chemokine receptor type 4, lysozyme chimera; structural genomics, PSI-2, protein structure initiative; HET: ITD OLC OLA; 2.50A {Homo sapiens} PDB: 3oe8_A* 3oe6_A* 3oe0_A* 3oe9_A* 2k03_B* 2k04_B 2k05_B* Back     alignment and structure
>3pbl_A D(3) dopamine receptor, lysozyme chimera; structural genomics, PSI-2, PSI-biology, protein structure initiative; HET: ETQ MAL; 2.89A {Homo sapiens} Back     alignment and structure
>2lnl_A C-X-C chemokine receptor type 1; G protein coupled receptor, GPCR, membrane protei transmembrane, 7TM, phospholipid, signaling, signaling PROT; NMR {Homo sapiens} Back     alignment and structure
>3sn6_R Lysozyme, beta-2 adrenergic receptor; seven transmembrane receptor, nanobody, G protein-coupled RE GPCR, signal transduction, G protein signaling; HET: P0G; 3.20A {Enterobacteria phage T4} PDB: 3kj6_A 2r4s_A 2r4r_A 4gbr_A* Back     alignment and structure
>2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Back     alignment and structure
>3vw7_A Proteinase-activated receptor 1, lysozyme; high resolution structure, protease-activated receptor 1, in conformation, antagonist vorapaxar; HET: VPX OLC; 2.20A {Homo sapiens} Back     alignment and structure
>4grv_A Neurotensin receptor type 1, lysozyme chimera; G-protein coupled receptor, G-protein, signaling protein-agonist complex; HET: EPE; 2.80A {Rattus norvegicus} Back     alignment and structure
>3odu_A C-X-C chemokine receptor type 4, lysozyme chimera; structural genomics, PSI-2, protein structure initiative; HET: ITD OLC OLA; 2.50A {Homo sapiens} PDB: 3oe8_A* 3oe6_A* 3oe0_A* 3oe9_A* 2k03_B* 2k04_B 2k05_B* Back     alignment and structure
>3uon_A Human M2 muscarinic acetylcholine, receptor T4 LY fusion protein; G protein-coupled receptor, GPCR, SI protein-antagonist complex; HET: QNB BGC; 3.00A {Homo sapiens} PDB: 4daj_A* Back     alignment and structure
>2koe_A Human cannabinoid receptor 1 - helix 7/8 peptide; GPCR, HCB1, membrane protein, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>1u19_A Rhodopsin; G protein-coupled receptor, membrane protein, retinal protei photoreceptor, signaling protein; HET: MAN NAG BMA RET PLM HTO HTG; 2.20A {Bos taurus} SCOP: f.13.1.2 PDB: 1hzx_A* 1gzm_A* 1l9h_A* 2g87_A* 2hpy_A* 2i35_A* 2i36_A* 2i37_A* 2ped_A* 3oax_A* 3c9l_A* 1jfp_A* 1ln6_A* 1f88_A* 3cap_A* 3dqb_A* 3pqr_A* 3pxo_A* 3c9m_A* 2x72_A* ... Back     alignment and structure
>2lnl_A C-X-C chemokine receptor type 1; G protein coupled receptor, GPCR, membrane protei transmembrane, 7TM, phospholipid, signaling, signaling PROT; NMR {Homo sapiens} Back     alignment and structure
>4dkl_A MU-type opioid receptor, lysozyme chimera; G-protein coupled receptor, 7 transmembrane receptor, signal protein-antagonist complex; HET: BF0 CLR MPG 1PE; 2.80A {Mus musculus} PDB: 4ej4_A* 4djh_A* Back     alignment and structure
>3v2y_A Sphingosine 1-phosphate receptor 1, lysozyme CHIM; EDG receptor, lipid receptor, multiple sclerosi autoimmunity, structural genomics, PSI-biology; HET: ML5 NAG; 2.80A {Homo sapiens} PDB: 3v2w_A* Back     alignment and structure
>3eml_A Human adenosine A2A receptor/T4 lysozyme chimera; caffeine, GPCR, membrane protein, LCP, mesophase, structural genomics, PSI-2; HET: ZMA STE; 2.60A {Homo sapiens} PDB: 3qak_A* Back     alignment and structure
>4amj_A Beta-1 adrenergic receptor; membrane protein, 7TMR BETA1-adrenoceptor, stabilising mutat biased agonist; HET: CVD 2CV; 2.30A {Meleagris gallopavo} PDB: 2y01_A* 2y02_A* 2y03_A* 2y04_A* 4ami_A* 2y00_A* 2vt4_A* 2ycw_A* 2ycx_A* 2ycy_A* 2ycz_A* Back     alignment and structure
>3rze_A Histamine H1 receptor, lysozyme chimera; structural genomics, PSI-biology, membrane protein, GPCR NET GPCR, hydrolase; HET: 5EH D7V OLC; 3.10A {Homo sapiens} Back     alignment and structure
>2ks9_A Substance-P receptor; water, autodock, NK1, neuropeptide receptor-NEU complex; NMR {Homo sapiens} PDB: 2ksa_A 2ksb_A Back     alignment and structure
>2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Back     alignment and structure
>1hll_A Alpha-2A adrenergic receptor; helix-linker-helix, membrane protein; NMR {Synthetic} SCOP: j.94.1.1 PDB: 1hof_A 1ho9_A 1hod_A Back     alignment and structure
>4eiy_A Adenosine receptor A2A/soluble cytochrome B562 CH; novel protein engineering, GPCR network, PSI-biology, struct genomics, membrane protein, GPCR; HET: ZMA CLR OLA OLC OLB; 1.80A {Homo sapiens} PDB: 3vg9_A* 3vga_A* 2ydv_A* 2ydo_A* 3uza_A* 3rey_A* 3rfm_A* 3pwh_A* 3uzc_A* 4er9_A Back     alignment and structure
>3pbl_A D(3) dopamine receptor, lysozyme chimera; structural genomics, PSI-2, PSI-biology, protein structure initiative; HET: ETQ MAL; 2.89A {Homo sapiens} Back     alignment and structure
>2rh1_A Beta-2-adrenergic receptor/T4-lysozyme chimera; GPCR, 7TM, fusion, lipidic cubic phase, lipidic, mesophase, cholesterol, membrane protein; HET: MAL CAU CLR PLM 12P; 2.40A {Homo sapiens} PDB: 3p0g_A* 3d4s_A* 3ny8_A* 3ny9_A* 3nya_A* 3pds_A* Back     alignment and structure
>3sn6_R Lysozyme, beta-2 adrenergic receptor; seven transmembrane receptor, nanobody, G protein-coupled RE GPCR, signal transduction, G protein signaling; HET: P0G; 3.20A {Enterobacteria phage T4} PDB: 3kj6_A 2r4s_A 2r4r_A 4gbr_A* Back     alignment and structure
>2ki9_A Cannabinoid receptor 2; GPCR, G-protein coupled receptor, membrane protein; NMR {Synthetic} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 317
d1u19a_348 f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: 2e-15
>d1u19a_ f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} Length = 348 Back     information, alignment and structure

class: Membrane and cell surface proteins and peptides
fold: Family A G protein-coupled receptor-like
superfamily: Family A G protein-coupled receptor-like
family: Rhodopsin-like
domain: Rhodopsin
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 73.5 bits (179), Expect = 2e-15
 Identities = 31/156 (19%), Positives = 59/156 (37%), Gaps = 14/156 (8%)

Query: 37  LSFLFFFFIPMLVIMLMYTRIGLRIRSRSRHSLGKRVEGTVHGETKRSQSRKSIIRMLTA 96
             F+  F IP++VI   Y ++   ++  +                   ++ K + RM+  
Sbjct: 206 YMFVVHFIIPLIVIFFCYGQLVFTVKEAAAQ---------QQESATTQKAEKEVTRMVII 256

Query: 97  VVTTFFLCWAPFHAQRLIYLYARDSQYFASLNEWLFMIAGGFYYVSSTVNPILYNVMSVK 156
           +V  F +CW P+          + S +          I   F   S+  NP++Y +M+ +
Sbjct: 257 MVIAFLICWLPYAGVAFYIFTHQGSDF----GPIFMTIPAFFAKTSAVYNPVIYIMMNKQ 312

Query: 157 YRQAFKQTLCCRGGSHGSFARDQSSFRETMVDVASP 192
           +R     TLCC     G      ++  +T     +P
Sbjct: 313 FRNCMVTTLCCGKNPLGD-DEASTTVSKTETSQVAP 347

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query317
d1u19a_348 Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} 99.81
d1u19a_ 348 Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} 97.81
>d1u19a_ f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: Family A G protein-coupled receptor-like
superfamily: Family A G protein-coupled receptor-like
family: Rhodopsin-like
domain: Rhodopsin
species: Cow (Bos taurus) [TaxId: 9913]

Probab=99.81  E-value=2.7e-20  Score=164.05  Aligned_cols=128  Identities=22%  Similarity=0.543  Sum_probs=101.9

Q ss_pred             cceehhhHHHHHHHHHHHHHHHHHHHHHHHhhccccccCccccccccccchhhhhhhhHHHHHHHHHHHHHHhhHHHHHH
Q psy14313         32 VPMYELSFLFFFFIPMLVIMLMYTRIGLRIRSRSRHSLGKRVEGTVHGETKRSQSRKSIIRMLTAVVTTFFLCWAPFHAQ  111 (317)
Q Consensus        32 ~~~~~~~~~~~~~~P~~ii~~~Y~~I~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~k~~~~l~~vv~~f~icw~P~~i~  111 (317)
                      ..+..+.+.+.+++|+++++++|.+|.+.++++.++.         .+...+.++++|++|++++++++|++||+|+.+.
T Consensus       201 ~~~~~~~~~~~~~ip~~i~~~~y~~i~~~~~~~~~~~---------~~~~~~~~~~~~~~~~~~~i~~~f~~~~~P~~i~  271 (348)
T d1u19a_         201 ESFVIYMFVVHFIIPLIVIFFCYGQLVFTVKEAAAQQ---------QESATTQKAEKEVTRMVIIMVIAFLICWLPYAGV  271 (348)
T ss_dssp             HHHHHHHHHHTTHHHHHHHHHHHTTTTTSSCSCCCSS---------CSSSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             hhhHHHHHHHHHHHHHHHHHHHHHHHHhhhccccccc---------chhhhhHHHHhhHhheEEEeehHHHHHhhHHHhh
Confidence            3455566777789999999999999998887765522         1233445677899999999999999999999998


Q ss_pred             HHHHHHhcCchhhhhHHHHHHHHHHHHHHhhhhhhHHHhhhcCHHHHHHHHHHhCCCCCCC
Q psy14313        112 RLIYLYARDSQYFASLNEWLFMIAGGFYYVSSTVNPILYNVMSVKYRQAFKQTLCCRGGSH  172 (317)
Q Consensus       112 ~l~~~~~~~~~~~~~~~~~~~~~~~~l~~~ns~~NP~IY~~~~~~fR~~~~~~l~~~~~~~  172 (317)
                      .++.........    ......++.+++++||++||+||+++|++||++++++++|+++..
T Consensus       272 ~~~~~~~~~~~~----~~~~~~~~~~l~~~ns~iNPiIY~~~~~~fR~~~~~~l~c~~~~~  328 (348)
T d1u19a_         272 AFYIFTHQGSDF----GPIFMTIPAFFAKTSAVYNPVIYIMMNKQFRNCMVTTLCCGKNPL  328 (348)
T ss_dssp             HHHHHHTTTSCC----CHHHHHHHHHHGGGGGTHHHHHHHHTCHHHHHHHHHHHTSSCCCT
T ss_pred             hheeeccCCccc----cHHHHHHHHHHHHHHHHHHHHHHHhcCHHHHHHHHHHhCCCCCCC
Confidence            887666544322    234567888999999999999999999999999999998776543
>d1u19a_ f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure