Psyllid ID: psy14416


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060-----
MSEDYDEELSANQVIAQALKFQGIEYVFGIVGIPVIELAMACQQEGIHYIGMRNEQAACYAAQAIGYLTKKPGVCLVVSGPGLLHTFGGMANAQINCWPMLVIGGSCAQDHEGIGGFQECPQVELARPYCKYSARPPNIHLIGQHVEKAVRLSTFGKPGRSLLLNNLPRHRLDAGTFGTMGVGLGFALAAALYCNHYAPGKRVVCVQGDSAFGFSGMELETLVRYRLPVILVIVNNNGIYGGFDEATYAWLDIIKKSNMSEDYDEELSANQVIAQALKFQGIEYVFGIVGIPVIELAMACQQEGIHYIGMRNEQAACYAAQAIGYLTKKPGVCLVVSGPGLLHTFGGMANAQINCWPMLVIGGSCAQDHEGIGGFQECPQVELARPYCKYSARPPNIHLIGQHVEKAVRLSTFGKPGVSYLDFPANLLAQRINQSALVPTPKVLEPTLPWPGIAELKQASQLILEAKAPLVIIGKVLEPTLPWPGIAELKQASRLILEAKAPLVIIGKGAAYSQAETELLSFVNSFNLPFLPTPMGKGVVPDAHPNCVSAARTHALQNADLVLLLGARLNWILHFGRAPRFKSNVKIIQVDLNAEELHNSVQAAVAIQSDVRLTVQQLKQMLSHTQRNWSFSATSPWWQELKLKCQTNRQVKLPVILVIVNNNGIYGGFDETTYASIVESGEVTTVLPVILVIVNNNGIYGGFDETTYASIVESGEVTTVLPVILVIVNNNGIYGGFDETTYASIVESGEVTTVLPVILVIVNNNGIYGGFDETTYASIVESGEVTTVLPVILVIVNNNGIYGGFDETTYASIVESGEVTTVLPVILVIVNNNGIYGGFDETTYASIVESGEVTTVLPVILVIVNNNGIYGGFDETTYASIVESGEVTTVLPVILVIVNNNGIYGGFDETTYASIVESGEVTTVLPVILVIVNNNGIYGGFDETTYASIVESGEVTTVLPVILVIVNNNGIYGGFDEATYASIVESGEVTTVSPPTSLGPSLRYEKMMAVFGHDGYLCTTVPQIKQAMKKCLQTTTRPSLINILINPSADRKPQNFSWLTNLLLE
ccccccccccHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHccccEEEEcccHHHHHHHHHHHHHccccEEEEEEccccHHHHHHHHHHHccccccEEEEEccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccEEEEcccccccccccccccccccccccHHHHHHHHHHccccccEEEEEcHHHHccHHHHHHHHHHccccEEEEEcccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHccccEEEccccHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHcccccEEEEEccccccccccccccccccHHHHcccccccccccccccHHHHHHHHHHHHHcccccccEEEEccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHcccccEEEEcccEEccccHHHHHHHHHHcccccccccccccccccccccccccHHHHccccccEEEEEcccccccccccccccccccccEEEEEcccccccccccccEEEEccHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHccccccccccccccHHHHHHHHcccccccEEEEcHHHHcccccccccccccccccccHHHHHHHHHccccccccccEEEEEEcccccccccHHHHHHHHHcccccccccEEEEEEEcccccccccHHHHHHHHccccccccccccccccccccccccccccccEEccccccccccccEEEEEEccccccccccccccccccccccEEEcccEEEEEEcccccccccccccHHHHHHcccccEEccEEEEEEcccccccccccHHHHHHHHccccccccccEEEEEEcccccccccccccHHHHHcccccccccEEEEEEccccccccccHHHHHHHHcccccccccccccccccccHHHHHHHcccccEEEccHHHHHHHHHHHHHcccccEEEEEEEcccccccccccccccccccc
cccccccHccHHHHHHHHHHHcccEEEEccccccHHHHHHHHHcccccEEEEEHHHHHHHHHccHHHHccccEEEEEEcccccHHHHHHHHHHHHccccEEEEEcccccccccccHHHHHcEEEEccccEEccEEEccHHHHHHHHHHHHHHHHccccccEEEcccccccccccccccccccccccHHHHHHHHHHHcccccEEEEEEHHHHcccHHHHHHHHHHccccEEEEEEcccccccccccccccccccccccccccccHHccHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHcccccEEEEEHHHHHHHHHccHHHcccccEEEEEEcccccHHHHHHHHHHHHccccEEEEEcccccccccccHHHHHcEEEEccccEEccEEEccHHHHHHHHHHHHHHHHccccccEEEEcccccccccccccccccccccccccccccccEEEEccccccccccccccccccccccccccccHHHHHHHHHHHHHccccEEEEcHHHHcccHHHHHHHHHHHccccEEHHHcccccccccccHHHHHHcHHHcccccEEEEEEEEEccccccccHHHHccccEEEEEEcccccccccccccccEEccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccccccccccccccHHHEEEEcccccEEEEccccHHHHHHHHHcccccccccccccccccccccHHEEEEEcccccEEEEEEccHHHHHHHHHHHHHHHHcccccccccEEEEEEcccHHHHHHHHHHHccccccccHHcccHHHHHHHHHHccEEEEEcccHHHHHHHHHHHccccEEEEEEEcccccccccccccccccccccccEEEEEEEEEEEccccEccccccEEEEEEEcccEEEEcEEEEEEEEccccEccccccEEEEEEEcccEEEEcEEEEEEEEccccEccccccEEEEEEEcccEEEEcEEEEEEEEccccEccccccEEEEEEEcccEEEcccccccccccHHHHHHHHHcccccEcccHHHHHHHHHHHHHccccHHHHHHHcccccccccccHHHHHHHHcc
MSEDYDEELSANQVIAQALKFQGIEYVFGIVGIPVIELAMACQQEGIHYIGMRNEQAACYAAQAIGyltkkpgvclvvsgpgllhtfggmanaqincwpmlviggscaqdhegiggfqecpqvelarpyckysarppnihliGQHVEKAVRlstfgkpgrslllnnlprhrldagtfgtmGVGLGFALAAALYcnhyapgkrvvcvqgdsafgfsgmELETLVRYRLPVILVIVNnngiyggfdeaTYAWLDIIKksnmsedydeELSANQVIAQALKFQGIEYVFGIVGIPVIELAMACQQEGIHYIGMRNEQAACYAAQAIGyltkkpgvclvvsgpgllhtfggmanaqincwpmlviggscaqdhegiggfqecpqvelarpyckysarppnihliGQHVEKAVRlstfgkpgvsyldfpaNLLAQRInqsalvptpkvleptlpwpgiaELKQASQLILEAKAPLVIIGkvleptlpwpgiaELKQASRLILEAKAPLVIIGKGAAYSQAETELLSFVnsfnlpflptpmgkgvvpdahpncvSAARTHALQNADLVLLLGARLNWIlhfgraprfksnVKIIQVDLNAEELHNSVQAAVAIQSDVRLTVQQLKQMLSHTqrnwsfsatspwwQELKLKcqtnrqvkLPVILVIVnnngiyggfdetTYASIVESGEVTTVLPVILVIVNnngiyggfdetTYASIVESGEVTTVLPVILVIVNnngiyggfdetTYASIVESGEVTTVLPVILVIVNnngiyggfdetTYASIVESGEVTTVLPVILVIVNnngiyggfdetTYASIVESGEVTTVLPVILVIVNnngiyggfdetTYASIVESGEVTTVLPVILVIVNnngiyggfdetTYASIVESGEVTTVLPVILVIVNnngiyggfdetTYASIVESGEVTTVLPVILVIVNnngiyggfdetTYASIVESGEVTTVLPVILVIVNnngiyggfdeATYASIVEsgevttvspptslgpslrYEKMMAVFghdgylcttVPQIKQAMKKCLqtttrpslinilinpsadrkpqnfSWLTNLLLE
MSEDYDEELSANQVIAQALKFQGIEYVFGIVGIPVIELAMACQQEGIHYIGMRNEQAACYAAQAIGYLTKKPGVCLVVSGPGLLHTFGGMANAQINCWPMLVIGGSCAQDHEGIGGFQECPQVELARPYCKYSARPPNIHLIGQHVEKAVRLSTFGKPGRSLLLNNLPRHRLDAGTFGTMGVGLGFALAAALYCNHYAPGKRVVCVQGDSAFGFSGMELETLVRYRLPVILVIVNNNGIYGGFDEATYAWLDIIKKSNMSEDYDEELSANQVIAQALKFQGIEYVFGIVGIPVIELAMACQQEGIHYIGMRNEQAACYAAQAIGYLTKKPGVCLVVSGPGLLHTFGGMANAQINCWPMLVIGGSCAQDHEGIGGFQECPQVELARPYCKYSARPPNIHLIGQHVEKAVRLSTFGKPGVSYLDFPANLLAQRINQSALVPTPKVLEPTLPWPGIAELKQASQLILEAKAPLVIIGKVLEPTLPWPGIAELKQASRLILEAKAPLVIIGKGAAYSQAETELLSFVNSFNLPFLPTPMGKGVVPDAHPNCVSAARTHALQNADLVLLLGARLNWILHFgraprfksNVKIIQVDLNAEELHNSVQAAVAIQSDVRLTVQQLKQMLSHTQRNWSFSATSPWWQELKLKCQTNRQVKLPVILVIVNNNGIYGGFDETTYASIVESGEVTTVLPVILVIVNNNGIYGGFDETTYASIVESGEVTTVLPVILVIVNNNGIYGGFDETTYASIVESGEVTTVLPVILVIVNNNGIYGGFDETTYASIVESGEVTTVLPVILVIVNNNGIYGGFDETTYASIVESGEVTTVLPVILVIVNNNGIYGGFDETTYASIVESGEVTTVLPVILVIVNNNGIYGGFDETTYASIVESGEVTTVLPVILVIVNNNGIYGGFDETTYASIVESGEVTTVLPVILVIVNNNGIYGGFDETTYASIVESGEVTTVLPVILVIVNNNGIYGGFDEATYASIVEsgevttvspptslgpSLRYEKMMAVFGHDGYLCTTVPQIKQAMKKCLQTTTRPSLINILinpsadrkpqnfswltnllle
MSEDYDEELSANQVIAQALKFQGIEYVFGIVGIPVIELAMACQQEGIHYIGMRNEQAACYAAQAIGYLTKKPGVCLVVSGPGLLHTFGGMANAQINCWPMLVIGGSCAQDHEGIGGFQECPQVELARPYCKYSARPPNIHLIGQHVEKAVRLSTFGKPGRSLLLNNLPRHRLDAGTFGTMgvglgfalaaalYCNHYAPGKRVVCVQGDSAFGFSGMELETLVRYRLPVILVIVNNNGIYGGFDEATYAWLDIIKKSNMSEDYDEELSANQVIAQALKFQGIEYVFGIVGIPVIELAMACQQEGIHYIGMRNEQAACYAAQAIGYLTKKPGVCLVVSGPGLLHTFGGMANAQINCWPMLVIGGSCAQDHEGIGGFQECPQVELARPYCKYSARPPNIHLIGQHVEKAVRLSTFGKPGVSYLDFPANLLAQRINQSALVPTPKVLEPTLPWPGIAELKQASQLILEAKAPLVIIGKVLEPTLPWPGIAELKQASRLILEAKAPLVIIGKGAAYSQAETELLSFVNSFNLPFLPTPMGKGVVPDAHPNCVSAARTHALQNADLVLLLGARLNWILHFGRAPRFKSNVKIIQVDLNAEELHNSVQAAVAIQSDVRLTVQQLKQMLSHTQRNWSFSATSPWWQELKLKCQTNRQVKLPVILVIVNNNGIYGGFDETTYASIVESGEVTTVLPvilvivnnngiyggFDETTYASIVESGEVTTVLPvilvivnnngiyggFDETTYASIVESGEVTTVLPvilvivnnngiyggFDETTYASIVESGEVTTVLPvilvivnnngiyggFDETTYASIVESGEVTTVLPvilvivnnngiyggFDETTYASIVESGEVTTVLPvilvivnnngiyggFDETTYASIVESGEVTTVLPvilvivnnngiyggFDETTYASIVESGEVTTVLPvilvivnnngiyggFDETTYASIVESGEVTTVLPvilvivnnngiyggFDEATYASIVESGEVTTVSPPTSLGPSLRYEKMMAVFGHDGYLCTTVPQIKQAMKKCLQTTTRPSLINILINPSADRKPQNFSWLTNLLLE
************QVIAQALKFQGIEYVFGIVGIPVIELAMACQQEGIHYIGMRNEQAACYAAQAIGYLTKKPGVCLVVSGPGLLHTFGGMANAQINCWPMLVIGGSCAQDHEGIGGFQECPQVELARPYCKYSARPPNIHLIGQHVEKAVRLSTFGKPGRSLLLNNLPRHRLDAGTFGTMGVGLGFALAAALYCNHYAPGKRVVCVQGDSAFGFSGMELETLVRYRLPVILVIVNNNGIYGGFDEATYAWLDIIKKSNMSEDYDEELSANQVIAQALKFQGIEYVFGIVGIPVIELAMACQQEGIHYIGMRNEQAACYAAQAIGYLTKKPGVCLVVSGPGLLHTFGGMANAQINCWPMLVIGGSCAQDHEGIGGFQECPQVELARPYCKYSARPPNIHLIGQHVEKAVRLSTFGKPGVSYLDFPANLLAQRINQSALVPTPKVLEPTLPWPGIAELKQASQLILEAKAPLVIIGKVLEPTLPWPGIAELKQASRLILEAKAPLVIIGKGAAYSQAETELLSFVNSFNLPFLPTPMGKGVVPDAHPNCVSAARTHALQNADLVLLLGARLNWILHFGRAPRFKSNVKIIQVDLNAEELHNSVQAAVAIQSDVRLTVQQLKQMLSHTQRNWSFSATSPWWQELKLKCQTNRQVKLPVILVIVNNNGIYGGFDETTYASIVESGEVTTVLPVILVIVNNNGIYGGFDETTYASIVESGEVTTVLPVILVIVNNNGIYGGFDETTYASIVESGEVTTVLPVILVIVNNNGIYGGFDETTYASIVESGEVTTVLPVILVIVNNNGIYGGFDETTYASIVESGEVTTVLPVILVIVNNNGIYGGFDETTYASIVESGEVTTVLPVILVIVNNNGIYGGFDETTYASIVESGEVTTVLPVILVIVNNNGIYGGFDETTYASIVESGEVTTVLPVILVIVNNNGIYGGFDETTYASIVESGEVTTVLPVILVIVNNNGIYGGFDEATYASIVESGEVTTV*****LGPSLRYEKMMAVFGHDGYLCTTVPQIKQAMKKCLQTTTRPSLINILINPS******NFSWLTNL***
***********NQVIAQALKFQGIEYVFGIVGIPVIELAMACQQEGIHYIGMRNEQAACYAAQAIGYLTKKPGVCLVVSGPGLLHTFGGMANAQINCWPMLVIGGSCAQDHEGIGGFQECPQVELARPYCKYSARPPNIHLIGQHVEKAVRLSTFGKPGRSLLLNNLPRHRLDAGTFGTMGVGLGFALAAALYCNHYAPGKRVVCVQGDSAFGFSGMELETLVRYRLPVILVIVNNNGIYGGFDEATYAWLDIIKKSNMSEDYDEELSANQVIAQALKFQGIEYVFGIVGIPVIELAMACQQEGIHYIGMRNEQAACYAAQAIGYLTKKPGVCLVVSGPGLLHTFGGMANAQINCWPMLVIGGSCAQDHEGIGGFQECPQVELARPYCKYSARPPNIHLIGQHVEKAVRLSTFGKPGVSYLDFPANLLAQRINQSALVPTPKVLEPTLPWPGIAELKQASQLILEAKAPLVIIGKVLEPTLPWPGIAELKQASRLILEAKAPLVIIGKGAAYSQAETELLSFVNSFNLPFLPTPMGKGVVPDAHPNCVSAARTHALQNADLVLLLGARLNWILHFGRAPRFKSNVKIIQVDLNAEELHNSVQAAVAIQSDVRLTVQQLKQMLSH*******SATSPWWQELKLKCQTNR*******LVIVNNNGIYGGFDETTYASIVESGEVTTVLPVILVIVNNNGIYGGFDETTYASIVESGEVTTVLPVILVIVNNNGIYGGFDETTYASIVESGEVTTVLPVILVIVNNNGIYGGFDETTYASIV*****TTVLPVILVIVNNNGIYGGFDETTYASIVESGEVTTVLPVILVIVNNNGIYGGFDETTYASIVESGEVTTVLPVILVIVNNNGIYGGFDETTYASIVESGEVTTVLPVILVIVNNNGIYGGFDETTYASIVESGEVTTVLPVILVIVNNNGIYGGFDETTYASIVESGEVTTVLPVILVIVNNNGIYGGFDEATYASIVESGEVTTVSPPTSLGPSLRYEKMMAVFGHDGYLCTTVPQIKQAMKKCLQTTTRPSLINILINPSADRKPQ*F**LTNL***
*********SANQVIAQALKFQGIEYVFGIVGIPVIELAMACQQEGIHYIGMRNEQAACYAAQAIGYLTKKPGVCLVVSGPGLLHTFGGMANAQINCWPMLVIGGSCAQDHEGIGGFQECPQVELARPYCKYSARPPNIHLIGQHVEKAVRLSTFGKPGRSLLLNNLPRHRLDAGTFGTMGVGLGFALAAALYCNHYAPGKRVVCVQGDSAFGFSGMELETLVRYRLPVILVIVNNNGIYGGFDEATYAWLDIIKKSNMSEDYDEELSANQVIAQALKFQGIEYVFGIVGIPVIELAMACQQEGIHYIGMRNEQAACYAAQAIGYLTKKPGVCLVVSGPGLLHTFGGMANAQINCWPMLVIGGSCAQDHEGIGGFQECPQVELARPYCKYSARPPNIHLIGQHVEKAVRLSTFGKPGVSYLDFPANLLAQRINQSALVPTPKVLEPTLPWPGIAELKQASQLILEAKAPLVIIGKVLEPTLPWPGIAELKQASRLILEAKAPLVIIGKGAAYSQAETELLSFVNSFNLPFLPTPMGKGVVPDAHPNCVSAARTHALQNADLVLLLGARLNWILHFGRAPRFKSNVKIIQVDLNAEELHNSVQAAVAIQSDVRLTVQQLKQMLSHTQRNWSFSATSPWWQELKLKCQTNRQVKLPVILVIVNNNGIYGGFDETTYASIVESGEVTTVLPVILVIVNNNGIYGGFDETTYASIVESGEVTTVLPVILVIVNNNGIYGGFDETTYASIVESGEVTTVLPVILVIVNNNGIYGGFDETTYASIVESGEVTTVLPVILVIVNNNGIYGGFDETTYASIVESGEVTTVLPVILVIVNNNGIYGGFDETTYASIVESGEVTTVLPVILVIVNNNGIYGGFDETTYASIVESGEVTTVLPVILVIVNNNGIYGGFDETTYASIVESGEVTTVLPVILVIVNNNGIYGGFDETTYASIVESGEVTTVLPVILVIVNNNGIYGGFDEATYASIVESGEVTTVSPPTSLGPSLRYEKMMAVFGHDGYLCTTVPQIKQAMKKCLQTTTRPSLINILINPSADRKPQNFSWLTNLLLE
********LSANQVIAQALKFQGIEYVFGIVGIPVIELAMACQQEGIHYIGMRNEQAACYAAQAIGYLTKKPGVCLVVSGPGLLHTFGGMANAQINCWPMLVIGGSCAQDHEGIGGFQECPQVELARPYCKYSARPPNIHLIGQHVEKAVRLSTFGKPGRSLLLNNLPRHRLDAGTFGTMGVGLGFALAAALYCNHYAPGKRVVCVQGDSAFGFSGMELETLVRYRLPVILVIVNNNGIYGGFDEATYAWLDIIKKS***ED***ELSANQVIAQALKFQGIEYVFGIVGIPVIELAMACQQEGIHYIGMRNEQAACYAAQAIGYLTKKPGVCLVVSGPGLLHTFGGMANAQINCWPMLVIGGSCAQDHEGIGGFQECPQVELARPYCKYSARPPNIHLIGQHVEKAVRLSTFGKPGVSYLDFPANLLAQRINQSALVPTPKVLEPTLPWPGIAELKQASQLILEAKAPLVIIGKVLEPTLPWPGIAELKQASRLILEAKAPLVIIGKGAAYSQAETELLSFVNSFNLPFLPTPMGKGVVPDAHPNCVSAARTHALQNADLVLLLGARLNWILHFGRAPRFKSNVKIIQVDLNAEELHNSVQAAVAIQSDVRLTVQQLKQMLSHTQRNWSFSATSPWWQELKLKCQTNRQVKLPVILVIVNNNGIYGGFDETTYASIVESGEVTTVLPVILVIVNNNGIYGGFDETTYASIVESGEVTTVLPVILVIVNNNGIYGGFDETTYASIVESGEVTTVLPVILVIVNNNGIYGGFDETTYASIVESGEVTTVLPVILVIVNNNGIYGGFDETTYASIVESGEVTTVLPVILVIVNNNGIYGGFDETTYASIVESGEVTTVLPVILVIVNNNGIYGGFDETTYASIVESGEVTTVLPVILVIVNNNGIYGGFDETTYASIVESGEVTTVLPVILVIVNNNGIYGGFDETTYASIVESGEVTTVLPVILVIVNNNGIYGGFDEATYASIVESGEVTTVSPPTSLGPSLRYEKMMAVFGHDGYLCTTVPQIKQAMKKCLQTTTRPSLINILINPSADRKPQNFSWLTNLLLE
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSEDYDEELSANQVIAQALKFQGIEYVFGIVGIPVIELAMACQQEGIHYIGMRNEQAACYAAQAIGYLTKKPGVCLVVSGPGLLHTFGGMANAQINCWPMLVIGGSCAQDHEGIGGFQECPQVELARPYCKYSARPPNIHLIGQHVEKAVRLSTFGKPGRSLLLNNLPRHRLDAGTFGTMGVGLGFALAAALYCNHYAPGKRVVCVQGDSAFGFSGMELETLVRYRLPVILVIVNNNGIYGGFDEATYAWLDIIKKSNMSEDYDEELSANQVIAQALKFQGIEYVFGIVGIPVIELAMACQQEGIHYIGMRNEQAACYAAQAIGYLTKKPGVCLVVSGPGLLHTFGGMANAQINCWPMLVIGGSCAQDHEGIGGFQECPQVELARPYCKYSARPPNIHLIGQHVEKAVRLSTFGKPGVSYLDFPANLLAQRINQSALVPTPKVLEPTLPWPGIAELKQASQLILEAKAPLVIIGKVLEPTLPWPGIAELKQASRLILEAKAPLVIIGKGAAYSQAETELLSFVNSFNLPFLPTPMGKGVVPDAHPNCVSAARTHALQNADLVLLLGARLNWILHFGRAPRFKSNVKIIQVDLNAEELHNSVQAAVAIQSDVRLTVQQLKQMLSHTQRNWSFSATSPWWQELKLKCQTNRQVKLPVILVIVNNNGIYGGFDETTYASIVESGEVTTVLPVILVIVNNNGIYGGFDETTYASIVESGEVTTVLPVILVIVNNNGIYGGFDETTYASIVESGEVTTVLPVILVIVNNNGIYGGFDETTYASIVESGEVTTVLPVILVIVNNNGIYGGFDETTYASIVESGEVTTVLPVILVIVNNNGIYGGFDETTYASIVESGEVTTVLPVILVIVNNNGIYGGFDETTYASIVESGEVTTVLPVILVIVNNNGIYGGFDETTYASIVESGEVTTVLPVILVIVNNNGIYGGFDETTYASIVESGEVTTVLPVILVIVNNNGIYGGFDEATYASIVESGEVTTVSPPTSLGPSLRYEKMMAVFGHDGYLCTTVPQIKQAMKKCLQTTTRPSLINILINPSADRKPQNFSWLTNLLLE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1065 2.2.26 [Sep-21-2011]
Q9UJ83578 2-hydroxyacyl-CoA lyase 1 yes N/A 0.476 0.877 0.416 1e-113
Q9QXE0581 2-hydroxyacyl-CoA lyase 1 yes N/A 0.470 0.862 0.417 1e-112
Q8CHM7581 2-hydroxyacyl-CoA lyase 1 yes N/A 0.461 0.845 0.422 1e-111
Q54DA9580 Probable 2-hydroxyacyl-Co yes N/A 0.437 0.803 0.316 1e-70
P39994560 Putative 2-hydroxyacyl-Co yes N/A 0.322 0.612 0.416 1e-66
Q9Y7M1568 Putative 2-hydroxyacyl-Co yes N/A 0.446 0.836 0.333 9e-66
Q9LF46572 2-hydroxyacyl-CoA lyase O yes N/A 0.334 0.622 0.350 2e-65
P40149568 Oxalyl-CoA decarboxylase N/A N/A 0.332 0.623 0.333 7e-56
P0AFI0564 Probable oxalyl-CoA decar N/A N/A 0.319 0.602 0.370 9e-56
P0AFI1564 Probable oxalyl-CoA decar N/A N/A 0.319 0.602 0.370 9e-56
>sp|Q9UJ83|HACL1_HUMAN 2-hydroxyacyl-CoA lyase 1 OS=Homo sapiens GN=HACL1 PE=1 SV=2 Back     alignment and function desciption
 Score =  411 bits (1057), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 229/550 (41%), Positives = 322/550 (58%), Gaps = 43/550 (7%)

Query: 257 SNMSEDYDEELSANQVIAQALKFQGIEYVFGIVGIPVIELAMACQQEGIHYIGMRNEQAA 316
           SN +E  +E++S  +VIAQALK Q +EY+FGIVGIPV E+A+A QQ GI YIGMRNEQAA
Sbjct: 4   SNFAERSEEQVSGAKVIAQALKTQDVEYIFGIVGIPVTEIAIAAQQLGIKYIGMRNEQAA 63

Query: 317 CYAAQAIGYLTKKPGVCLVVSGPGLLHTFGGMANAQINCWPMLVIGGSCAQDHEGIGGFQ 376
           CYAA AIGYLT +PGVCLVVSGPGL+H  GGMANA +NCWP+LVIGGS  ++ E +G FQ
Sbjct: 64  CYAASAIGYLTSRPGVCLVVSGPGLIHALGGMANANMNCWPLLVIGGSSERNQETMGAFQ 123

Query: 377 ECPQVELARPYCKYSARPPNIHLIGQHVEKAVRLSTFGKPGVSYLDFPANLLAQRINQSA 436
           E PQVE  R Y K+SARP +I  I   +EKAVR S +G+PG  Y+D PA+ +  ++N ++
Sbjct: 124 EFPQVEACRLYTKFSARPSSIEAIPFVIEKAVRSSIYGRPGACYVDIPADFVNLQVNVNS 183

Query: 437 LVPTPKVLEPTLPWPGIAELKQASQLILEAKAPLVIIGKVLEPTLPWPGIAELKQASRLI 496
           +    K +E                             + + P +     + +  A+ +I
Sbjct: 184 I----KYME-----------------------------RCMSPPISMAETSAVCTAASVI 210

Query: 497 LEAKAPLVIIGKGAAYSQAETELLSFVNSFNLPFLPTPMGKGVVPDAHPNCVSAARTHAL 556
             AK PL+IIGKGAAY+ AE  +   V  + LPFLPTPMGKGVVPD HP CV AAR+ AL
Sbjct: 211 RNAKQPLLIIGKGAAYAHAEESIKKLVEQYKLPFLPTPMGKGVVPDNHPYCVGAARSRAL 270

Query: 557 QNADLVLLLGARLNWILHFGRAPRFKSNVKIIQVDLNAEELHNSVQAAVAIQSDVRLTVQ 616
           Q AD+++L GARLNWILHFG  PR++ +VK IQVD+ AEEL N+V+ AV +  ++    +
Sbjct: 271 QFADVIVLFGARLNWILHFGLPPRYQPDVKFIQVDICAEELGNNVKPAVTLLGNIHAVTK 330

Query: 617 QLKQMLSHTQRNWSFSATSPWWQELKLKCQTNRQVKLPVIL---VIVNNNGIYGGFDETT 673
           QL + L  T   W +   S WW+ L+ K ++N      +     + +N   ++    E  
Sbjct: 331 QLLEELDKTP--WQYPPESKWWKTLREKMKSNEAASKELASKKSLPMNYYTVFYHVQEQL 388

Query: 674 YASIVESGEVTTVLPVILVIVNNNGIYGGFDETTYASIVESGEVTTVLPVILVIVNNNGI 733
                   E    + +   ++ N       D  T+ ++   G    +   ++    + G 
Sbjct: 389 PRDCFVVSEGANTMDIGRTVLQNYLPRHRLDAGTFGTM-GVGLGFAIAAAVVAKDRSPGQ 447

Query: 734 YGGFDETTYASIVESGEVTTV----LPVILVIVNNNGIYGGFDETTYASIVESGEVTTVL 789
           +    E   A      EV T+    LP+IL++VNNNGIY GFD  T+  +++  + T V+
Sbjct: 448 WIICVEGDSAFGFSGMEVETICRYNLPIILLVVNNNGIYQGFDTDTWKEMLKFQDATAVV 507

Query: 790 PVILVIVNNN 799
           P + ++ N++
Sbjct: 508 PPMCLLPNSH 517




Catalyzes a carbon-carbon cleavage reaction; cleaves a 2-hydroxy-3-methylacyl-CoA into formyl-CoA and a 2-methyl-branched fatty aldehyde.
Homo sapiens (taxid: 9606)
EC: 4EC: .EC: 1EC: .EC: -EC: .EC: -
>sp|Q9QXE0|HACL1_MOUSE 2-hydroxyacyl-CoA lyase 1 OS=Mus musculus GN=Hacl1 PE=1 SV=2 Back     alignment and function description
>sp|Q8CHM7|HACL1_RAT 2-hydroxyacyl-CoA lyase 1 OS=Rattus norvegicus GN=Hacl1 PE=1 SV=1 Back     alignment and function description
>sp|Q54DA9|HACL1_DICDI Probable 2-hydroxyacyl-CoA lyase 1 OS=Dictyostelium discoideum GN=hacl1 PE=3 SV=1 Back     alignment and function description
>sp|P39994|YEC0_YEAST Putative 2-hydroxyacyl-CoA lyase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YEL020C PE=1 SV=1 Back     alignment and function description
>sp|Q9Y7M1|YGK4_SCHPO Putative 2-hydroxyacyl-CoA lyase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC725.04 PE=3 SV=1 Back     alignment and function description
>sp|Q9LF46|HACL_ARATH 2-hydroxyacyl-CoA lyase OS=Arabidopsis thaliana GN=HACL PE=2 SV=1 Back     alignment and function description
>sp|P40149|OXC_OXAFO Oxalyl-CoA decarboxylase OS=Oxalobacter formigenes GN=oxc PE=1 SV=1 Back     alignment and function description
>sp|P0AFI0|OXC_ECOLI Probable oxalyl-CoA decarboxylase OS=Escherichia coli (strain K12) GN=oxc PE=1 SV=1 Back     alignment and function description
>sp|P0AFI1|OXC_ECO57 Probable oxalyl-CoA decarboxylase OS=Escherichia coli O157:H7 GN=oxc PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1065
170056814567 2-hydroxyacyl-CoA lyase 1 [Culex quinque 0.468 0.880 0.484 1e-136
170066022567 2-hydroxyphytanoyl-coa lyase [Culex quin 0.468 0.880 0.482 1e-135
158289987567 AGAP010368-PA [Anopheles gambiae str. PE 0.455 0.855 0.486 1e-135
195057253568 GH22747 [Drosophila grimshawi] gi|193899 0.455 0.853 0.488 1e-134
194881517568 GG20879 [Drosophila erecta] gi|190658064 0.452 0.848 0.484 1e-134
312377568567 hypothetical protein AND_11090 [Anophele 0.472 0.887 0.462 1e-133
19922626568 CG11208 [Drosophila melanogaster] gi|730 0.455 0.853 0.477 1e-133
56201294568 unnamed protein product [Drosophila simu 0.452 0.848 0.482 1e-133
195486951568 GE13819 [Drosophila yakuba] gi|194177821 0.455 0.853 0.477 1e-133
195170154568 GL10162 [Drosophila persimilis] gi|19411 0.452 0.848 0.480 1e-133
>gi|170056814|ref|XP_001864201.1| 2-hydroxyacyl-CoA lyase 1 [Culex quinquefasciatus] gi|167876488|gb|EDS39871.1| 2-hydroxyacyl-CoA lyase 1 [Culex quinquefasciatus] Back     alignment and taxonomy information
 Score =  491 bits (1264), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 269/555 (48%), Positives = 342/555 (61%), Gaps = 56/555 (10%)

Query: 266 ELSANQVIAQALKFQGIEYVFGIVGIPVIELAMACQQEGIHYIGMRNEQAACYAAQAIGY 325
           E+  N V+A++LK QG+EYVFGIVGIPVIEL+MA Q EG+ YIGMRNEQ+ACYAAQAIGY
Sbjct: 2   EVDGNTVLARSLKEQGVEYVFGIVGIPVIELSMAMQAEGLKYIGMRNEQSACYAAQAIGY 61

Query: 326 LTKKPGVCLVVSGPGLLHTFGGMANAQINCWPMLVIGGSCAQDHEGIGGFQECPQVELAR 385
           LT KPGVCLVVSGPGLLH  GGMANAQ+NCWP+LVIGGS  QDHEGIGGFQECPQVEL+R
Sbjct: 62  LTGKPGVCLVVSGPGLLHVTGGMANAQVNCWPLLVIGGSTFQDHEGIGGFQECPQVELSR 121

Query: 386 PYCKYSARPPNIHLIGQHVEKAVRLSTFGKPGVSYLDFPANLLAQRINQSALVPTPKVLE 445
           PYCKYSARP  + LI QHVEKAVRL+ +G+PG +YLDFP NLL  R      VP  KV  
Sbjct: 122 PYCKYSARPAGVTLIPQHVEKAVRLACYGRPGAAYLDFPGNLLLAR------VPEEKVP- 174

Query: 446 PTLPWPGIAELKQASQLILEAKAPLVIIGKVLEPTLPWPGIAELKQASRLILEAKAPLVI 505
                      KQ +                 EP + +P    ++QA+ L+  AK PL+I
Sbjct: 175 -----------KQYAHP---------------EPPIAFPSEKCVRQAAHLLANAKRPLII 208

Query: 506 IGKGAAYSQAETELLSFVNSFNLPFLPTPMGKGVVPDAHPNCVSAARTHALQNADLVLLL 565
           IGKGAAY++AE  L   V+  NLPFLPTPMGKGVVPD  P CV+ ART ALQ AD +LLL
Sbjct: 209 IGKGAAYARAELHLRQLVHQTNLPFLPTPMGKGVVPDLDPQCVAPARTLALQKADCILLL 268

Query: 566 GARLNWILHFGRAPRFKSNVKIIQVDLNAEELHNSVQAAVAIQSDVRLTVQQLKQMLSHT 625
           GARLNW+LHFGRAPR+   VKIIQVDLN EELHNSV ++VA+QSD+    +QL   L++ 
Sbjct: 269 GARLNWMLHFGRAPRYSEGVKIIQVDLNPEELHNSVLSSVAVQSDIVPFTEQLIDELANM 328

Query: 626 QRNWSFSATSPWWQELKLKCQTNRQVKLPV---ILVIVNNNGIYGGFDETTYASIVESGE 682
             +++F   + WW +L+ KC  NR++   +   + V +N + ++    E      +   E
Sbjct: 329 --HFTFDNKNDWWVDLRAKCDKNRKIVDKMAQDVKVPLNYHAVFHHLQELIPKDAIIVSE 386

Query: 683 VTTVLPVILVIVNNNGIYGGFDETTYAS--------IVESGEVTTVLPVILVIVNNNGIY 734
               + +    ++N       D  T+ +        I  +       P   VI       
Sbjct: 387 GANTMDIGRTFLHNKWPRHRLDAGTFGTMGVGPGFAIAAALVCRDRFPGEKVICVEGDSA 446

Query: 735 GGFDETTYASIVESGEVTTVLPVILVIVNNNGIYGGFDETTYASIVESGEVTTVLPVILV 794
            GF      +++        LPV++VIVNN GIY GFD+ TY  +   G++T V P   +
Sbjct: 447 FGFSGMEIETMMRYQ-----LPVVIVIVNNGGIYSGFDKQTYDDMRSGGDLTQVTPPTAL 501

Query: 795 IVNNN-----GIYGG 804
            V  +     G++G 
Sbjct: 502 AVETHYEAMMGMFGA 516




Source: Culex quinquefasciatus

Species: Culex quinquefasciatus

Genus: Culex

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|170066022|ref|XP_001868099.1| 2-hydroxyphytanoyl-coa lyase [Culex quinquefasciatus] gi|167862705|gb|EDS26088.1| 2-hydroxyphytanoyl-coa lyase [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|158289987|ref|XP_311576.3| AGAP010368-PA [Anopheles gambiae str. PEST] gi|157018423|gb|EAA07115.3| AGAP010368-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|195057253|ref|XP_001995225.1| GH22747 [Drosophila grimshawi] gi|193899431|gb|EDV98297.1| GH22747 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|194881517|ref|XP_001974877.1| GG20879 [Drosophila erecta] gi|190658064|gb|EDV55277.1| GG20879 [Drosophila erecta] Back     alignment and taxonomy information
>gi|312377568|gb|EFR24375.1| hypothetical protein AND_11090 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|19922626|ref|NP_611460.1| CG11208 [Drosophila melanogaster] gi|7302414|gb|AAF57501.1| CG11208 [Drosophila melanogaster] gi|16198201|gb|AAL13912.1| LD40177p [Drosophila melanogaster] gi|220946180|gb|ACL85633.1| CG11208-PA [synthetic construct] gi|220955878|gb|ACL90482.1| CG11208-PA [synthetic construct] Back     alignment and taxonomy information
>gi|56201294|dbj|BAD72897.1| unnamed protein product [Drosophila simulans] gi|56201314|dbj|BAD72915.1| unnamed protein product [Drosophila sechellia] Back     alignment and taxonomy information
>gi|195486951|ref|XP_002091720.1| GE13819 [Drosophila yakuba] gi|194177821|gb|EDW91432.1| GE13819 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|195170154|ref|XP_002025878.1| GL10162 [Drosophila persimilis] gi|194110742|gb|EDW32785.1| GL10162 [Drosophila persimilis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1065
FB|FBgn0034488568 CG11208 [Drosophila melanogast 0.197 0.369 0.652 2.9e-97
ZFIN|ZDB-GENE-040426-2058568 hacl1 "2-hydroxyacyl-CoA lyase 0.198 0.371 0.521 5.7e-124
UNIPROTKB|Q9UJ83578 HACL1 "2-hydroxyacyl-CoA lyase 0.205 0.378 0.557 5.2e-123
MGI|MGI:1929657581 Hacl1 "2-hydroxyacyl-CoA lyase 0.206 0.378 0.533 9.3e-120
UNIPROTKB|F1NYG7574 HACL1 "Uncharacterized protein 0.198 0.367 0.545 4.3e-117
UNIPROTKB|E2R9K1581 HACL1 "Uncharacterized protein 0.202 0.371 0.546 1.8e-78
UNIPROTKB|F1MVP8581 HACL1 "Uncharacterized protein 0.203 0.373 0.539 7.9e-78
RGD|619849581 Hacl1 "2-hydroxyacyl-CoA lyase 0.208 0.382 0.528 2.7e-75
UNIPROTKB|J9NS82763 HACL1 "Uncharacterized protein 0.202 0.283 0.546 7.8e-76
UNIPROTKB|E9PEN4518 HACL1 "2-hydroxyacyl-CoA lyase 0.171 0.353 0.518 1.9e-98
FB|FBgn0034488 CG11208 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 738 (264.8 bits), Expect = 2.9e-97, Sum P(2) = 2.9e-97
 Identities = 137/210 (65%), Positives = 170/210 (80%)

Query:   266 ELSANQVIAQALKFQGIEYVFGIVGIPVIELAMACQQEGIHYIGMRNEQAACYAAQAIGY 325
             E+ A Q+IA++LK QG+EYVFGI+GIPVIEL+MA Q  G+ YIGMRNEQAACYAAQAIGY
Sbjct:     3 EVEAVQIIAESLKQQGVEYVFGIIGIPVIELSMAFQAAGLKYIGMRNEQAACYAAQAIGY 62

Query:   326 LTKKPGVCLVVSGPGLLHTFGGMANAQINCWPMLVIGGSCAQDHEGIGGFQECPQVELAR 385
             LT KPGVCLVVSGPGLLH  GGMANAQ+NCWP++VIGG+  QDHEGIGGFQECPQVEL+R
Sbjct:    63 LTGKPGVCLVVSGPGLLHVTGGMANAQVNCWPLIVIGGATNQDHEGIGGFQECPQVELSR 122

Query:   386 PYCKYSARPPNIHLIGQHVEKAVRLSTFGKPGVSYLDFPANLLAQRINQSALVPTPKVLE 445
             PYCKY+ARP    LI  HVEKAVR +T+G+PGV+YLDFP N+L  +  ++++        
Sbjct:   123 PYCKYAARPATAALIPLHVEKAVRYATYGRPGVAYLDFPGNILQSKAQEASIYKALAHPA 182

Query:   446 PTLPWPGIAELKQASQLILEAKAPLVIIGK 475
             P L +P   ++ +A++L+ +AK PLVI+GK
Sbjct:   183 PPLAYPPHDDVIRAAKLLRQAKRPLVIVGK 212


GO:0008949 "oxalyl-CoA decarboxylase activity" evidence=ISS
GO:0000287 "magnesium ion binding" evidence=IEA
GO:0030976 "thiamine pyrophosphate binding" evidence=IEA
ZFIN|ZDB-GENE-040426-2058 hacl1 "2-hydroxyacyl-CoA lyase 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UJ83 HACL1 "2-hydroxyacyl-CoA lyase 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1929657 Hacl1 "2-hydroxyacyl-CoA lyase 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1NYG7 HACL1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E2R9K1 HACL1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1MVP8 HACL1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|619849 Hacl1 "2-hydroxyacyl-CoA lyase 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|J9NS82 HACL1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E9PEN4 HACL1 "2-hydroxyacyl-CoA lyase 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1065
PRK09259569 PRK09259, PRK09259, putative oxalyl-CoA decarboxyl 2e-93
TIGR03254554 TIGR03254, oxalate_oxc, oxalyl-CoA decarboxylase 1e-88
COG0028550 COG0028, IlvB, Thiamine pyrophosphate-requiring en 1e-84
cd07035155 cd07035, TPP_PYR_POX_like, Pyrimidine (PYR) bindin 1e-50
pfam02776172 pfam02776, TPP_enzyme_N, Thiamine pyrophosphate en 5e-49
cd07035155 cd07035, TPP_PYR_POX_like, Pyrimidine (PYR) bindin 3e-48
pfam02776172 pfam02776, TPP_enzyme_N, Thiamine pyrophosphate en 2e-44
PRK05858542 PRK05858, PRK05858, hypothetical protein; Provisio 2e-42
cd02004172 cd02004, TPP_BZL_OCoD_HPCL, Thiamine pyrophosphate 2e-42
COG0028550 COG0028, IlvB, Thiamine pyrophosphate-requiring en 1e-41
TIGR00118558 TIGR00118, acolac_lg, acetolactate synthase, large 1e-41
PRK08322547 PRK08322, PRK08322, acetolactate synthase; Reviewe 8e-40
pfam00205136 pfam00205, TPP_enzyme_M, Thiamine pyrophosphate en 2e-38
PRK08611576 PRK08611, PRK08611, pyruvate oxidase; Provisional 4e-37
PRK08979572 PRK08979, PRK08979, acetolactate synthase 3 cataly 5e-37
PRK09259569 PRK09259, PRK09259, putative oxalyl-CoA decarboxyl 6e-37
PRK07979574 PRK07979, PRK07979, acetolactate synthase 3 cataly 1e-36
PRK06725570 PRK06725, PRK06725, acetolactate synthase 3 cataly 2e-36
PRK08155564 PRK08155, PRK08155, acetolactate synthase catalyti 6e-35
TIGR03254554 TIGR03254, oxalate_oxc, oxalyl-CoA decarboxylase 1e-33
PRK06882574 PRK06882, PRK06882, acetolactate synthase 3 cataly 1e-33
PRK06965587 PRK06965, PRK06965, acetolactate synthase 3 cataly 2e-33
PRK08266542 PRK08266, PRK08266, hypothetical protein; Provisio 7e-33
PRK06048561 PRK06048, PRK06048, acetolactate synthase 3 cataly 8e-33
PRK06466574 PRK06466, PRK06466, acetolactate synthase 3 cataly 1e-32
CHL00099585 CHL00099, ilvB, acetohydroxyacid synthase large su 2e-32
PRK07282566 PRK07282, PRK07282, acetolactate synthase catalyti 3e-32
PLN02470585 PLN02470, PLN02470, acetolactate synthase 7e-32
PRK07789612 PRK07789, PRK07789, acetolactate synthase 1 cataly 1e-30
PRK09259569 PRK09259, PRK09259, putative oxalyl-CoA decarboxyl 2e-30
PRK06276586 PRK06276, PRK06276, acetolactate synthase catalyti 3e-30
PRK08527563 PRK08527, PRK08527, acetolactate synthase 3 cataly 2e-29
PRK06456572 PRK06456, PRK06456, acetolactate synthase catalyti 3e-29
PRK08199557 PRK08199, PRK08199, thiamine pyrophosphate protein 9e-28
TIGR03457579 TIGR03457, sulphoacet_xsc, sulfoacetaldehyde acety 1e-27
PRK09107595 PRK09107, PRK09107, acetolactate synthase 3 cataly 1e-27
TIGR02418539 TIGR02418, acolac_catab, acetolactate synthase, ca 2e-27
PRK08978548 PRK08978, PRK08978, acetolactate synthase 2 cataly 4e-27
PRK07524535 PRK07524, PRK07524, hypothetical protein; Provisio 5e-27
PRK07418616 PRK07418, PRK07418, acetolactate synthase 3 cataly 5e-27
TIGR03254554 TIGR03254, oxalate_oxc, oxalyl-CoA decarboxylase 2e-26
PRK06112578 PRK06112, PRK06112, acetolactate synthase catalyti 8e-26
PRK07710571 PRK07710, PRK07710, acetolactate synthase catalyti 1e-25
PRK08617552 PRK08617, PRK08617, acetolactate synthase; Reviewe 2e-25
PRK06154565 PRK06154, PRK06154, hypothetical protein; Provisio 6e-25
cd07039164 cd07039, TPP_PYR_POX, Pyrimidine (PYR) binding dom 7e-24
PRK07525588 PRK07525, PRK07525, sulfoacetaldehyde acetyltransf 1e-22
PRK06457549 PRK06457, PRK06457, pyruvate dehydrogenase; Provis 4e-22
cd07039164 cd07039, TPP_PYR_POX, Pyrimidine (PYR) binding dom 1e-21
TIGR02720575 TIGR02720, pyruv_oxi_spxB, pyruvate oxidase 1e-21
PRK05858542 PRK05858, PRK05858, hypothetical protein; Provisio 3e-21
pfam02775151 pfam02775, TPP_enzyme_C, Thiamine pyrophosphate en 7e-21
COG0028550 COG0028, IlvB, Thiamine pyrophosphate-requiring en 1e-20
PRK06466574 PRK06466, PRK06466, acetolactate synthase 3 cataly 1e-20
TIGR00118558 TIGR00118, acolac_lg, acetolactate synthase, large 3e-20
PRK08979572 PRK08979, PRK08979, acetolactate synthase 3 cataly 4e-20
TIGR02418539 TIGR02418, acolac_catab, acetolactate synthase, ca 4e-20
PRK06965587 PRK06965, PRK06965, acetolactate synthase 3 cataly 9e-20
PRK09124574 PRK09124, PRK09124, pyruvate dehydrogenase; Provis 2e-19
cd00568168 cd00568, TPP_enzymes, Thiamine pyrophosphate (TPP) 2e-19
PRK06882574 PRK06882, PRK06882, acetolactate synthase 3 cataly 1e-18
PRK07064544 PRK07064, PRK07064, hypothetical protein; Provisio 1e-18
PRK07979574 PRK07979, PRK07979, acetolactate synthase 3 cataly 3e-18
PRK08617552 PRK08617, PRK08617, acetolactate synthase; Reviewe 7e-18
PRK08322547 PRK08322, PRK08322, acetolactate synthase; Reviewe 9e-18
cd02004172 cd02004, TPP_BZL_OCoD_HPCL, Thiamine pyrophosphate 1e-17
PRK06725570 PRK06725, PRK06725, acetolactate synthase 3 cataly 1e-17
PRK09107595 PRK09107, PRK09107, acetolactate synthase 3 cataly 1e-17
PRK08327569 PRK08327, PRK08327, acetolactate synthase catalyti 3e-17
PRK05858542 PRK05858, PRK05858, hypothetical protein; Provisio 5e-17
COG3960592 COG3960, COG3960, Glyoxylate carboligase [General 1e-16
PRK06456572 PRK06456, PRK06456, acetolactate synthase catalyti 8e-16
COG3962617 COG3962, COG3962, Acetolactate synthase [Amino aci 1e-15
TIGR01504588 TIGR01504, glyox_carbo_lig, glyoxylate carboligase 1e-15
cd02015186 cd02015, TPP_AHAS, Thiamine pyrophosphate (TPP) fa 4e-15
PRK07282566 PRK07282, PRK07282, acetolactate synthase catalyti 6e-15
PRK07710571 PRK07710, PRK07710, acetolactate synthase catalyti 8e-15
PLN02470585 PLN02470, PLN02470, acetolactate synthase 2e-14
PRK08611576 PRK08611, PRK08611, pyruvate oxidase; Provisional 3e-14
PRK08527563 PRK08527, PRK08527, acetolactate synthase 3 cataly 5e-14
PRK08199557 PRK08199, PRK08199, thiamine pyrophosphate protein 6e-14
PRK08266542 PRK08266, PRK08266, hypothetical protein; Provisio 7e-14
PRK06048561 PRK06048, PRK06048, acetolactate synthase 3 cataly 7e-14
PRK06276586 PRK06276, PRK06276, acetolactate synthase catalyti 1e-13
PRK11269591 PRK11269, PRK11269, glyoxylate carboligase; Provis 2e-13
PRK07524535 PRK07524, PRK07524, hypothetical protein; Provisio 3e-13
PRK09259569 PRK09259, PRK09259, putative oxalyl-CoA decarboxyl 4e-13
TIGR03254554 TIGR03254, oxalate_oxc, oxalyl-CoA decarboxylase 4e-13
PRK06546578 PRK06546, PRK06546, pyruvate dehydrogenase; Provis 5e-13
cd02010177 cd02010, TPP_ALS, Thiamine pyrophosphate (TPP) fam 5e-13
TIGR03457579 TIGR03457, sulphoacet_xsc, sulfoacetaldehyde acety 3e-12
PRK08978548 PRK08978, PRK08978, acetolactate synthase 2 cataly 3e-12
CHL00099585 CHL00099, ilvB, acetohydroxyacid synthase large su 9e-12
PRK08155564 PRK08155, PRK08155, acetolactate synthase catalyti 1e-11
PRK07525588 PRK07525, PRK07525, sulfoacetaldehyde acetyltransf 1e-11
PRK08617552 PRK08617, PRK08617, acetolactate synthase; Reviewe 2e-11
cd02014178 cd02014, TPP_POX, Thiamine pyrophosphate (TPP) fam 2e-11
PRK08199557 PRK08199, PRK08199, thiamine pyrophosphate protein 4e-11
TIGR02418539 TIGR02418, acolac_catab, acetolactate synthase, ca 7e-11
PRK07418616 PRK07418, PRK07418, acetolactate synthase 3 cataly 1e-10
cd06586154 cd06586, TPP_enzyme_PYR, Pyrimidine (PYR) binding 2e-10
PRK07789612 PRK07789, PRK07789, acetolactate synthase 1 cataly 3e-10
TIGR00118558 TIGR00118, acolac_lg, acetolactate synthase, large 6e-10
PRK07418616 PRK07418, PRK07418, acetolactate synthase 3 cataly 7e-10
cd02013196 cd02013, TPP_Xsc_like, Thiamine pyrophosphate (TPP 9e-10
PRK06112578 PRK06112, PRK06112, acetolactate synthase catalyti 1e-09
PRK06457549 PRK06457, PRK06457, pyruvate dehydrogenase; Provis 2e-09
PRK07979574 PRK07979, PRK07979, acetolactate synthase 3 cataly 3e-09
PRK08266542 PRK08266, PRK08266, hypothetical protein; Provisio 3e-09
cd02005183 cd02005, TPP_PDC_IPDC, Thiamine pyrophosphate (TPP 3e-09
PRK06154565 PRK06154, PRK06154, hypothetical protein; Provisio 4e-09
cd02002178 cd02002, TPP_BFDC, Thiamine pyrophosphate (TPP) fa 4e-09
PRK08322547 PRK08322, PRK08322, acetolactate synthase; Reviewe 5e-09
TIGR02720575 TIGR02720, pyruv_oxi_spxB, pyruvate oxidase 5e-09
PRK06112578 PRK06112, PRK06112, acetolactate synthase catalyti 6e-09
PRK07525588 PRK07525, PRK07525, sulfoacetaldehyde acetyltransf 9e-09
cd06586154 cd06586, TPP_enzyme_PYR, Pyrimidine (PYR) binding 9e-09
PRK06882574 PRK06882, PRK06882, acetolactate synthase 3 cataly 1e-08
PRK06466574 PRK06466, PRK06466, acetolactate synthase 3 cataly 2e-08
PRK06546578 PRK06546, PRK06546, pyruvate dehydrogenase; Provis 2e-08
COG3961557 COG3961, COG3961, Pyruvate decarboxylase and relat 3e-08
PRK08527563 PRK08527, PRK08527, acetolactate synthase 3 cataly 6e-08
PRK06154565 PRK06154, PRK06154, hypothetical protein; Provisio 7e-08
PRK08978548 PRK08978, PRK08978, acetolactate synthase 2 cataly 8e-08
PRK09124574 PRK09124, PRK09124, pyruvate dehydrogenase; Provis 8e-08
PRK08155564 PRK08155, PRK08155, acetolactate synthase catalyti 1e-07
PRK08979572 PRK08979, PRK08979, acetolactate synthase 3 cataly 2e-07
PRK06276586 PRK06276, PRK06276, acetolactate synthase catalyti 2e-07
TIGR03457579 TIGR03457, sulphoacet_xsc, sulfoacetaldehyde acety 2e-07
CHL00099585 CHL00099, ilvB, acetohydroxyacid synthase large su 4e-07
PRK07524535 PRK07524, PRK07524, hypothetical protein; Provisio 4e-07
PRK07092530 PRK07092, PRK07092, benzoylformate decarboxylase; 7e-07
PRK06725570 PRK06725, PRK06725, acetolactate synthase 3 cataly 2e-06
PRK08611576 PRK08611, PRK08611, pyruvate oxidase; Provisional 3e-06
PRK06048561 PRK06048, PRK06048, acetolactate synthase 3 cataly 3e-06
COG3960592 COG3960, COG3960, Glyoxylate carboligase [General 3e-06
PRK07064544 PRK07064, PRK07064, hypothetical protein; Provisio 6e-06
PRK06965587 PRK06965, PRK06965, acetolactate synthase 3 cataly 1e-05
cd02006202 cd02006, TPP_Gcl, Thiamine pyrophosphate (TPP) fam 1e-05
PRK09107595 PRK09107, PRK09107, acetolactate synthase 3 cataly 2e-05
PLN02470585 PLN02470, PLN02470, acetolactate synthase 3e-05
TIGR01504588 TIGR01504, glyox_carbo_lig, glyoxylate carboligase 3e-05
PRK06456572 PRK06456, PRK06456, acetolactate synthase catalyti 4e-05
PRK08327569 PRK08327, PRK08327, acetolactate synthase catalyti 6e-05
PRK08273597 PRK08273, PRK08273, thiamine pyrophosphate protein 7e-05
PRK07710571 PRK07710, PRK07710, acetolactate synthase catalyti 8e-05
PRK07586514 PRK07586, PRK07586, hypothetical protein; Validate 8e-05
pfam02775151 pfam02775, TPP_enzyme_C, Thiamine pyrophosphate en 9e-05
COG3961557 COG3961, COG3961, Pyruvate decarboxylase and relat 1e-04
PRK08273597 PRK08273, PRK08273, thiamine pyrophosphate protein 1e-04
TIGR01504588 TIGR01504, glyox_carbo_lig, glyoxylate carboligase 2e-04
PRK12474518 PRK12474, PRK12474, hypothetical protein; Provisio 2e-04
COG0028550 COG0028, IlvB, Thiamine pyrophosphate-requiring en 3e-04
COG3960592 COG3960, COG3960, Glyoxylate carboligase [General 3e-04
PRK06457549 PRK06457, PRK06457, pyruvate dehydrogenase; Provis 4e-04
TIGR02720575 TIGR02720, pyruv_oxi_spxB, pyruvate oxidase 4e-04
PRK11269591 PRK11269, PRK11269, glyoxylate carboligase; Provis 4e-04
cd07038162 cd07038, TPP_PYR_PDC_IPDC_like, Pyrimidine (PYR) b 5e-04
cd07038162 cd07038, TPP_PYR_PDC_IPDC_like, Pyrimidine (PYR) b 5e-04
TIGR03394535 TIGR03394, indol_phenyl_DC, indolepyruvate/phenylp 6e-04
PRK07282566 PRK07282, PRK07282, acetolactate synthase catalyti 0.001
PRK07064544 PRK07064, PRK07064, hypothetical protein; Provisio 0.001
PRK06546578 PRK06546, PRK06546, pyruvate dehydrogenase; Provis 0.001
TIGR00173430 TIGR00173, menD, 2-succinyl-5-enolpyruvyl-6-hydrox 0.001
PRK08327569 PRK08327, PRK08327, acetolactate synthase catalyti 0.002
PRK12474518 PRK12474, PRK12474, hypothetical protein; Provisio 0.002
>gnl|CDD|236433 PRK09259, PRK09259, putative oxalyl-CoA decarboxylase; Validated Back     alignment and domain information
 Score =  308 bits (792), Expect = 2e-93
 Identities = 145/383 (37%), Positives = 216/383 (56%), Gaps = 43/383 (11%)

Query: 271 QVIAQALKFQGIEYVFGIVGIPVIELAMACQQEGIHYIGMRNEQAACYAAQAIGYLTKKP 330
            ++  ALK  GI+ ++G+VGIP+ +LA   Q EGI YIG R+EQ+A  AA A G+LT+KP
Sbjct: 14  HLVIDALKLNGIDTIYGVVGIPITDLARLAQAEGIRYIGFRHEQSAGNAAAAAGFLTQKP 73

Query: 331 GVCLVVSGPGLLHTFGGMANAQINCWPMLVIGGSCAQDHEGI----GGFQECPQVELARP 386
           GVCL VS PG L+    +ANA  NC+PM++I GS   + E +    G ++E  Q+  A+P
Sbjct: 74  GVCLTVSAPGFLNGLTALANATTNCFPMIMISGS--SEREIVDLQQGDYEELDQLNAAKP 131

Query: 387 YCKYSARPPNIHLIGQHVEKAVRLSTFGKPGVSYLDFPANLLAQRINQSALVPTPKVLEP 446
           +CK + R      IG  V +A+R +  G+PG  YLD PA +LAQ ++             
Sbjct: 132 FCKAAFRVNRAEDIGIGVARAIRTAVSGRPGGVYLDLPAKVLAQTMDADE---------- 181

Query: 447 TLPWPGIAELKQASQLILEAKAPLVIIGKVLEPTLPW-PGIAELKQASRLILEAKAPLVI 505
                              A   LV   KV++P     P    + +A  L+ +AK PL+I
Sbjct: 182 -------------------ALTSLV---KVVDPAPAQLPAPEAVDRALDLLKKAKRPLII 219

Query: 506 IGKGAAYSQAETELLSFVNSFNLPFLPTPMGKGVVPDAHPNCVSAARTHALQNADLVLLL 565
           +GKGAAY+QA+ ++  FV    +PFLP  M KG++PD HP   +AAR+ AL NAD+VLL+
Sbjct: 220 LGKGAAYAQADEQIREFVEKTGIPFLPMSMAKGLLPDTHPQSAAAARSLALANADVVLLV 279

Query: 566 GARLNWILHFGRAPRFKSNVKIIQVDLNAEELHNSVQAAVAIQSDVRLTVQQLKQMLSHT 625
           GARLNW+L  G+   + ++ K IQ+D+  +E+ ++   A  +  D+   +Q L   L+  
Sbjct: 280 GARLNWLLSHGKGKTWGADKKFIQIDIEPQEIDSNRPIAAPVVGDIGSVMQAL---LAGL 336

Query: 626 QRNWSFSATSPWWQELKLKCQTN 648
           ++N  F A + W   L  + + N
Sbjct: 337 KQNT-FKAPAEWLDALAERKEKN 358


Length = 569

>gnl|CDD|132298 TIGR03254, oxalate_oxc, oxalyl-CoA decarboxylase Back     alignment and domain information
>gnl|CDD|223107 COG0028, IlvB, Thiamine pyrophosphate-requiring enzymes [acetolactate synthase, pyruvate dehydrogenase (cytochrome), glyoxylate carboligase, phosphonopyruvate decarboxylase] [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|132918 cd07035, TPP_PYR_POX_like, Pyrimidine (PYR) binding domain of POX and related proteins Back     alignment and domain information
>gnl|CDD|217224 pfam02776, TPP_enzyme_N, Thiamine pyrophosphate enzyme, N-terminal TPP binding domain Back     alignment and domain information
>gnl|CDD|132918 cd07035, TPP_PYR_POX_like, Pyrimidine (PYR) binding domain of POX and related proteins Back     alignment and domain information
>gnl|CDD|217224 pfam02776, TPP_enzyme_N, Thiamine pyrophosphate enzyme, N-terminal TPP binding domain Back     alignment and domain information
>gnl|CDD|235629 PRK05858, PRK05858, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238962 cd02004, TPP_BZL_OCoD_HPCL, Thiamine pyrophosphate (TPP) family, BZL_OCoD_HPCL subfamily, TPP-binding module; composed of proteins similar to benzaldehyde lyase (BZL), oxalyl-CoA decarboxylase (OCoD) and 2-hydroxyphytanoyl-CoA lyase (2-HPCL) Back     alignment and domain information
>gnl|CDD|223107 COG0028, IlvB, Thiamine pyrophosphate-requiring enzymes [acetolactate synthase, pyruvate dehydrogenase (cytochrome), glyoxylate carboligase, phosphonopyruvate decarboxylase] [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|232833 TIGR00118, acolac_lg, acetolactate synthase, large subunit, biosynthetic type Back     alignment and domain information
>gnl|CDD|236239 PRK08322, PRK08322, acetolactate synthase; Reviewed Back     alignment and domain information
>gnl|CDD|215786 pfam00205, TPP_enzyme_M, Thiamine pyrophosphate enzyme, central domain Back     alignment and domain information
>gnl|CDD|181502 PRK08611, PRK08611, pyruvate oxidase; Provisional Back     alignment and domain information
>gnl|CDD|181602 PRK08979, PRK08979, acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|236433 PRK09259, PRK09259, putative oxalyl-CoA decarboxylase; Validated Back     alignment and domain information
>gnl|CDD|181185 PRK07979, PRK07979, acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|180672 PRK06725, PRK06725, acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|181257 PRK08155, PRK08155, acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|132298 TIGR03254, oxalate_oxc, oxalyl-CoA decarboxylase Back     alignment and domain information
>gnl|CDD|168717 PRK06882, PRK06882, acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|180780 PRK06965, PRK06965, acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|181337 PRK08266, PRK08266, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|180368 PRK06048, PRK06048, acetolactate synthase 3 catalytic subunit; Reviewed Back     alignment and domain information
>gnl|CDD|180578 PRK06466, PRK06466, acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|214363 CHL00099, ilvB, acetohydroxyacid synthase large subunit Back     alignment and domain information
>gnl|CDD|180919 PRK07282, PRK07282, acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>gnl|CDD|215261 PLN02470, PLN02470, acetolactate synthase Back     alignment and domain information
>gnl|CDD|236098 PRK07789, PRK07789, acetolactate synthase 1 catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|236433 PRK09259, PRK09259, putative oxalyl-CoA decarboxylase; Validated Back     alignment and domain information
>gnl|CDD|235766 PRK06276, PRK06276, acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>gnl|CDD|181458 PRK08527, PRK08527, acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|180569 PRK06456, PRK06456, acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>gnl|CDD|181285 PRK08199, PRK08199, thiamine pyrophosphate protein; Validated Back     alignment and domain information
>gnl|CDD|132497 TIGR03457, sulphoacet_xsc, sulfoacetaldehyde acetyltransferase Back     alignment and domain information
>gnl|CDD|236380 PRK09107, PRK09107, acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|131471 TIGR02418, acolac_catab, acetolactate synthase, catabolic Back     alignment and domain information
>gnl|CDD|181601 PRK08978, PRK08978, acetolactate synthase 2 catalytic subunit; Reviewed Back     alignment and domain information
>gnl|CDD|236041 PRK07524, PRK07524, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|236014 PRK07418, PRK07418, acetolactate synthase 3 catalytic subunit; Reviewed Back     alignment and domain information
>gnl|CDD|132298 TIGR03254, oxalate_oxc, oxalyl-CoA decarboxylase Back     alignment and domain information
>gnl|CDD|235700 PRK06112, PRK06112, acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|236076 PRK07710, PRK07710, acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>gnl|CDD|236312 PRK08617, PRK08617, acetolactate synthase; Reviewed Back     alignment and domain information
>gnl|CDD|235718 PRK06154, PRK06154, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|132922 cd07039, TPP_PYR_POX, Pyrimidine (PYR) binding domain of POX Back     alignment and domain information
>gnl|CDD|236042 PRK07525, PRK07525, sulfoacetaldehyde acetyltransferase; Validated Back     alignment and domain information
>gnl|CDD|180570 PRK06457, PRK06457, pyruvate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|132922 cd07039, TPP_PYR_POX, Pyrimidine (PYR) binding domain of POX Back     alignment and domain information
>gnl|CDD|213733 TIGR02720, pyruv_oxi_spxB, pyruvate oxidase Back     alignment and domain information
>gnl|CDD|235629 PRK05858, PRK05858, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|217223 pfam02775, TPP_enzyme_C, Thiamine pyrophosphate enzyme, C-terminal TPP binding domain Back     alignment and domain information
>gnl|CDD|223107 COG0028, IlvB, Thiamine pyrophosphate-requiring enzymes [acetolactate synthase, pyruvate dehydrogenase (cytochrome), glyoxylate carboligase, phosphonopyruvate decarboxylase] [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|180578 PRK06466, PRK06466, acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|232833 TIGR00118, acolac_lg, acetolactate synthase, large subunit, biosynthetic type Back     alignment and domain information
>gnl|CDD|181602 PRK08979, PRK08979, acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|131471 TIGR02418, acolac_catab, acetolactate synthase, catabolic Back     alignment and domain information
>gnl|CDD|180780 PRK06965, PRK06965, acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|181661 PRK09124, PRK09124, pyruvate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|238318 cd00568, TPP_enzymes, Thiamine pyrophosphate (TPP) enzyme family, TPP-binding module; found in many key metabolic enzymes which use TPP (also known as thiamine diphosphate) as a cofactor Back     alignment and domain information
>gnl|CDD|168717 PRK06882, PRK06882, acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|180820 PRK07064, PRK07064, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|181185 PRK07979, PRK07979, acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|236312 PRK08617, PRK08617, acetolactate synthase; Reviewed Back     alignment and domain information
>gnl|CDD|236239 PRK08322, PRK08322, acetolactate synthase; Reviewed Back     alignment and domain information
>gnl|CDD|238962 cd02004, TPP_BZL_OCoD_HPCL, Thiamine pyrophosphate (TPP) family, BZL_OCoD_HPCL subfamily, TPP-binding module; composed of proteins similar to benzaldehyde lyase (BZL), oxalyl-CoA decarboxylase (OCoD) and 2-hydroxyphytanoyl-CoA lyase (2-HPCL) Back     alignment and domain information
>gnl|CDD|180672 PRK06725, PRK06725, acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|236380 PRK09107, PRK09107, acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|236243 PRK08327, PRK08327, acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|235629 PRK05858, PRK05858, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|226469 COG3960, COG3960, Glyoxylate carboligase [General function prediction only] Back     alignment and domain information
>gnl|CDD|180569 PRK06456, PRK06456, acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>gnl|CDD|226471 COG3962, COG3962, Acetolactate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|213633 TIGR01504, glyox_carbo_lig, glyoxylate carboligase Back     alignment and domain information
>gnl|CDD|238973 cd02015, TPP_AHAS, Thiamine pyrophosphate (TPP) family, Acetohydroxyacid synthase (AHAS) subfamily, TPP-binding module; composed of proteins similar to the large catalytic subunit of AHAS Back     alignment and domain information
>gnl|CDD|180919 PRK07282, PRK07282, acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>gnl|CDD|236076 PRK07710, PRK07710, acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>gnl|CDD|215261 PLN02470, PLN02470, acetolactate synthase Back     alignment and domain information
>gnl|CDD|181502 PRK08611, PRK08611, pyruvate oxidase; Provisional Back     alignment and domain information
>gnl|CDD|181458 PRK08527, PRK08527, acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|181285 PRK08199, PRK08199, thiamine pyrophosphate protein; Validated Back     alignment and domain information
>gnl|CDD|181337 PRK08266, PRK08266, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|180368 PRK06048, PRK06048, acetolactate synthase 3 catalytic subunit; Reviewed Back     alignment and domain information
>gnl|CDD|235766 PRK06276, PRK06276, acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>gnl|CDD|183066 PRK11269, PRK11269, glyoxylate carboligase; Provisional Back     alignment and domain information
>gnl|CDD|236041 PRK07524, PRK07524, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|236433 PRK09259, PRK09259, putative oxalyl-CoA decarboxylase; Validated Back     alignment and domain information
>gnl|CDD|132298 TIGR03254, oxalate_oxc, oxalyl-CoA decarboxylase Back     alignment and domain information
>gnl|CDD|180614 PRK06546, PRK06546, pyruvate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|238968 cd02010, TPP_ALS, Thiamine pyrophosphate (TPP) family, Acetolactate synthase (ALS) subfamily, TPP-binding module; composed of proteins similar to Klebsiella pneumoniae ALS, a catabolic enzyme required for butanediol fermentation Back     alignment and domain information
>gnl|CDD|132497 TIGR03457, sulphoacet_xsc, sulfoacetaldehyde acetyltransferase Back     alignment and domain information
>gnl|CDD|181601 PRK08978, PRK08978, acetolactate synthase 2 catalytic subunit; Reviewed Back     alignment and domain information
>gnl|CDD|214363 CHL00099, ilvB, acetohydroxyacid synthase large subunit Back     alignment and domain information
>gnl|CDD|181257 PRK08155, PRK08155, acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|236042 PRK07525, PRK07525, sulfoacetaldehyde acetyltransferase; Validated Back     alignment and domain information
>gnl|CDD|236312 PRK08617, PRK08617, acetolactate synthase; Reviewed Back     alignment and domain information
>gnl|CDD|238972 cd02014, TPP_POX, Thiamine pyrophosphate (TPP) family, Pyruvate oxidase (POX) subfamily, TPP-binding module; composed of proteins similar to Lactobacillus plantarum POX, which plays a key role in controlling acetate production under aerobic conditions Back     alignment and domain information
>gnl|CDD|181285 PRK08199, PRK08199, thiamine pyrophosphate protein; Validated Back     alignment and domain information
>gnl|CDD|131471 TIGR02418, acolac_catab, acetolactate synthase, catabolic Back     alignment and domain information
>gnl|CDD|236014 PRK07418, PRK07418, acetolactate synthase 3 catalytic subunit; Reviewed Back     alignment and domain information
>gnl|CDD|132915 cd06586, TPP_enzyme_PYR, Pyrimidine (PYR) binding domain of thiamine pyrophosphate (TPP)-dependent enzymes Back     alignment and domain information
>gnl|CDD|236098 PRK07789, PRK07789, acetolactate synthase 1 catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|232833 TIGR00118, acolac_lg, acetolactate synthase, large subunit, biosynthetic type Back     alignment and domain information
>gnl|CDD|236014 PRK07418, PRK07418, acetolactate synthase 3 catalytic subunit; Reviewed Back     alignment and domain information
>gnl|CDD|238971 cd02013, TPP_Xsc_like, Thiamine pyrophosphate (TPP) family, Xsc-like subfamily, TPP-binding module; composed of proteins similar to Alcaligenes defragrans sulfoacetaldehyde acetyltransferase (Xsc) Back     alignment and domain information
>gnl|CDD|235700 PRK06112, PRK06112, acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|180570 PRK06457, PRK06457, pyruvate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181185 PRK07979, PRK07979, acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|181337 PRK08266, PRK08266, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238963 cd02005, TPP_PDC_IPDC, Thiamine pyrophosphate (TPP) family, PDC_IPDC subfamily, TPP-binding module; composed of proteins similar to pyruvate decarboxylase (PDC) and indolepyruvate decarboxylase (IPDC) Back     alignment and domain information
>gnl|CDD|235718 PRK06154, PRK06154, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238960 cd02002, TPP_BFDC, Thiamine pyrophosphate (TPP) family, BFDC subfamily, TPP-binding module; composed of proteins similar to Pseudomonas putida benzoylformate decarboxylase (BFDC) Back     alignment and domain information
>gnl|CDD|236239 PRK08322, PRK08322, acetolactate synthase; Reviewed Back     alignment and domain information
>gnl|CDD|213733 TIGR02720, pyruv_oxi_spxB, pyruvate oxidase Back     alignment and domain information
>gnl|CDD|235700 PRK06112, PRK06112, acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|236042 PRK07525, PRK07525, sulfoacetaldehyde acetyltransferase; Validated Back     alignment and domain information
>gnl|CDD|132915 cd06586, TPP_enzyme_PYR, Pyrimidine (PYR) binding domain of thiamine pyrophosphate (TPP)-dependent enzymes Back     alignment and domain information
>gnl|CDD|168717 PRK06882, PRK06882, acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|180578 PRK06466, PRK06466, acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|180614 PRK06546, PRK06546, pyruvate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|226470 COG3961, COG3961, Pyruvate decarboxylase and related thiamine pyrophosphate-requiring enzymes [Carbohydrate transport and metabolism / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|181458 PRK08527, PRK08527, acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|235718 PRK06154, PRK06154, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|181601 PRK08978, PRK08978, acetolactate synthase 2 catalytic subunit; Reviewed Back     alignment and domain information
>gnl|CDD|181661 PRK09124, PRK09124, pyruvate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181257 PRK08155, PRK08155, acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|181602 PRK08979, PRK08979, acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|235766 PRK06276, PRK06276, acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>gnl|CDD|132497 TIGR03457, sulphoacet_xsc, sulfoacetaldehyde acetyltransferase Back     alignment and domain information
>gnl|CDD|214363 CHL00099, ilvB, acetohydroxyacid synthase large subunit Back     alignment and domain information
>gnl|CDD|236041 PRK07524, PRK07524, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|235931 PRK07092, PRK07092, benzoylformate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|180672 PRK06725, PRK06725, acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|181502 PRK08611, PRK08611, pyruvate oxidase; Provisional Back     alignment and domain information
>gnl|CDD|180368 PRK06048, PRK06048, acetolactate synthase 3 catalytic subunit; Reviewed Back     alignment and domain information
>gnl|CDD|226469 COG3960, COG3960, Glyoxylate carboligase [General function prediction only] Back     alignment and domain information
>gnl|CDD|180820 PRK07064, PRK07064, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|180780 PRK06965, PRK06965, acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|238964 cd02006, TPP_Gcl, Thiamine pyrophosphate (TPP) family, Gcl subfamily, TPP-binding module; composed of proteins similar to Escherichia coli glyoxylate carboligase (Gcl) Back     alignment and domain information
>gnl|CDD|236380 PRK09107, PRK09107, acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|215261 PLN02470, PLN02470, acetolactate synthase Back     alignment and domain information
>gnl|CDD|213633 TIGR01504, glyox_carbo_lig, glyoxylate carboligase Back     alignment and domain information
>gnl|CDD|180569 PRK06456, PRK06456, acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>gnl|CDD|236243 PRK08327, PRK08327, acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|181344 PRK08273, PRK08273, thiamine pyrophosphate protein; Provisional Back     alignment and domain information
>gnl|CDD|236076 PRK07710, PRK07710, acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>gnl|CDD|236063 PRK07586, PRK07586, hypothetical protein; Validated Back     alignment and domain information
>gnl|CDD|217223 pfam02775, TPP_enzyme_C, Thiamine pyrophosphate enzyme, C-terminal TPP binding domain Back     alignment and domain information
>gnl|CDD|226470 COG3961, COG3961, Pyruvate decarboxylase and related thiamine pyrophosphate-requiring enzymes [Carbohydrate transport and metabolism / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|181344 PRK08273, PRK08273, thiamine pyrophosphate protein; Provisional Back     alignment and domain information
>gnl|CDD|213633 TIGR01504, glyox_carbo_lig, glyoxylate carboligase Back     alignment and domain information
>gnl|CDD|139002 PRK12474, PRK12474, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|223107 COG0028, IlvB, Thiamine pyrophosphate-requiring enzymes [acetolactate synthase, pyruvate dehydrogenase (cytochrome), glyoxylate carboligase, phosphonopyruvate decarboxylase] [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|226469 COG3960, COG3960, Glyoxylate carboligase [General function prediction only] Back     alignment and domain information
>gnl|CDD|180570 PRK06457, PRK06457, pyruvate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|213733 TIGR02720, pyruv_oxi_spxB, pyruvate oxidase Back     alignment and domain information
>gnl|CDD|183066 PRK11269, PRK11269, glyoxylate carboligase; Provisional Back     alignment and domain information
>gnl|CDD|132921 cd07038, TPP_PYR_PDC_IPDC_like, Pyrimidine (PYR) binding domain of pyruvate decarboxylase (PDC), indolepyruvate decarboxylase (IPDC) and related proteins Back     alignment and domain information
>gnl|CDD|132921 cd07038, TPP_PYR_PDC_IPDC_like, Pyrimidine (PYR) binding domain of pyruvate decarboxylase (PDC), indolepyruvate decarboxylase (IPDC) and related proteins Back     alignment and domain information
>gnl|CDD|132435 TIGR03394, indol_phenyl_DC, indolepyruvate/phenylpyruvate decarboxylase, Azospirillum family Back     alignment and domain information
>gnl|CDD|180919 PRK07282, PRK07282, acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>gnl|CDD|180820 PRK07064, PRK07064, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|180614 PRK06546, PRK06546, pyruvate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|232855 TIGR00173, menD, 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1- carboxylic-acid synthase Back     alignment and domain information
>gnl|CDD|236243 PRK08327, PRK08327, acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|139002 PRK12474, PRK12474, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1065
KOG1185|consensus571 100.0
COG0028550 IlvB Thiamine pyrophosphate-requiring enzymes [ace 100.0
PRK05858542 hypothetical protein; Provisional 100.0
PRK08978548 acetolactate synthase 2 catalytic subunit; Reviewe 100.0
PRK08979572 acetolactate synthase 3 catalytic subunit; Validat 100.0
TIGR01504588 glyox_carbo_lig glyoxylate carboligase. Glyoxylate 100.0
PRK11269591 glyoxylate carboligase; Provisional 100.0
PRK07979574 acetolactate synthase 3 catalytic subunit; Validat 100.0
PRK06466574 acetolactate synthase 3 catalytic subunit; Validat 100.0
TIGR03254554 oxalate_oxc oxalyl-CoA decarboxylase. In a number 100.0
PRK08322547 acetolactate synthase; Reviewed 100.0
PRK08617552 acetolactate synthase; Reviewed 100.0
PRK06965587 acetolactate synthase 3 catalytic subunit; Validat 100.0
PRK09107595 acetolactate synthase 3 catalytic subunit; Validat 100.0
PRK06048561 acetolactate synthase 3 catalytic subunit; Reviewe 100.0
PRK07789612 acetolactate synthase 1 catalytic subunit; Validat 100.0
PRK07710571 acetolactate synthase catalytic subunit; Reviewed 100.0
PRK08155564 acetolactate synthase catalytic subunit; Validated 100.0
PRK07282566 acetolactate synthase catalytic subunit; Reviewed 100.0
PRK06456572 acetolactate synthase catalytic subunit; Reviewed 100.0
PRK06725570 acetolactate synthase 3 catalytic subunit; Validat 100.0
PRK08199557 thiamine pyrophosphate protein; Validated 100.0
PRK09259569 putative oxalyl-CoA decarboxylase; Validated 100.0
PLN02470585 acetolactate synthase 100.0
PRK06882574 acetolactate synthase 3 catalytic subunit; Validat 100.0
PRK08527563 acetolactate synthase 3 catalytic subunit; Validat 100.0
PRK07418616 acetolactate synthase 3 catalytic subunit; Reviewe 100.0
TIGR03457579 sulphoacet_xsc sulfoacetaldehyde acetyltransferase 100.0
TIGR02418539 acolac_catab acetolactate synthase, catabolic. Ace 100.0
PRK08611576 pyruvate oxidase; Provisional 100.0
CHL00099585 ilvB acetohydroxyacid synthase large subunit 100.0
PRK08273597 thiamine pyrophosphate protein; Provisional 100.0
PRK06457549 pyruvate dehydrogenase; Provisional 100.0
TIGR00118558 acolac_lg acetolactate synthase, large subunit, bi 100.0
PRK09124574 pyruvate dehydrogenase; Provisional 100.0
PRK06276586 acetolactate synthase catalytic subunit; Reviewed 100.0
TIGR02720575 pyruv_oxi_spxB pyruvate oxidase. Members of this f 100.0
PRK07525588 sulfoacetaldehyde acetyltransferase; Validated 100.0
PRK06546578 pyruvate dehydrogenase; Provisional 100.0
PRK07524535 hypothetical protein; Provisional 100.0
PRK08266542 hypothetical protein; Provisional 100.0
PRK06112578 acetolactate synthase catalytic subunit; Validated 100.0
PRK06154565 hypothetical protein; Provisional 100.0
PRK07064544 hypothetical protein; Provisional 100.0
PRK08327569 acetolactate synthase catalytic subunit; Validated 100.0
PRK07092530 benzoylformate decarboxylase; Reviewed 100.0
PRK07586514 hypothetical protein; Validated 100.0
PLN02573578 pyruvate decarboxylase 100.0
PRK12474518 hypothetical protein; Provisional 100.0
TIGR03394535 indol_phenyl_DC indolepyruvate/phenylpyruvate deca 100.0
PRK07449568 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1 100.0
TIGR03393539 indolpyr_decarb indolepyruvate decarboxylase, Erwi 100.0
COG1165566 MenD 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-car 100.0
KOG4166|consensus675 100.0
PLN02980 1655 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi 100.0
COG3961557 Pyruvate decarboxylase and related thiamine pyroph 100.0
TIGR00173432 menD 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex 100.0
COG3962617 Acetolactate synthase [Amino acid transport and me 100.0
KOG1184|consensus561 100.0
COG3960592 Glyoxylate carboligase [General function predictio 100.0
COG0028550 IlvB Thiamine pyrophosphate-requiring enzymes [ace 100.0
KOG1185|consensus571 100.0
PRK07979574 acetolactate synthase 3 catalytic subunit; Validat 100.0
PRK08979572 acetolactate synthase 3 catalytic subunit; Validat 100.0
PRK07282566 acetolactate synthase catalytic subunit; Reviewed 100.0
PRK06466574 acetolactate synthase 3 catalytic subunit; Validat 100.0
TIGR01504588 glyox_carbo_lig glyoxylate carboligase. Glyoxylate 100.0
PRK06048561 acetolactate synthase 3 catalytic subunit; Reviewe 100.0
PRK08978548 acetolactate synthase 2 catalytic subunit; Reviewe 100.0
PRK12474518 hypothetical protein; Provisional 100.0
PRK09107595 acetolactate synthase 3 catalytic subunit; Validat 100.0
PRK06965587 acetolactate synthase 3 catalytic subunit; Validat 100.0
PRK07586514 hypothetical protein; Validated 100.0
PRK06725570 acetolactate synthase 3 catalytic subunit; Validat 100.0
PRK05858542 hypothetical protein; Provisional 100.0
PRK11269591 glyoxylate carboligase; Provisional 100.0
PRK08322547 acetolactate synthase; Reviewed 100.0
PRK07710571 acetolactate synthase catalytic subunit; Reviewed 100.0
PLN02470585 acetolactate synthase 100.0
PRK08617552 acetolactate synthase; Reviewed 100.0
PRK06456572 acetolactate synthase catalytic subunit; Reviewed 100.0
PRK07418616 acetolactate synthase 3 catalytic subunit; Reviewe 100.0
PRK08155564 acetolactate synthase catalytic subunit; Validated 100.0
TIGR02418539 acolac_catab acetolactate synthase, catabolic. Ace 100.0
PRK08527563 acetolactate synthase 3 catalytic subunit; Validat 100.0
KOG4166|consensus675 100.0
TIGR03457579 sulphoacet_xsc sulfoacetaldehyde acetyltransferase 100.0
PRK06457549 pyruvate dehydrogenase; Provisional 100.0
PRK08611576 pyruvate oxidase; Provisional 100.0
PRK09124574 pyruvate dehydrogenase; Provisional 100.0
PRK07789612 acetolactate synthase 1 catalytic subunit; Validat 100.0
PRK08273597 thiamine pyrophosphate protein; Provisional 100.0
PRK06882574 acetolactate synthase 3 catalytic subunit; Validat 100.0
CHL00099585 ilvB acetohydroxyacid synthase large subunit 100.0
TIGR03254554 oxalate_oxc oxalyl-CoA decarboxylase. In a number 100.0
PRK07524535 hypothetical protein; Provisional 100.0
PRK06546578 pyruvate dehydrogenase; Provisional 100.0
PRK06276586 acetolactate synthase catalytic subunit; Reviewed 100.0
PRK08199557 thiamine pyrophosphate protein; Validated 100.0
TIGR00118558 acolac_lg acetolactate synthase, large subunit, bi 100.0
PRK06154565 hypothetical protein; Provisional 100.0
TIGR02720575 pyruv_oxi_spxB pyruvate oxidase. Members of this f 100.0
PRK08266542 hypothetical protein; Provisional 100.0
PRK07525588 sulfoacetaldehyde acetyltransferase; Validated 100.0
PRK07064544 hypothetical protein; Provisional 100.0
PRK09259569 putative oxalyl-CoA decarboxylase; Validated 100.0
PLN02573578 pyruvate decarboxylase 100.0
PRK08327569 acetolactate synthase catalytic subunit; Validated 100.0
TIGR03394535 indol_phenyl_DC indolepyruvate/phenylpyruvate deca 100.0
PRK07092530 benzoylformate decarboxylase; Reviewed 100.0
PRK06112578 acetolactate synthase catalytic subunit; Validated 100.0
TIGR03393539 indolpyr_decarb indolepyruvate decarboxylase, Erwi 100.0
COG3961557 Pyruvate decarboxylase and related thiamine pyroph 100.0
PRK07449568 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1 100.0
cd07039164 TPP_PYR_POX Pyrimidine (PYR) binding domain of POX 100.0
KOG1184|consensus561 100.0
COG3960592 Glyoxylate carboligase [General function predictio 100.0
cd07037162 TPP_PYR_MenD Pyrimidine (PYR) binding domain of 2- 100.0
PLN02980 1655 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi 100.0
PF02776172 TPP_enzyme_N: Thiamine pyrophosphate enzyme, N-ter 100.0
cd07039164 TPP_PYR_POX Pyrimidine (PYR) binding domain of POX 100.0
cd07037162 TPP_PYR_MenD Pyrimidine (PYR) binding domain of 2- 100.0
cd07038162 TPP_PYR_PDC_IPDC_like Pyrimidine (PYR) binding dom 99.98
TIGR00173432 menD 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex 99.97
PF02776172 TPP_enzyme_N: Thiamine pyrophosphate enzyme, N-ter 99.97
cd07038162 TPP_PYR_PDC_IPDC_like Pyrimidine (PYR) binding dom 99.97
cd07035155 TPP_PYR_POX_like Pyrimidine (PYR) binding domain o 99.97
cd07035155 TPP_PYR_POX_like Pyrimidine (PYR) binding domain o 99.95
COG3962617 Acetolactate synthase [Amino acid transport and me 99.95
cd07034160 TPP_PYR_PFOR_IOR-alpha_like Pyrimidine (PYR) bindi 99.94
cd07034160 TPP_PYR_PFOR_IOR-alpha_like Pyrimidine (PYR) bindi 99.93
TIGR03297361 Ppyr-DeCO2ase phosphonopyruvate decarboxylase. Thi 99.92
cd06586154 TPP_enzyme_PYR Pyrimidine (PYR) binding domain of 99.91
cd06586154 TPP_enzyme_PYR Pyrimidine (PYR) binding domain of 99.9
TIGR03845157 sulfopyru_alph sulfopyruvate decarboxylase, alpha 99.87
TIGR03845157 sulfopyru_alph sulfopyruvate decarboxylase, alpha 99.87
cd02006202 TPP_Gcl Thiamine pyrophosphate (TPP) family, Gcl s 99.87
TIGR03297361 Ppyr-DeCO2ase phosphonopyruvate decarboxylase. Thi 99.86
cd02013196 TPP_Xsc_like Thiamine pyrophosphate (TPP) family, 99.86
cd02003205 TPP_IolD Thiamine pyrophosphate (TPP) family, IolD 99.85
COG1165566 MenD 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-car 99.84
cd02010177 TPP_ALS Thiamine pyrophosphate (TPP) family, Aceto 99.84
cd02015186 TPP_AHAS Thiamine pyrophosphate (TPP) family, Acet 99.83
TIGR03336595 IOR_alpha indolepyruvate ferredoxin oxidoreductase 99.83
PF00205137 TPP_enzyme_M: Thiamine pyrophosphate enzyme, centr 99.82
cd02004172 TPP_BZL_OCoD_HPCL Thiamine pyrophosphate (TPP) fam 99.82
cd02009175 TPP_SHCHC_synthase Thiamine pyrophosphate (TPP) fa 99.8
cd02014178 TPP_POX Thiamine pyrophosphate (TPP) family, Pyruv 99.8
cd02005183 TPP_PDC_IPDC Thiamine pyrophosphate (TPP) family, 99.79
cd02002178 TPP_BFDC Thiamine pyrophosphate (TPP) family, BFDC 99.76
PRK06163202 hypothetical protein; Provisional 99.75
cd02013196 TPP_Xsc_like Thiamine pyrophosphate (TPP) family, 99.73
cd02006202 TPP_Gcl Thiamine pyrophosphate (TPP) family, Gcl s 99.72
cd03375193 TPP_OGFOR Thiamine pyrophosphate (TPP family), 2-o 99.71
cd02015186 TPP_AHAS Thiamine pyrophosphate (TPP) family, Acet 99.69
cd02008178 TPP_IOR_alpha Thiamine pyrophosphate (TPP) family, 99.69
PF02775153 TPP_enzyme_C: Thiamine pyrophosphate enzyme, C-ter 99.69
cd02010177 TPP_ALS Thiamine pyrophosphate (TPP) family, Aceto 99.68
cd02001157 TPP_ComE_PpyrDC Thiamine pyrophosphate (TPP) famil 99.68
cd02004172 TPP_BZL_OCoD_HPCL Thiamine pyrophosphate (TPP) fam 99.68
cd03371188 TPP_PpyrDC Thiamine pyrophosphate (TPP) family, Pp 99.67
cd02003205 TPP_IolD Thiamine pyrophosphate (TPP) family, IolD 99.67
TIGR03336595 IOR_alpha indolepyruvate ferredoxin oxidoreductase 99.65
cd03376235 TPP_PFOR_porB_like Thiamine pyrophosphate (TPP fam 99.65
cd02018237 TPP_PFOR Thiamine pyrophosphate (TPP family), Pyru 99.64
cd03372179 TPP_ComE Thiamine pyrophosphate (TPP) family, ComE 99.63
cd00568168 TPP_enzymes Thiamine pyrophosphate (TPP) enzyme fa 99.63
TIGR03846181 sulfopy_beta sulfopyruvate decarboxylase, beta sub 99.62
cd02009175 TPP_SHCHC_synthase Thiamine pyrophosphate (TPP) fa 99.61
PRK11867286 2-oxoglutarate ferredoxin oxidoreductase subunit b 99.61
PF02775153 TPP_enzyme_C: Thiamine pyrophosphate enzyme, C-ter 99.61
PRK09628277 oorB 2-oxoglutarate-acceptor oxidoreductase subuni 99.6
cd02005183 TPP_PDC_IPDC Thiamine pyrophosphate (TPP) family, 99.58
cd02002178 TPP_BFDC Thiamine pyrophosphate (TPP) family, BFDC 99.58
PRK05778301 2-oxoglutarate ferredoxin oxidoreductase subunit b 99.57
PRK06163202 hypothetical protein; Provisional 99.57
cd02014178 TPP_POX Thiamine pyrophosphate (TPP) family, Pyruv 99.55
cd02001157 TPP_ComE_PpyrDC Thiamine pyrophosphate (TPP) famil 99.52
PRK11869280 2-oxoacid ferredoxin oxidoreductase subunit beta; 99.52
PRK11866279 2-oxoacid ferredoxin oxidoreductase subunit beta; 99.51
TIGR03846181 sulfopy_beta sulfopyruvate decarboxylase, beta sub 99.51
cd02008178 TPP_IOR_alpha Thiamine pyrophosphate (TPP) family, 99.51
cd03375193 TPP_OGFOR Thiamine pyrophosphate (TPP family), 2-o 99.49
cd03371188 TPP_PpyrDC Thiamine pyrophosphate (TPP) family, Pp 99.48
TIGR02177287 PorB_KorB 2-oxoacid:acceptor oxidoreductase, beta 99.46
cd00568168 TPP_enzymes Thiamine pyrophosphate (TPP) enzyme fa 99.41
cd03372179 TPP_ComE Thiamine pyrophosphate (TPP) family, ComE 99.38
cd03376235 TPP_PFOR_porB_like Thiamine pyrophosphate (TPP fam 99.36
PRK11867286 2-oxoglutarate ferredoxin oxidoreductase subunit b 99.33
PRK05778301 2-oxoglutarate ferredoxin oxidoreductase subunit b 99.32
cd02018237 TPP_PFOR Thiamine pyrophosphate (TPP family), Pyru 99.29
TIGR02177287 PorB_KorB 2-oxoacid:acceptor oxidoreductase, beta 99.29
PRK09628277 oorB 2-oxoglutarate-acceptor oxidoreductase subuni 99.28
PRK11869280 2-oxoacid ferredoxin oxidoreductase subunit beta; 99.24
PRK11866279 2-oxoacid ferredoxin oxidoreductase subunit beta; 99.23
cd02012255 TPP_TK Thiamine pyrophosphate (TPP) family, Transk 99.12
TIGR03181341 PDH_E1_alph_x pyruvate dehydrogenase E1 component, 99.08
cd02012255 TPP_TK Thiamine pyrophosphate (TPP) family, Transk 98.98
cd02000293 TPP_E1_PDC_ADC_BCADC Thiamine pyrophosphate (TPP) 98.98
cd02000293 TPP_E1_PDC_ADC_BCADC Thiamine pyrophosphate (TPP) 98.97
TIGR03182315 PDH_E1_alph_y pyruvate dehydrogenase E1 component, 98.89
TIGR03182315 PDH_E1_alph_y pyruvate dehydrogenase E1 component, 98.89
TIGR00315162 cdhB CO dehydrogenase/acetyl-CoA synthase complex, 98.87
PRK00945171 acetyl-CoA decarbonylase/synthase complex subunit 98.86
PRK05899624 transketolase; Reviewed 98.81
TIGR03181341 PDH_E1_alph_x pyruvate dehydrogenase E1 component, 98.81
CHL00149341 odpA pyruvate dehydrogenase E1 component alpha sub 98.78
PRK05899 624 transketolase; Reviewed 98.76
PRK05444580 1-deoxy-D-xylulose-5-phosphate synthase; Provision 98.75
CHL00149341 odpA pyruvate dehydrogenase E1 component alpha sub 98.71
PRK12571641 1-deoxy-D-xylulose-5-phosphate synthase; Provision 98.6
PLN02374433 pyruvate dehydrogenase (acetyl-transferring) 98.5
cd02007195 TPP_DXS Thiamine pyrophosphate (TPP) family, DXS s 98.47
PLN02374433 pyruvate dehydrogenase (acetyl-transferring) 98.35
PRK05444 580 1-deoxy-D-xylulose-5-phosphate synthase; Provision 98.32
cd02007195 TPP_DXS Thiamine pyrophosphate (TPP) family, DXS s 98.29
PRK11865299 pyruvate ferredoxin oxidoreductase subunit beta; P 98.15
TIGR00204617 dxs 1-deoxy-D-xylulose-5-phosphate synthase. DXP s 98.08
PLN02582677 1-deoxy-D-xylulose-5-phosphate synthase 98.05
PRK12753663 transketolase; Reviewed 98.05
COG4032172 Predicted thiamine-pyrophosphate-binding protein [ 98.04
PRK09627375 oorA 2-oxoglutarate-acceptor oxidoreductase subuni 98.01
PRK08659376 2-oxoglutarate ferredoxin oxidoreductase subunit a 98.0
PRK08659376 2-oxoglutarate ferredoxin oxidoreductase subunit a 98.0
COG4231640 Indolepyruvate ferredoxin oxidoreductase, alpha an 97.97
PTZ00089661 transketolase; Provisional 97.93
PRK11864300 2-ketoisovalerate ferredoxin oxidoreductase subuni 97.93
PLN02234641 1-deoxy-D-xylulose-5-phosphate synthase 97.91
PRK12315581 1-deoxy-D-xylulose-5-phosphate synthase; Provision 97.89
TIGR00232653 tktlase_bact transketolase, bacterial and yeast. T 97.82
PRK09627375 oorA 2-oxoglutarate-acceptor oxidoreductase subuni 97.82
COG1013294 PorB Pyruvate:ferredoxin oxidoreductase and relate 97.77
PRK07119352 2-ketoisovalerate ferredoxin reductase; Validated 97.75
TIGR03710562 OAFO_sf 2-oxoacid:acceptor oxidoreductase, alpha s 97.73
PRK08366390 vorA 2-ketoisovalerate ferredoxin oxidoreductase s 97.73
TIGR03710562 OAFO_sf 2-oxoacid:acceptor oxidoreductase, alpha s 97.72
PRK13030 1159 2-oxoacid ferredoxin oxidoreductase; Provisional 97.72
PRK07119352 2-ketoisovalerate ferredoxin reductase; Validated 97.71
PRK08367394 porA pyruvate ferredoxin oxidoreductase subunit al 97.69
PLN02790 654 transketolase 97.63
PRK09193 1165 indolepyruvate ferredoxin oxidoreductase; Validate 97.62
PRK11865299 pyruvate ferredoxin oxidoreductase subunit beta; P 97.6
PRK12315 581 1-deoxy-D-xylulose-5-phosphate synthase; Provision 97.59
PRK09622407 porA pyruvate flavodoxin oxidoreductase subunit al 97.59
PRK12571 641 1-deoxy-D-xylulose-5-phosphate synthase; Provision 97.58
PF01855230 POR_N: Pyruvate flavodoxin/ferredoxin oxidoreducta 97.57
COG4231640 Indolepyruvate ferredoxin oxidoreductase, alpha an 97.55
PLN02269362 Pyruvate dehydrogenase E1 component subunit alpha 97.5
PF01855230 POR_N: Pyruvate flavodoxin/ferredoxin oxidoreducta 97.48
PRK08366390 vorA 2-ketoisovalerate ferredoxin oxidoreductase s 97.47
COG4032172 Predicted thiamine-pyrophosphate-binding protein [ 97.45
PRK11864300 2-ketoisovalerate ferredoxin oxidoreductase subuni 97.41
PTZ00089 661 transketolase; Provisional 97.4
TIGR00232 653 tktlase_bact transketolase, bacterial and yeast. T 97.36
cd03377365 TPP_PFOR_PNO Thiamine pyrophosphate (TPP family), 97.35
PRK08367394 porA pyruvate ferredoxin oxidoreductase subunit al 97.34
PRK09622407 porA pyruvate flavodoxin oxidoreductase subunit al 97.34
PRK12754 663 transketolase; Reviewed 97.31
PF00456332 Transketolase_N: Transketolase, thiamine diphospha 97.29
PRK12753 663 transketolase; Reviewed 97.28
PLN02790654 transketolase 97.25
COG1880170 CdhB CO dehydrogenase/acetyl-CoA synthase epsilon 97.24
COG1154627 Dxs Deoxyxylulose-5-phosphate synthase [Coenzyme m 97.23
PRK12754663 transketolase; Reviewed 97.14
cd02017386 TPP_E1_EcPDC_like Thiamine pyrophosphate (TPP) fam 97.11
PRK13029 1186 2-oxoacid ferredoxin oxidoreductase; Provisional 97.0
COG0674365 PorA Pyruvate:ferredoxin oxidoreductase and relate 96.99
PLN02225701 1-deoxy-D-xylulose-5-phosphate synthase 96.93
COG1071358 AcoA Pyruvate/2-oxoglutarate dehydrogenase complex 96.84
COG3959243 Transketolase, N-terminal subunit [Carbohydrate tr 96.79
cd02016265 TPP_E1_OGDC_like Thiamine pyrophosphate (TPP) fami 96.76
PF00456332 Transketolase_N: Transketolase, thiamine diphospha 96.7
PF00676300 E1_dh: Dehydrogenase E1 component; InterPro: IPR00 96.52
cd02011227 TPP_PK Thiamine pyrophosphate (TPP) family, Phosph 96.48
KOG0523|consensus632 96.47
COG0674365 PorA Pyruvate:ferredoxin oxidoreductase and relate 96.44
TIGR03186889 AKGDH_not_PDH alpha-ketoglutarate dehydrogenase. S 96.39
PF00676300 E1_dh: Dehydrogenase E1 component; InterPro: IPR00 96.38
PRK13012896 2-oxoacid dehydrogenase subunit E1; Provisional 96.29
COG1071358 AcoA Pyruvate/2-oxoglutarate dehydrogenase complex 96.27
cd02017386 TPP_E1_EcPDC_like Thiamine pyrophosphate (TPP) fam 96.27
COG1013294 PorB Pyruvate:ferredoxin oxidoreductase and relate 96.22
TIGR00759885 aceE pyruvate dehydrogenase E1 component, homodime 96.07
PF13292270 DXP_synthase_N: 1-deoxy-D-xylulose-5-phosphate syn 96.03
PF13292270 DXP_synthase_N: 1-deoxy-D-xylulose-5-phosphate syn 96.02
TIGR00204 617 dxs 1-deoxy-D-xylulose-5-phosphate synthase. DXP s 95.96
KOG0523|consensus 632 95.94
COG1154 627 Dxs Deoxyxylulose-5-phosphate synthase [Coenzyme m 95.85
TIGR021761165 pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxid 95.79
COG0021663 TktA Transketolase [Carbohydrate transport and met 95.78
COG0021 663 TktA Transketolase [Carbohydrate transport and met 95.68
PLN02269362 Pyruvate dehydrogenase E1 component subunit alpha 95.66
COG3959243 Transketolase, N-terminal subunit [Carbohydrate tr 95.57
PRK09405891 aceE pyruvate dehydrogenase subunit E1; Reviewed 95.51
PRK05261785 putative phosphoketolase; Provisional 95.32
PF02552167 CO_dh: CO dehydrogenase beta subunit/acetyl-CoA sy 95.2
PLN02225 701 1-deoxy-D-xylulose-5-phosphate synthase 95.2
cd02011227 TPP_PK Thiamine pyrophosphate (TPP) family, Phosph 95.0
PLN02234 641 1-deoxy-D-xylulose-5-phosphate synthase 94.9
TIGR00239 929 2oxo_dh_E1 2-oxoglutarate dehydrogenase, E1 compon 94.71
cd02016265 TPP_E1_OGDC_like Thiamine pyrophosphate (TPP) fami 94.67
COG1029429 FwdB Formylmethanofuran dehydrogenase subunit B [E 94.46
PRK130301159 2-oxoacid ferredoxin oxidoreductase; Provisional 94.35
PLN02582 677 1-deoxy-D-xylulose-5-phosphate synthase 93.8
PRK09404 924 sucA 2-oxoglutarate dehydrogenase E1 component; Re 93.7
TIGR02176 1165 pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxid 93.7
PRK091931165 indolepyruvate ferredoxin oxidoreductase; Validate 93.31
cd03377365 TPP_PFOR_PNO Thiamine pyrophosphate (TPP family), 92.68
PRK130291186 2-oxoacid ferredoxin oxidoreductase; Provisional 92.56
cd01408235 SIRT1 SIRT1: Eukaryotic group (class1) which inclu 92.21
TIGR03186 889 AKGDH_not_PDH alpha-ketoglutarate dehydrogenase. S 92.0
cd07033156 TPP_PYR_DXS_TK_like Pyrimidine (PYR) binding domai 91.91
PRK13012 896 2-oxoacid dehydrogenase subunit E1; Provisional 91.88
PRK11916312 electron transfer flavoprotein subunit YdiR; Provi 91.84
PRK09404924 sucA 2-oxoglutarate dehydrogenase E1 component; Re 91.77
PRK03363313 fixB putative electron transfer flavoprotein FixB; 91.65
PRK05261 785 putative phosphoketolase; Provisional 91.26
KOG0225|consensus394 91.24
TIGR00759 885 aceE pyruvate dehydrogenase E1 component, homodime 90.98
PRK09444462 pntB pyridine nucleotide transhydrogenase; Provisi 90.95
TIGR00239929 2oxo_dh_E1 2-oxoglutarate dehydrogenase, E1 compon 90.86
PLN00022356 electron transfer flavoprotein subunit alpha; Prov 90.61
COG2025313 FixB Electron transfer flavoprotein, alpha subunit 90.59
PRK14138244 NAD-dependent deacetylase; Provisional 88.03
PRK09405 891 aceE pyruvate dehydrogenase subunit E1; Reviewed 87.99
cd02761415 MopB_FmdB-FwdB The MopB_FmdB-FwdB CD contains the 87.77
smart00861168 Transket_pyr Transketolase, pyrimidine binding dom 86.73
PF02779178 Transket_pyr: Transketolase, pyrimidine binding do 86.65
PF02233463 PNTB: NAD(P) transhydrogenase beta subunit; InterP 85.04
PRK00481242 NAD-dependent deacetylase; Provisional 84.15
cd07033156 TPP_PYR_DXS_TK_like Pyrimidine (PYR) binding domai 83.3
TIGR00300407 conserved hypothetical protein TIGR00300. All memb 82.98
KOG3954|consensus336 82.86
PRK05333285 NAD-dependent deacetylase; Provisional 82.82
cd01412224 SIRT5_Af1_CobB SIRT5_Af1_CobB: Eukaryotic, archaea 82.05
KOG0225|consensus394 81.22
COG1282463 PntB NAD/NADP transhydrogenase beta subunit [Energ 80.68
>KOG1185|consensus Back     alignment and domain information
Probab=100.00  E-value=1e-94  Score=800.29  Aligned_cols=560  Identities=44%  Similarity=0.740  Sum_probs=509.1

Q ss_pred             CcccccCccHHHHHHHHHHhcCceEEEeecCCchhhhHHHhhcCCceEEEccCCchHHHHHHHHHHHhCCCeEEEEeccc
Q psy14416        260 SEDYDEELSANQVIAQALKFQGIEYVFGIVGIPVIELAMACQQEGIHYIGMRNEQAACYAAQAIGYLTKKPGVCLVVSGP  339 (1065)
Q Consensus       260 ~~~~~~~~~~~~~l~~~L~~~GV~~vfg~pG~~~~~l~~al~~~~i~~i~~~~E~~A~~~A~g~ar~tgkpgv~~~tsGp  339 (1065)
                      +++..+.+.+++.+|+.|+++||+++||+-|.++.++..+.+..|||+|.||||++|+|+|++|+|+|||||||+++|||
T Consensus         7 ~~~~~~~~~g~~~vA~~Lk~~gVe~iFgiVGipV~el~~aaqalGIk~I~~RnEqaA~yAA~A~gyLt~kpGV~lVvsGP   86 (571)
T KOG1185|consen    7 KVDKASSRHGGELVAAVLKAQGVEYIFGIVGIPVIELAVAAQALGIKFIGTRNEQAAVYAASAYGYLTGKPGVLLVVSGP   86 (571)
T ss_pred             cccccccccHHHHHHHHHHHcCceEEEEEeccchHHHHHHHHHcCCeEeecccHHHHHHHHHHhhhhcCCCeEEEEecCC
Confidence            45667789999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccccccccccccccCcceEeecCCCccCCCCCCCCCccChhhhhcccccEEeeCCChhhHHHHHHHHHHHhhcCCCCEE
Q psy14416        340 GLLHTFGGMANAQINCWPMLVIGGSCAQDHEGIGGFQECPQVELARPYCKYSARPPNIHLIGQHVEKAVRLSTFGKPGVS  419 (1065)
Q Consensus       340 G~~N~~~av~eA~~~~vPLlvItg~~p~~~~g~ga~Q~idQ~~l~~~~~k~s~~l~~~~~i~~~i~~A~~~A~~~~~GPV  419 (1065)
                      |++|+++|++||+.+++|||+|.|..++.+.++|+||++||+.+++++||++.+++++++|+..+++|++.|++++|||+
T Consensus        87 Gl~hal~gv~NA~~n~wPll~IgGsa~~~~~~rGafQe~dQvel~rp~~K~~~r~~~~~~I~~~i~kA~r~a~~G~PG~~  166 (571)
T KOG1185|consen   87 GLTHALAGVANAQMNCWPLLLIGGSASTLLENRGAFQELDQVELFRPLCKFVARPTSVRDIPPTIRKAVRAAMSGRPGPV  166 (571)
T ss_pred             hHHHHHHHhhhhhhccCcEEEEecccchhhhcccccccccHHhhhhhhhhhccCCCChhhccHHHHHHHHHHhcCCCCce
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEecChhhhhhcc-ccccCC-CCCCCCCCCCCCCchhhhhHhHHHHHhhcccccccccccCCCCCCCCHHHHHHHHHHHH
Q psy14416        420 YLDFPANLLAQRI-NQSALV-PTPKVLEPTLPWPGIAELKQASQLILEAKAPLVIIGKVLEPTLPWPGIAELKQASRLIL  497 (1065)
Q Consensus       420 ~L~iP~Dv~~~~~-~~~~~~-~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~v~~~ae~L~  497 (1065)
                      |+++|.|+..... .+.+.. ..|..                               ..+.+..+.|+++++++++++|+
T Consensus       167 yvD~P~d~v~~~~~~e~~~~~~~p~~-------------------------------~~p~P~i~~p~~s~i~~av~llk  215 (571)
T KOG1185|consen  167 YVDLPADVVLPSKMVEKEIDVSEPQP-------------------------------PIPLPPIPGPPPSQIQKAVQLLK  215 (571)
T ss_pred             EEecccceeeeecccccccccCCCCC-------------------------------CCCCCCCCCCCHHHHHHHHHHHH
Confidence            9999999544332 222111 00000                               01223367789999999999999


Q ss_pred             hCCCcEEEEccCCCchhHHHHHHHHHhhcCCCEEecCCCCCCCCCCCcccccHHHHhhhcCCCEEEEeCCccccccccCC
Q psy14416        498 EAKAPLVIIGKGAAYSQAETELLSFVNSFNLPFLPTPMGKGVVPDAHPNCVSAARTHALQNADLVLLLGARLNWILHFGR  577 (1065)
Q Consensus       498 ~AkrPvIlvG~g~~~~~a~~~L~~LAe~lg~PV~tt~~gkg~v~~~hpl~lg~~~~~al~~aDlVI~iG~~~~~~~~~g~  577 (1065)
                      +||||+||+|.|+..+.+.++|++|.|++|+|++.++|+||++|++||++++.++..++++||+||++|++++|..++|.
T Consensus       216 ~AKrPLlvvGkgAa~~~ae~~l~~~Ve~~glPflptpMgKGll~d~hPl~v~~aRS~ALk~ADvvll~GarlnwiLhfG~  295 (571)
T KOG1185|consen  216 SAKRPLLVVGKGAAYAPAEDQLRKFVETTGLPFLPTPMGKGLLPDNHPLNVSSARSLALKKADVVLLAGARLNWILHFGL  295 (571)
T ss_pred             hcCCcEEEEecccccCccHHHHHHHHHhcCCCcccCcccccCCCCCCchhhhHHHHHHHhhCCEEEEecceeeEEEecCC
Confidence            99999999999999888899999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CccccCCCeEEEecCChhhcccc-cccceEEEcCHHHHHHHHHHhhcccccCCCCCCCchHHHHHHHHHHhhhhcccchh
Q psy14416        578 APRFKSNVKIIQVDLNAEELHNS-VQAAVAIQSDVRLTVQQLKQMLSHTQRNWSFSATSPWWQELKLKCQTNRQVKLPVI  656 (1065)
Q Consensus       578 ~~~~~~~~~iI~Vd~d~~~~~~~-~~~~~~I~~D~~~~L~~L~~~l~~~~~~~~~~~~~~W~~~~~~~~~~~~~~~~~~~  656 (1065)
                      +++|.++.++||||.+++.++.+ ..+++.|++|+..++.+|.+.+..  .+|......+|.+.+++..+++++..++..
T Consensus       296 ~Pk~~kd~KfIqvd~n~Eel~~n~~k~~v~i~gDig~~~~~L~e~l~~--~~~~~~~s~~w~k~Lrek~~~ne~~~~~~~  373 (571)
T KOG1185|consen  296 PPKWSKDVKFIQVDINPEELGNNFVKPDVAIQGDIGLFVLQLVEELQD--QPWTWGPSTDWVKELREKDKQNEAAVEEKA  373 (571)
T ss_pred             CCccCCCceEEEEeCCHHHHhcccCCCCceeeecHHHHHHHHHHHhcC--CCcccCCchhHHHHHHHHHHhhHHHHHHHh
Confidence            99999999999999999999987 789999999999999999999973  234445556999999999999888877652


Q ss_pred             hhhhccCCccCCCCccccccccccCccccccceEEeecccccccccccccccccccchhhhhhcCC-CcEEEEECCCCcC
Q psy14416        657 LVIVNNNGIYGGFDETTYASIVESGEVTTVLPVILVIVNNNGIYGGFDETTYASIVESGEVTTVLP-VILVIVNNNGIYG  735 (1065)
Q Consensus       657 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~pl~~~~~~~~~~~~~~~~~~~~~~~~~g~L~~~LP-~d~ilv~d~G~~~  735 (1065)
                                         .       ..+.|+     |   ++.+++           .|.+.|| .|.|+|+|+++  
T Consensus       374 -------------------~-------~~~~pL-----N---~~~~~~-----------~vre~L~~~d~ilVsEGan--  406 (571)
T KOG1185|consen  374 -------------------A-------KKSTPL-----N---YYQVLQ-----------TVRELLPNDDTILVSEGAN--  406 (571)
T ss_pred             -------------------h-------ccCCCC-----c---HHHHHH-----------HHHHhcCCCCcEEEecCCc--
Confidence                               1       456788     9   999999           9999999 89999999944  


Q ss_pred             cccccchhhhccccccccccceEEEEeeCCCcccCCCcccccccccccccccccceeeeeecCCCcccccCccccccccc
Q psy14416        736 GFDETTYASIVESGEVTTVLPVILVIVNNNGIYGGFDETTYASIVESGEVTTVLPVILVIVNNNGIYGGFDETTYASIVE  815 (1065)
Q Consensus       736 ~~~~~~~~~~~~~~~~~~~lp~~~~~~~n~g~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~  815 (1065)
                                                             |    |.+|  |++++...|       +.|.|.||      
T Consensus       407 ---------------------------------------t----mdig--r~~l~~~~P-------r~rLDaGt------  428 (571)
T KOG1185|consen  407 ---------------------------------------T----MDIG--RTLLPPRGP-------RRRLDAGT------  428 (571)
T ss_pred             ---------------------------------------c----hhhh--hhhccCCCc-------ccccCCcc------
Confidence                                                   4    6666  777888888       99999999      


Q ss_pred             ccceeeccceEEEEEcCCcccccccccccceeecccceeeecceEEEEeccccccccccchhhhhheeccccccccccEE
Q psy14416        816 SGEVTTVLPVILVIVNNNGIYGGFDETTYASIVESGEVTTVLPVILVIVNNNGIYGGFDETTYASIVESGEVTTVLPVIL  895 (1065)
Q Consensus       816 ~~~~~~~~~~~~~~~~n~Gi~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~g~~~~~~~~~~~~~~~~~~~~~~~  895 (1065)
                                          +|+|                            |+++||++  ||+++.        |+++
T Consensus       429 --------------------fgTM----------------------------GVG~Gfal--aaa~~~--------P~~~  450 (571)
T KOG1185|consen  429 --------------------FGTM----------------------------GVGLGFAL--AAALAA--------PDRK  450 (571)
T ss_pred             --------------------cccc----------------------------ccchhHHH--HHHhhC--------CCCe
Confidence                                6677                            99999999  999999        9999


Q ss_pred             EEEccCcccCCccccccceeccccceeeeccceEEEEeccccccCcchhhHHHhhccCccccCCCEEEEEEcCCcccCCC
Q psy14416        896 VIVNNNGIYGGFDETTYASIVESGEVTTVLPVILVIVNNNGIYGGFDETTYASIVESGEVTTVLPVILVIVNNNGIYGGF  975 (1065)
Q Consensus       896 v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~gd~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nn~g~~~~~  975 (1065)
                      |+                                 +|-||++| +|+.||+.|+     +|++||+++||+|||||| |+
T Consensus       451 V~---------------------------------~veGDsaF-GfSaME~ET~-----vR~~Lpvv~vV~NN~Giy-g~  490 (571)
T KOG1185|consen  451 VV---------------------------------CVEGDSAF-GFSAMELETF-----VRYKLPVVIVVGNNNGIY-GL  490 (571)
T ss_pred             EE---------------------------------EEecCccc-CcchhhHHHH-----HHhcCCeEEEEecCCccc-cc
Confidence            99                                 99999999 9999999999     999999999999999999 88


Q ss_pred             chhhHhHHhhcCCcccCCCCCCCCCCccHHHHHHHcCCCeEeeCCHHHHHHHHHHHHhcCCCCEEEEEEeCCCCCCCcch
Q psy14416        976 DEATYASIVESGEVTTVSPPTSLGPSLRYEKMMAVFGHDGYLCTTVPQIKQAMKKCLQTTTRPSLINILINPSADRKPQN 1055 (1065)
Q Consensus       976 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~l~~~~~~~~~~~~~~~li~~~~~~~~~~~~~~ 1055 (1065)
                      +...++++. ++..+...|++++.++.||+++|++||.+|+.|+|++||+.+++++.+.+++|+||||.|+|.+.||++.
T Consensus       491 d~~~~~~I~-e~~~~~~~p~~~l~~~~rY~~v~ka~G~kG~~v~t~~el~~~l~~a~q~~~~psvINVlI~p~~~rk~~~  569 (571)
T KOG1185|consen  491 DDDGWKQIS-EQDPTLDLPPTALLANTRYDKVAKAFGGKGYFVSTVEELLAALQQACQDTDKPSVINVLIGPTAFRKGQI  569 (571)
T ss_pred             CcccHHHHh-hcCcccCCCcccccccccHHHHHHHcCCCceeeCCHHHHHHHHHHHHhcCCCCeEEEEEecccccccccc
Confidence            888899988 7777888899999999999999999999999999999999999999999789999999999999999864


Q ss_pred             h
Q psy14416       1056 F 1056 (1065)
Q Consensus      1056 ~ 1056 (1065)
                      |
T Consensus       570 ~  570 (571)
T KOG1185|consen  570 F  570 (571)
T ss_pred             c
Confidence            4



>COG0028 IlvB Thiamine pyrophosphate-requiring enzymes [acetolactate synthase, pyruvate dehydrogenase (cytochrome), glyoxylate carboligase, phosphonopyruvate decarboxylase] [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK05858 hypothetical protein; Provisional Back     alignment and domain information
>PRK08978 acetolactate synthase 2 catalytic subunit; Reviewed Back     alignment and domain information
>PRK08979 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>TIGR01504 glyox_carbo_lig glyoxylate carboligase Back     alignment and domain information
>PRK11269 glyoxylate carboligase; Provisional Back     alignment and domain information
>PRK07979 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK06466 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>TIGR03254 oxalate_oxc oxalyl-CoA decarboxylase Back     alignment and domain information
>PRK08322 acetolactate synthase; Reviewed Back     alignment and domain information
>PRK08617 acetolactate synthase; Reviewed Back     alignment and domain information
>PRK06965 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK09107 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK06048 acetolactate synthase 3 catalytic subunit; Reviewed Back     alignment and domain information
>PRK07789 acetolactate synthase 1 catalytic subunit; Validated Back     alignment and domain information
>PRK07710 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PRK08155 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>PRK07282 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PRK06456 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PRK06725 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK08199 thiamine pyrophosphate protein; Validated Back     alignment and domain information
>PRK09259 putative oxalyl-CoA decarboxylase; Validated Back     alignment and domain information
>PLN02470 acetolactate synthase Back     alignment and domain information
>PRK06882 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK08527 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK07418 acetolactate synthase 3 catalytic subunit; Reviewed Back     alignment and domain information
>TIGR03457 sulphoacet_xsc sulfoacetaldehyde acetyltransferase Back     alignment and domain information
>TIGR02418 acolac_catab acetolactate synthase, catabolic Back     alignment and domain information
>PRK08611 pyruvate oxidase; Provisional Back     alignment and domain information
>CHL00099 ilvB acetohydroxyacid synthase large subunit Back     alignment and domain information
>PRK08273 thiamine pyrophosphate protein; Provisional Back     alignment and domain information
>PRK06457 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00118 acolac_lg acetolactate synthase, large subunit, biosynthetic type Back     alignment and domain information
>PRK09124 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>PRK06276 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>TIGR02720 pyruv_oxi_spxB pyruvate oxidase Back     alignment and domain information
>PRK07525 sulfoacetaldehyde acetyltransferase; Validated Back     alignment and domain information
>PRK06546 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>PRK07524 hypothetical protein; Provisional Back     alignment and domain information
>PRK08266 hypothetical protein; Provisional Back     alignment and domain information
>PRK06112 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>PRK06154 hypothetical protein; Provisional Back     alignment and domain information
>PRK07064 hypothetical protein; Provisional Back     alignment and domain information
>PRK08327 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>PRK07092 benzoylformate decarboxylase; Reviewed Back     alignment and domain information
>PRK07586 hypothetical protein; Validated Back     alignment and domain information
>PLN02573 pyruvate decarboxylase Back     alignment and domain information
>PRK12474 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03394 indol_phenyl_DC indolepyruvate/phenylpyruvate decarboxylase, Azospirillum family Back     alignment and domain information
>PRK07449 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase; Validated Back     alignment and domain information
>TIGR03393 indolpyr_decarb indolepyruvate decarboxylase, Erwinia family Back     alignment and domain information
>COG1165 MenD 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase [Coenzyme metabolism] Back     alignment and domain information
>KOG4166|consensus Back     alignment and domain information
>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding Back     alignment and domain information
>COG3961 Pyruvate decarboxylase and related thiamine pyrophosphate-requiring enzymes [Carbohydrate transport and metabolism / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>TIGR00173 menD 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase Back     alignment and domain information
>COG3962 Acetolactate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1184|consensus Back     alignment and domain information
>COG3960 Glyoxylate carboligase [General function prediction only] Back     alignment and domain information
>COG0028 IlvB Thiamine pyrophosphate-requiring enzymes [acetolactate synthase, pyruvate dehydrogenase (cytochrome), glyoxylate carboligase, phosphonopyruvate decarboxylase] [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>KOG1185|consensus Back     alignment and domain information
>PRK07979 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK08979 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK07282 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PRK06466 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>TIGR01504 glyox_carbo_lig glyoxylate carboligase Back     alignment and domain information
>PRK06048 acetolactate synthase 3 catalytic subunit; Reviewed Back     alignment and domain information
>PRK08978 acetolactate synthase 2 catalytic subunit; Reviewed Back     alignment and domain information
>PRK12474 hypothetical protein; Provisional Back     alignment and domain information
>PRK09107 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK06965 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK07586 hypothetical protein; Validated Back     alignment and domain information
>PRK06725 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK05858 hypothetical protein; Provisional Back     alignment and domain information
>PRK11269 glyoxylate carboligase; Provisional Back     alignment and domain information
>PRK08322 acetolactate synthase; Reviewed Back     alignment and domain information
>PRK07710 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PLN02470 acetolactate synthase Back     alignment and domain information
>PRK08617 acetolactate synthase; Reviewed Back     alignment and domain information
>PRK06456 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PRK07418 acetolactate synthase 3 catalytic subunit; Reviewed Back     alignment and domain information
>PRK08155 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>TIGR02418 acolac_catab acetolactate synthase, catabolic Back     alignment and domain information
>PRK08527 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>KOG4166|consensus Back     alignment and domain information
>TIGR03457 sulphoacet_xsc sulfoacetaldehyde acetyltransferase Back     alignment and domain information
>PRK06457 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>PRK08611 pyruvate oxidase; Provisional Back     alignment and domain information
>PRK09124 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>PRK07789 acetolactate synthase 1 catalytic subunit; Validated Back     alignment and domain information
>PRK08273 thiamine pyrophosphate protein; Provisional Back     alignment and domain information
>PRK06882 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>CHL00099 ilvB acetohydroxyacid synthase large subunit Back     alignment and domain information
>TIGR03254 oxalate_oxc oxalyl-CoA decarboxylase Back     alignment and domain information
>PRK07524 hypothetical protein; Provisional Back     alignment and domain information
>PRK06546 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>PRK06276 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PRK08199 thiamine pyrophosphate protein; Validated Back     alignment and domain information
>TIGR00118 acolac_lg acetolactate synthase, large subunit, biosynthetic type Back     alignment and domain information
>PRK06154 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02720 pyruv_oxi_spxB pyruvate oxidase Back     alignment and domain information
>PRK08266 hypothetical protein; Provisional Back     alignment and domain information
>PRK07525 sulfoacetaldehyde acetyltransferase; Validated Back     alignment and domain information
>PRK07064 hypothetical protein; Provisional Back     alignment and domain information
>PRK09259 putative oxalyl-CoA decarboxylase; Validated Back     alignment and domain information
>PLN02573 pyruvate decarboxylase Back     alignment and domain information
>PRK08327 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>TIGR03394 indol_phenyl_DC indolepyruvate/phenylpyruvate decarboxylase, Azospirillum family Back     alignment and domain information
>PRK07092 benzoylformate decarboxylase; Reviewed Back     alignment and domain information
>PRK06112 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>TIGR03393 indolpyr_decarb indolepyruvate decarboxylase, Erwinia family Back     alignment and domain information
>COG3961 Pyruvate decarboxylase and related thiamine pyrophosphate-requiring enzymes [Carbohydrate transport and metabolism / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>PRK07449 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase; Validated Back     alignment and domain information
>cd07039 TPP_PYR_POX Pyrimidine (PYR) binding domain of POX Back     alignment and domain information
>KOG1184|consensus Back     alignment and domain information
>COG3960 Glyoxylate carboligase [General function prediction only] Back     alignment and domain information
>cd07037 TPP_PYR_MenD Pyrimidine (PYR) binding domain of 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexadiene-1-carboxylate synthase (MenD) and related proteins Back     alignment and domain information
>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding Back     alignment and domain information
>PF02776 TPP_enzyme_N: Thiamine pyrophosphate enzyme, N-terminal TPP binding domain; InterPro: IPR012001 A number of enzymes require thiamine pyrophosphate (TPP) (vitamin B1) as a cofactor Back     alignment and domain information
>cd07039 TPP_PYR_POX Pyrimidine (PYR) binding domain of POX Back     alignment and domain information
>cd07037 TPP_PYR_MenD Pyrimidine (PYR) binding domain of 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexadiene-1-carboxylate synthase (MenD) and related proteins Back     alignment and domain information
>cd07038 TPP_PYR_PDC_IPDC_like Pyrimidine (PYR) binding domain of pyruvate decarboxylase (PDC), indolepyruvate decarboxylase (IPDC) and related proteins Back     alignment and domain information
>TIGR00173 menD 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase Back     alignment and domain information
>PF02776 TPP_enzyme_N: Thiamine pyrophosphate enzyme, N-terminal TPP binding domain; InterPro: IPR012001 A number of enzymes require thiamine pyrophosphate (TPP) (vitamin B1) as a cofactor Back     alignment and domain information
>cd07038 TPP_PYR_PDC_IPDC_like Pyrimidine (PYR) binding domain of pyruvate decarboxylase (PDC), indolepyruvate decarboxylase (IPDC) and related proteins Back     alignment and domain information
>cd07035 TPP_PYR_POX_like Pyrimidine (PYR) binding domain of POX and related proteins Back     alignment and domain information
>cd07035 TPP_PYR_POX_like Pyrimidine (PYR) binding domain of POX and related proteins Back     alignment and domain information
>COG3962 Acetolactate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>cd07034 TPP_PYR_PFOR_IOR-alpha_like Pyrimidine (PYR) binding domain of pyruvate ferredoxin oxidoreductase (PFOR), indolepyruvate ferredoxin oxidoreductase alpha subunit (IOR-alpha), and related proteins Back     alignment and domain information
>cd07034 TPP_PYR_PFOR_IOR-alpha_like Pyrimidine (PYR) binding domain of pyruvate ferredoxin oxidoreductase (PFOR), indolepyruvate ferredoxin oxidoreductase alpha subunit (IOR-alpha), and related proteins Back     alignment and domain information
>TIGR03297 Ppyr-DeCO2ase phosphonopyruvate decarboxylase Back     alignment and domain information
>cd06586 TPP_enzyme_PYR Pyrimidine (PYR) binding domain of thiamine pyrophosphate (TPP)-dependent enzymes Back     alignment and domain information
>cd06586 TPP_enzyme_PYR Pyrimidine (PYR) binding domain of thiamine pyrophosphate (TPP)-dependent enzymes Back     alignment and domain information
>TIGR03845 sulfopyru_alph sulfopyruvate decarboxylase, alpha subunit Back     alignment and domain information
>TIGR03845 sulfopyru_alph sulfopyruvate decarboxylase, alpha subunit Back     alignment and domain information
>cd02006 TPP_Gcl Thiamine pyrophosphate (TPP) family, Gcl subfamily, TPP-binding module; composed of proteins similar to Escherichia coli glyoxylate carboligase (Gcl) Back     alignment and domain information
>TIGR03297 Ppyr-DeCO2ase phosphonopyruvate decarboxylase Back     alignment and domain information
>cd02013 TPP_Xsc_like Thiamine pyrophosphate (TPP) family, Xsc-like subfamily, TPP-binding module; composed of proteins similar to Alcaligenes defragrans sulfoacetaldehyde acetyltransferase (Xsc) Back     alignment and domain information
>cd02003 TPP_IolD Thiamine pyrophosphate (TPP) family, IolD subfamily, TPP-binding module; composed of proteins similar to Rhizobium leguminosarum bv Back     alignment and domain information
>COG1165 MenD 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase [Coenzyme metabolism] Back     alignment and domain information
>cd02010 TPP_ALS Thiamine pyrophosphate (TPP) family, Acetolactate synthase (ALS) subfamily, TPP-binding module; composed of proteins similar to Klebsiella pneumoniae ALS, a catabolic enzyme required for butanediol fermentation Back     alignment and domain information
>cd02015 TPP_AHAS Thiamine pyrophosphate (TPP) family, Acetohydroxyacid synthase (AHAS) subfamily, TPP-binding module; composed of proteins similar to the large catalytic subunit of AHAS Back     alignment and domain information
>TIGR03336 IOR_alpha indolepyruvate ferredoxin oxidoreductase, alpha subunit Back     alignment and domain information
>PF00205 TPP_enzyme_M: Thiamine pyrophosphate enzyme, central domain; InterPro: IPR012000 A number of enzymes require thiamine pyrophosphate (TPP) (vitamin B1) as a cofactor Back     alignment and domain information
>cd02004 TPP_BZL_OCoD_HPCL Thiamine pyrophosphate (TPP) family, BZL_OCoD_HPCL subfamily, TPP-binding module; composed of proteins similar to benzaldehyde lyase (BZL), oxalyl-CoA decarboxylase (OCoD) and 2-hydroxyphytanoyl-CoA lyase (2-HPCL) Back     alignment and domain information
>cd02009 TPP_SHCHC_synthase Thiamine pyrophosphate (TPP) family, SHCHC synthase subfamily, TPP-binding module; composed of proteins similar to Escherichia coli 2-succinyl-6-hydroxyl-2,4-cyclohexadiene-1-carboxylic acid (SHCHC) synthase (also called MenD) Back     alignment and domain information
>cd02014 TPP_POX Thiamine pyrophosphate (TPP) family, Pyruvate oxidase (POX) subfamily, TPP-binding module; composed of proteins similar to Lactobacillus plantarum POX, which plays a key role in controlling acetate production under aerobic conditions Back     alignment and domain information
>cd02005 TPP_PDC_IPDC Thiamine pyrophosphate (TPP) family, PDC_IPDC subfamily, TPP-binding module; composed of proteins similar to pyruvate decarboxylase (PDC) and indolepyruvate decarboxylase (IPDC) Back     alignment and domain information
>cd02002 TPP_BFDC Thiamine pyrophosphate (TPP) family, BFDC subfamily, TPP-binding module; composed of proteins similar to Pseudomonas putida benzoylformate decarboxylase (BFDC) Back     alignment and domain information
>PRK06163 hypothetical protein; Provisional Back     alignment and domain information
>cd02013 TPP_Xsc_like Thiamine pyrophosphate (TPP) family, Xsc-like subfamily, TPP-binding module; composed of proteins similar to Alcaligenes defragrans sulfoacetaldehyde acetyltransferase (Xsc) Back     alignment and domain information
>cd02006 TPP_Gcl Thiamine pyrophosphate (TPP) family, Gcl subfamily, TPP-binding module; composed of proteins similar to Escherichia coli glyoxylate carboligase (Gcl) Back     alignment and domain information
>cd03375 TPP_OGFOR Thiamine pyrophosphate (TPP family), 2-oxoglutarate ferredoxin oxidoreductase (OGFOR) subfamily, TPP-binding module; OGFOR catalyzes the oxidative decarboxylation of 2-oxo-acids, with ferredoxin acting as an electron acceptor Back     alignment and domain information
>cd02015 TPP_AHAS Thiamine pyrophosphate (TPP) family, Acetohydroxyacid synthase (AHAS) subfamily, TPP-binding module; composed of proteins similar to the large catalytic subunit of AHAS Back     alignment and domain information
>cd02008 TPP_IOR_alpha Thiamine pyrophosphate (TPP) family, IOR-alpha subfamily, TPP-binding module; composed of proteins similar to indolepyruvate ferredoxin oxidoreductase (IOR) alpha subunit Back     alignment and domain information
>PF02775 TPP_enzyme_C: Thiamine pyrophosphate enzyme, C-terminal TPP binding domain; InterPro: IPR011766 A number of enzymes require thiamine pyrophosphate (TPP) (vitamin B1) as a cofactor Back     alignment and domain information
>cd02010 TPP_ALS Thiamine pyrophosphate (TPP) family, Acetolactate synthase (ALS) subfamily, TPP-binding module; composed of proteins similar to Klebsiella pneumoniae ALS, a catabolic enzyme required for butanediol fermentation Back     alignment and domain information
>cd02001 TPP_ComE_PpyrDC Thiamine pyrophosphate (TPP) family, ComE and PpyrDC subfamily, TPP-binding module; composed of proteins similar to sulfopyruvate decarboxylase beta subunit (ComE) and phosphonopyruvate decarboxylase (Ppyr decarboxylase) Back     alignment and domain information
>cd02004 TPP_BZL_OCoD_HPCL Thiamine pyrophosphate (TPP) family, BZL_OCoD_HPCL subfamily, TPP-binding module; composed of proteins similar to benzaldehyde lyase (BZL), oxalyl-CoA decarboxylase (OCoD) and 2-hydroxyphytanoyl-CoA lyase (2-HPCL) Back     alignment and domain information
>cd03371 TPP_PpyrDC Thiamine pyrophosphate (TPP) family, PpyrDC subfamily, TPP-binding module; composed of proteins similar to phosphonopyruvate decarboxylase (PpyrDC) proteins Back     alignment and domain information
>cd02003 TPP_IolD Thiamine pyrophosphate (TPP) family, IolD subfamily, TPP-binding module; composed of proteins similar to Rhizobium leguminosarum bv Back     alignment and domain information
>TIGR03336 IOR_alpha indolepyruvate ferredoxin oxidoreductase, alpha subunit Back     alignment and domain information
>cd03376 TPP_PFOR_porB_like Thiamine pyrophosphate (TPP family), PFOR porB-like subfamily, TPP-binding module; composed of proteins similar to the beta subunit (porB) of the Helicobacter pylori four-subunit pyruvate ferredoxin oxidoreductase (PFOR), which are also found in archaea and some hyperthermophilic bacteria Back     alignment and domain information
>cd02018 TPP_PFOR Thiamine pyrophosphate (TPP family), Pyruvate ferredoxin/flavodoxin oxidoreductase (PFOR) subfamily, TPP-binding module; PFOR catalyzes the oxidative decarboxylation of pyruvate to form acetyl-CoA, a crucial step in many metabolic pathways Back     alignment and domain information
>cd03372 TPP_ComE Thiamine pyrophosphate (TPP) family, ComE subfamily, TPP-binding module; composed of proteins similar to Methanococcus jannaschii sulfopyruvate decarboxylase beta subunit (ComE) Back     alignment and domain information
>cd00568 TPP_enzymes Thiamine pyrophosphate (TPP) enzyme family, TPP-binding module; found in many key metabolic enzymes which use TPP (also known as thiamine diphosphate) as a cofactor Back     alignment and domain information
>TIGR03846 sulfopy_beta sulfopyruvate decarboxylase, beta subunit Back     alignment and domain information
>cd02009 TPP_SHCHC_synthase Thiamine pyrophosphate (TPP) family, SHCHC synthase subfamily, TPP-binding module; composed of proteins similar to Escherichia coli 2-succinyl-6-hydroxyl-2,4-cyclohexadiene-1-carboxylic acid (SHCHC) synthase (also called MenD) Back     alignment and domain information
>PRK11867 2-oxoglutarate ferredoxin oxidoreductase subunit beta; Reviewed Back     alignment and domain information
>PF02775 TPP_enzyme_C: Thiamine pyrophosphate enzyme, C-terminal TPP binding domain; InterPro: IPR011766 A number of enzymes require thiamine pyrophosphate (TPP) (vitamin B1) as a cofactor Back     alignment and domain information
>PRK09628 oorB 2-oxoglutarate-acceptor oxidoreductase subunit OorB; Reviewed Back     alignment and domain information
>cd02005 TPP_PDC_IPDC Thiamine pyrophosphate (TPP) family, PDC_IPDC subfamily, TPP-binding module; composed of proteins similar to pyruvate decarboxylase (PDC) and indolepyruvate decarboxylase (IPDC) Back     alignment and domain information
>cd02002 TPP_BFDC Thiamine pyrophosphate (TPP) family, BFDC subfamily, TPP-binding module; composed of proteins similar to Pseudomonas putida benzoylformate decarboxylase (BFDC) Back     alignment and domain information
>PRK05778 2-oxoglutarate ferredoxin oxidoreductase subunit beta; Validated Back     alignment and domain information
>PRK06163 hypothetical protein; Provisional Back     alignment and domain information
>cd02014 TPP_POX Thiamine pyrophosphate (TPP) family, Pyruvate oxidase (POX) subfamily, TPP-binding module; composed of proteins similar to Lactobacillus plantarum POX, which plays a key role in controlling acetate production under aerobic conditions Back     alignment and domain information
>cd02001 TPP_ComE_PpyrDC Thiamine pyrophosphate (TPP) family, ComE and PpyrDC subfamily, TPP-binding module; composed of proteins similar to sulfopyruvate decarboxylase beta subunit (ComE) and phosphonopyruvate decarboxylase (Ppyr decarboxylase) Back     alignment and domain information
>PRK11869 2-oxoacid ferredoxin oxidoreductase subunit beta; Provisional Back     alignment and domain information
>PRK11866 2-oxoacid ferredoxin oxidoreductase subunit beta; Provisional Back     alignment and domain information
>TIGR03846 sulfopy_beta sulfopyruvate decarboxylase, beta subunit Back     alignment and domain information
>cd02008 TPP_IOR_alpha Thiamine pyrophosphate (TPP) family, IOR-alpha subfamily, TPP-binding module; composed of proteins similar to indolepyruvate ferredoxin oxidoreductase (IOR) alpha subunit Back     alignment and domain information
>cd03375 TPP_OGFOR Thiamine pyrophosphate (TPP family), 2-oxoglutarate ferredoxin oxidoreductase (OGFOR) subfamily, TPP-binding module; OGFOR catalyzes the oxidative decarboxylation of 2-oxo-acids, with ferredoxin acting as an electron acceptor Back     alignment and domain information
>cd03371 TPP_PpyrDC Thiamine pyrophosphate (TPP) family, PpyrDC subfamily, TPP-binding module; composed of proteins similar to phosphonopyruvate decarboxylase (PpyrDC) proteins Back     alignment and domain information
>TIGR02177 PorB_KorB 2-oxoacid:acceptor oxidoreductase, beta subunit, pyruvate/2-ketoisovalerate family Back     alignment and domain information
>cd00568 TPP_enzymes Thiamine pyrophosphate (TPP) enzyme family, TPP-binding module; found in many key metabolic enzymes which use TPP (also known as thiamine diphosphate) as a cofactor Back     alignment and domain information
>cd03372 TPP_ComE Thiamine pyrophosphate (TPP) family, ComE subfamily, TPP-binding module; composed of proteins similar to Methanococcus jannaschii sulfopyruvate decarboxylase beta subunit (ComE) Back     alignment and domain information
>cd03376 TPP_PFOR_porB_like Thiamine pyrophosphate (TPP family), PFOR porB-like subfamily, TPP-binding module; composed of proteins similar to the beta subunit (porB) of the Helicobacter pylori four-subunit pyruvate ferredoxin oxidoreductase (PFOR), which are also found in archaea and some hyperthermophilic bacteria Back     alignment and domain information
>PRK11867 2-oxoglutarate ferredoxin oxidoreductase subunit beta; Reviewed Back     alignment and domain information
>PRK05778 2-oxoglutarate ferredoxin oxidoreductase subunit beta; Validated Back     alignment and domain information
>cd02018 TPP_PFOR Thiamine pyrophosphate (TPP family), Pyruvate ferredoxin/flavodoxin oxidoreductase (PFOR) subfamily, TPP-binding module; PFOR catalyzes the oxidative decarboxylation of pyruvate to form acetyl-CoA, a crucial step in many metabolic pathways Back     alignment and domain information
>TIGR02177 PorB_KorB 2-oxoacid:acceptor oxidoreductase, beta subunit, pyruvate/2-ketoisovalerate family Back     alignment and domain information
>PRK09628 oorB 2-oxoglutarate-acceptor oxidoreductase subunit OorB; Reviewed Back     alignment and domain information
>PRK11869 2-oxoacid ferredoxin oxidoreductase subunit beta; Provisional Back     alignment and domain information
>PRK11866 2-oxoacid ferredoxin oxidoreductase subunit beta; Provisional Back     alignment and domain information
>cd02012 TPP_TK Thiamine pyrophosphate (TPP) family, Transketolase (TK) subfamily, TPP-binding module; TK catalyzes the transfer of a two-carbon unit from ketose phosphates to aldose phosphates Back     alignment and domain information
>TIGR03181 PDH_E1_alph_x pyruvate dehydrogenase E1 component, alpha subunit Back     alignment and domain information
>cd02012 TPP_TK Thiamine pyrophosphate (TPP) family, Transketolase (TK) subfamily, TPP-binding module; TK catalyzes the transfer of a two-carbon unit from ketose phosphates to aldose phosphates Back     alignment and domain information
>cd02000 TPP_E1_PDC_ADC_BCADC Thiamine pyrophosphate (TPP) family, E1 of PDC_ADC_BCADC subfamily, TPP-binding module; composed of proteins similar to the E1 components of the human pyruvate dehydrogenase complex (PDC), the acetoin dehydrogenase complex (ADC) and the branched chain alpha-keto acid dehydrogenase/2-oxoisovalerate dehydrogenase complex (BCADC) Back     alignment and domain information
>cd02000 TPP_E1_PDC_ADC_BCADC Thiamine pyrophosphate (TPP) family, E1 of PDC_ADC_BCADC subfamily, TPP-binding module; composed of proteins similar to the E1 components of the human pyruvate dehydrogenase complex (PDC), the acetoin dehydrogenase complex (ADC) and the branched chain alpha-keto acid dehydrogenase/2-oxoisovalerate dehydrogenase complex (BCADC) Back     alignment and domain information
>TIGR03182 PDH_E1_alph_y pyruvate dehydrogenase E1 component, alpha subunit Back     alignment and domain information
>TIGR03182 PDH_E1_alph_y pyruvate dehydrogenase E1 component, alpha subunit Back     alignment and domain information
>TIGR00315 cdhB CO dehydrogenase/acetyl-CoA synthase complex, epsilon subunit Back     alignment and domain information
>PRK00945 acetyl-CoA decarbonylase/synthase complex subunit epsilon; Provisional Back     alignment and domain information
>PRK05899 transketolase; Reviewed Back     alignment and domain information
>TIGR03181 PDH_E1_alph_x pyruvate dehydrogenase E1 component, alpha subunit Back     alignment and domain information
>CHL00149 odpA pyruvate dehydrogenase E1 component alpha subunit; Reviewed Back     alignment and domain information
>PRK05899 transketolase; Reviewed Back     alignment and domain information
>PRK05444 1-deoxy-D-xylulose-5-phosphate synthase; Provisional Back     alignment and domain information
>CHL00149 odpA pyruvate dehydrogenase E1 component alpha subunit; Reviewed Back     alignment and domain information
>PRK12571 1-deoxy-D-xylulose-5-phosphate synthase; Provisional Back     alignment and domain information
>PLN02374 pyruvate dehydrogenase (acetyl-transferring) Back     alignment and domain information
>cd02007 TPP_DXS Thiamine pyrophosphate (TPP) family, DXS subfamily, TPP-binding module; 1-Deoxy-D-xylulose-5-phosphate synthase (DXS) is a regulatory enzyme of the mevalonate-independent pathway involved in terpenoid biosynthesis Back     alignment and domain information
>PLN02374 pyruvate dehydrogenase (acetyl-transferring) Back     alignment and domain information
>PRK05444 1-deoxy-D-xylulose-5-phosphate synthase; Provisional Back     alignment and domain information
>cd02007 TPP_DXS Thiamine pyrophosphate (TPP) family, DXS subfamily, TPP-binding module; 1-Deoxy-D-xylulose-5-phosphate synthase (DXS) is a regulatory enzyme of the mevalonate-independent pathway involved in terpenoid biosynthesis Back     alignment and domain information
>PRK11865 pyruvate ferredoxin oxidoreductase subunit beta; Provisional Back     alignment and domain information
>TIGR00204 dxs 1-deoxy-D-xylulose-5-phosphate synthase Back     alignment and domain information
>PLN02582 1-deoxy-D-xylulose-5-phosphate synthase Back     alignment and domain information
>PRK12753 transketolase; Reviewed Back     alignment and domain information
>COG4032 Predicted thiamine-pyrophosphate-binding protein [General function prediction only] Back     alignment and domain information
>PRK09627 oorA 2-oxoglutarate-acceptor oxidoreductase subunit OorA; Reviewed Back     alignment and domain information
>PRK08659 2-oxoglutarate ferredoxin oxidoreductase subunit alpha; Validated Back     alignment and domain information
>PRK08659 2-oxoglutarate ferredoxin oxidoreductase subunit alpha; Validated Back     alignment and domain information
>COG4231 Indolepyruvate ferredoxin oxidoreductase, alpha and beta subunits [Energy production and conversion] Back     alignment and domain information
>PTZ00089 transketolase; Provisional Back     alignment and domain information
>PRK11864 2-ketoisovalerate ferredoxin oxidoreductase subunit beta; Provisional Back     alignment and domain information
>PLN02234 1-deoxy-D-xylulose-5-phosphate synthase Back     alignment and domain information
>PRK12315 1-deoxy-D-xylulose-5-phosphate synthase; Provisional Back     alignment and domain information
>TIGR00232 tktlase_bact transketolase, bacterial and yeast Back     alignment and domain information
>PRK09627 oorA 2-oxoglutarate-acceptor oxidoreductase subunit OorA; Reviewed Back     alignment and domain information
>COG1013 PorB Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, beta subunit [Energy production and conversion] Back     alignment and domain information
>PRK07119 2-ketoisovalerate ferredoxin reductase; Validated Back     alignment and domain information
>TIGR03710 OAFO_sf 2-oxoacid:acceptor oxidoreductase, alpha subunit Back     alignment and domain information
>PRK08366 vorA 2-ketoisovalerate ferredoxin oxidoreductase subunit alpha; Reviewed Back     alignment and domain information
>TIGR03710 OAFO_sf 2-oxoacid:acceptor oxidoreductase, alpha subunit Back     alignment and domain information
>PRK13030 2-oxoacid ferredoxin oxidoreductase; Provisional Back     alignment and domain information
>PRK07119 2-ketoisovalerate ferredoxin reductase; Validated Back     alignment and domain information
>PRK08367 porA pyruvate ferredoxin oxidoreductase subunit alpha; Reviewed Back     alignment and domain information
>PLN02790 transketolase Back     alignment and domain information
>PRK09193 indolepyruvate ferredoxin oxidoreductase; Validated Back     alignment and domain information
>PRK11865 pyruvate ferredoxin oxidoreductase subunit beta; Provisional Back     alignment and domain information
>PRK12315 1-deoxy-D-xylulose-5-phosphate synthase; Provisional Back     alignment and domain information
>PRK09622 porA pyruvate flavodoxin oxidoreductase subunit alpha; Reviewed Back     alignment and domain information
>PRK12571 1-deoxy-D-xylulose-5-phosphate synthase; Provisional Back     alignment and domain information
>PF01855 POR_N: Pyruvate flavodoxin/ferredoxin oxidoreductase, thiamine diP-bdg; InterPro: IPR002880 This family includes the N-terminal region of the pyruvate ferredoxin oxidoreductase, corresponding to the first two structural domains Back     alignment and domain information
>COG4231 Indolepyruvate ferredoxin oxidoreductase, alpha and beta subunits [Energy production and conversion] Back     alignment and domain information
>PLN02269 Pyruvate dehydrogenase E1 component subunit alpha Back     alignment and domain information
>PF01855 POR_N: Pyruvate flavodoxin/ferredoxin oxidoreductase, thiamine diP-bdg; InterPro: IPR002880 This family includes the N-terminal region of the pyruvate ferredoxin oxidoreductase, corresponding to the first two structural domains Back     alignment and domain information
>PRK08366 vorA 2-ketoisovalerate ferredoxin oxidoreductase subunit alpha; Reviewed Back     alignment and domain information
>COG4032 Predicted thiamine-pyrophosphate-binding protein [General function prediction only] Back     alignment and domain information
>PRK11864 2-ketoisovalerate ferredoxin oxidoreductase subunit beta; Provisional Back     alignment and domain information
>PTZ00089 transketolase; Provisional Back     alignment and domain information
>TIGR00232 tktlase_bact transketolase, bacterial and yeast Back     alignment and domain information
>cd03377 TPP_PFOR_PNO Thiamine pyrophosphate (TPP family), PFOR_PNO subfamily, TPP-binding module; composed of proteins similar to the single subunit pyruvate ferredoxin oxidoreductase (PFOR) of Desulfovibrio Africanus, present in bacteria and amitochondriate eukaryotes Back     alignment and domain information
>PRK08367 porA pyruvate ferredoxin oxidoreductase subunit alpha; Reviewed Back     alignment and domain information
>PRK09622 porA pyruvate flavodoxin oxidoreductase subunit alpha; Reviewed Back     alignment and domain information
>PRK12754 transketolase; Reviewed Back     alignment and domain information
>PF00456 Transketolase_N: Transketolase, thiamine diphosphate binding domain; InterPro: IPR005474 Transketolase 2 Back     alignment and domain information
>PRK12753 transketolase; Reviewed Back     alignment and domain information
>PLN02790 transketolase Back     alignment and domain information
>COG1880 CdhB CO dehydrogenase/acetyl-CoA synthase epsilon subunit [Energy production and conversion] Back     alignment and domain information
>COG1154 Dxs Deoxyxylulose-5-phosphate synthase [Coenzyme metabolism / Lipid metabolism] Back     alignment and domain information
>PRK12754 transketolase; Reviewed Back     alignment and domain information
>cd02017 TPP_E1_EcPDC_like Thiamine pyrophosphate (TPP) family, E1 of E Back     alignment and domain information
>PRK13029 2-oxoacid ferredoxin oxidoreductase; Provisional Back     alignment and domain information
>COG0674 PorA Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, alpha subunit [Energy production and conversion] Back     alignment and domain information
>PLN02225 1-deoxy-D-xylulose-5-phosphate synthase Back     alignment and domain information
>COG1071 AcoA Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, alpha subunit [Energy production and conversion] Back     alignment and domain information
>COG3959 Transketolase, N-terminal subunit [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd02016 TPP_E1_OGDC_like Thiamine pyrophosphate (TPP) family, E1 of OGDC-like subfamily, TPP-binding module; composed of proteins similar to the E1 component of the 2-oxoglutarate dehydrogenase multienzyme complex (OGDC) Back     alignment and domain information
>PF00456 Transketolase_N: Transketolase, thiamine diphosphate binding domain; InterPro: IPR005474 Transketolase 2 Back     alignment and domain information
>PF00676 E1_dh: Dehydrogenase E1 component; InterPro: IPR001017 This entry includes a number of dehydrogenases all of which use thiamine pyrophosphate as a cofactor and are members of a multienzyme complex Back     alignment and domain information
>cd02011 TPP_PK Thiamine pyrophosphate (TPP) family, Phosphoketolase (PK) subfamily, TPP-binding module; PK catalyzes the conversion of D-xylulose 5-phosphate and phosphate to acetyl phosphate, D-glyceraldehyde-3-phosphate and H2O Back     alignment and domain information
>KOG0523|consensus Back     alignment and domain information
>COG0674 PorA Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, alpha subunit [Energy production and conversion] Back     alignment and domain information
>TIGR03186 AKGDH_not_PDH alpha-ketoglutarate dehydrogenase Back     alignment and domain information
>PF00676 E1_dh: Dehydrogenase E1 component; InterPro: IPR001017 This entry includes a number of dehydrogenases all of which use thiamine pyrophosphate as a cofactor and are members of a multienzyme complex Back     alignment and domain information
>PRK13012 2-oxoacid dehydrogenase subunit E1; Provisional Back     alignment and domain information
>COG1071 AcoA Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, alpha subunit [Energy production and conversion] Back     alignment and domain information
>cd02017 TPP_E1_EcPDC_like Thiamine pyrophosphate (TPP) family, E1 of E Back     alignment and domain information
>COG1013 PorB Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, beta subunit [Energy production and conversion] Back     alignment and domain information
>TIGR00759 aceE pyruvate dehydrogenase E1 component, homodimeric type Back     alignment and domain information
>PF13292 DXP_synthase_N: 1-deoxy-D-xylulose-5-phosphate synthase; PDB: 2O1X_C 2O1S_B Back     alignment and domain information
>PF13292 DXP_synthase_N: 1-deoxy-D-xylulose-5-phosphate synthase; PDB: 2O1X_C 2O1S_B Back     alignment and domain information
>TIGR00204 dxs 1-deoxy-D-xylulose-5-phosphate synthase Back     alignment and domain information
>KOG0523|consensus Back     alignment and domain information
>COG1154 Dxs Deoxyxylulose-5-phosphate synthase [Coenzyme metabolism / Lipid metabolism] Back     alignment and domain information
>TIGR02176 pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxidoreductase, homodimeric Back     alignment and domain information
>COG0021 TktA Transketolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG0021 TktA Transketolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02269 Pyruvate dehydrogenase E1 component subunit alpha Back     alignment and domain information
>COG3959 Transketolase, N-terminal subunit [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK09405 aceE pyruvate dehydrogenase subunit E1; Reviewed Back     alignment and domain information
>PRK05261 putative phosphoketolase; Provisional Back     alignment and domain information
>PF02552 CO_dh: CO dehydrogenase beta subunit/acetyl-CoA synthase epsilon subunit; InterPro: IPR003704 Carbon monoxide dehydrogenase (Cdh) from Methanosarcina mazei (Methanosarcina frisia) Go1 is a Ni2+-, Fe2+-, and S2-containing alpha2beta2 heterotetramer [] Back     alignment and domain information
>PLN02225 1-deoxy-D-xylulose-5-phosphate synthase Back     alignment and domain information
>cd02011 TPP_PK Thiamine pyrophosphate (TPP) family, Phosphoketolase (PK) subfamily, TPP-binding module; PK catalyzes the conversion of D-xylulose 5-phosphate and phosphate to acetyl phosphate, D-glyceraldehyde-3-phosphate and H2O Back     alignment and domain information
>PLN02234 1-deoxy-D-xylulose-5-phosphate synthase Back     alignment and domain information
>TIGR00239 2oxo_dh_E1 2-oxoglutarate dehydrogenase, E1 component Back     alignment and domain information
>cd02016 TPP_E1_OGDC_like Thiamine pyrophosphate (TPP) family, E1 of OGDC-like subfamily, TPP-binding module; composed of proteins similar to the E1 component of the 2-oxoglutarate dehydrogenase multienzyme complex (OGDC) Back     alignment and domain information
>COG1029 FwdB Formylmethanofuran dehydrogenase subunit B [Energy production and conversion] Back     alignment and domain information
>PRK13030 2-oxoacid ferredoxin oxidoreductase; Provisional Back     alignment and domain information
>PLN02582 1-deoxy-D-xylulose-5-phosphate synthase Back     alignment and domain information
>PRK09404 sucA 2-oxoglutarate dehydrogenase E1 component; Reviewed Back     alignment and domain information
>TIGR02176 pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxidoreductase, homodimeric Back     alignment and domain information
>PRK09193 indolepyruvate ferredoxin oxidoreductase; Validated Back     alignment and domain information
>cd03377 TPP_PFOR_PNO Thiamine pyrophosphate (TPP family), PFOR_PNO subfamily, TPP-binding module; composed of proteins similar to the single subunit pyruvate ferredoxin oxidoreductase (PFOR) of Desulfovibrio Africanus, present in bacteria and amitochondriate eukaryotes Back     alignment and domain information
>PRK13029 2-oxoacid ferredoxin oxidoreductase; Provisional Back     alignment and domain information
>cd01408 SIRT1 SIRT1: Eukaryotic group (class1) which includes human sirtuins SIRT1-3 and yeast Hst1-4; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation Back     alignment and domain information
>TIGR03186 AKGDH_not_PDH alpha-ketoglutarate dehydrogenase Back     alignment and domain information
>cd07033 TPP_PYR_DXS_TK_like Pyrimidine (PYR) binding domain of 1-deoxy-D-xylulose-5-phosphate synthase (DXS), transketolase (TK), and related proteins Back     alignment and domain information
>PRK13012 2-oxoacid dehydrogenase subunit E1; Provisional Back     alignment and domain information
>PRK11916 electron transfer flavoprotein subunit YdiR; Provisional Back     alignment and domain information
>PRK09404 sucA 2-oxoglutarate dehydrogenase E1 component; Reviewed Back     alignment and domain information
>PRK03363 fixB putative electron transfer flavoprotein FixB; Provisional Back     alignment and domain information
>PRK05261 putative phosphoketolase; Provisional Back     alignment and domain information
>KOG0225|consensus Back     alignment and domain information
>TIGR00759 aceE pyruvate dehydrogenase E1 component, homodimeric type Back     alignment and domain information
>PRK09444 pntB pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>TIGR00239 2oxo_dh_E1 2-oxoglutarate dehydrogenase, E1 component Back     alignment and domain information
>PLN00022 electron transfer flavoprotein subunit alpha; Provisional Back     alignment and domain information
>COG2025 FixB Electron transfer flavoprotein, alpha subunit [Energy production and conversion] Back     alignment and domain information
>PRK14138 NAD-dependent deacetylase; Provisional Back     alignment and domain information
>PRK09405 aceE pyruvate dehydrogenase subunit E1; Reviewed Back     alignment and domain information
>cd02761 MopB_FmdB-FwdB The MopB_FmdB-FwdB CD contains the molybdenum/tungsten formylmethanofuran dehydrogenases, subunit B (FmdB/FwdB), and other related proteins Back     alignment and domain information
>smart00861 Transket_pyr Transketolase, pyrimidine binding domain Back     alignment and domain information
>PF02779 Transket_pyr: Transketolase, pyrimidine binding domain; InterPro: IPR005475 Transketolase 2 Back     alignment and domain information
>PF02233 PNTB: NAD(P) transhydrogenase beta subunit; InterPro: IPR012136 NAD(P) transhydrogenase catalyses the transfer of reducing equivalents between NAD(H) and NADP(H), coupled to the translocation of protons across a membrane [] Back     alignment and domain information
>PRK00481 NAD-dependent deacetylase; Provisional Back     alignment and domain information
>cd07033 TPP_PYR_DXS_TK_like Pyrimidine (PYR) binding domain of 1-deoxy-D-xylulose-5-phosphate synthase (DXS), transketolase (TK), and related proteins Back     alignment and domain information
>TIGR00300 conserved hypothetical protein TIGR00300 Back     alignment and domain information
>KOG3954|consensus Back     alignment and domain information
>PRK05333 NAD-dependent deacetylase; Provisional Back     alignment and domain information
>cd01412 SIRT5_Af1_CobB SIRT5_Af1_CobB: Eukaryotic, archaeal and prokaryotic group (class3) which includes human sirtuin SIRT5, Archaeoglobus fulgidus Sir2-Af1, and E Back     alignment and domain information
>KOG0225|consensus Back     alignment and domain information
>COG1282 PntB NAD/NADP transhydrogenase beta subunit [Energy production and conversion] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1065
2q27_A564 Crystal Structure Of Oxalyl-Coa Decarboxylase From 4e-57
2q27_A564 Crystal Structure Of Oxalyl-Coa Decarboxylase From 6e-04
2c31_A568 Crystal Structure Of Oxalyl-Coa Decarboxylase In Co 4e-57
1ybh_A590 Crystal Structure Of Arabidopsis Thaliana Acetohydr 3e-30
3e9y_A584 Arabidopsis Thaliana Acetohydroxyacid Synthase In C 3e-30
1n0h_A677 Crystal Structure Of Yeast Acetohydroxyacid Synthas 7e-21
1jsc_A630 Crystal Structure Of The Catalytic Subunit Of Yeast 8e-21
1pox_A585 The Refined Structures Of A Stabilized Mutant And O 9e-21
1pow_A585 The Refined Structures Of A Stabilized Mutant And O 2e-20
4fee_A603 High-Resolution Structure Of Pyruvate Oxidase In Co 2e-20
2ez4_A603 Pyruvate Oxidase Variant F479w Length = 603 2e-20
1y9d_A603 Pyruvate Oxidase Variant V265a From Lactobacillus P 2e-20
3iaf_A570 Structure Of Benzaldehyde Lyase A28s Mutant With Mo 5e-19
3d7k_A570 Crystal Structure Of Benzaldehyde Lyase In Complex 5e-19
2ag0_A563 Crystal Structure Of Benzaldehyde Lyase (Bal)- Nati 6e-19
2uz1_B563 1.65 Angstrom Structure Of Benzaldehyde Lyase Compl 6e-19
3iae_A570 Structure Of Benzaldehyde Lyase A28s Mutant With Be 7e-19
2ag1_A563 Crystal Structure Of Benzaldehyde Lyase (Bal)- Seme 1e-17
1ozg_A566 The Crystal Structure Of Klebsiella Pneumoniae Acet 8e-15
2pan_A616 Crystal Structure Of E. Coli Glyoxylate Carboligase 5e-14
3eya_A549 Structural Basis For Membrane Binding And Catalytic 6e-13
3ey9_A572 Structural Basis For Membrane Binding And Catalytic 7e-13
1v5e_A590 Crystal Structure Of Pyruvate Oxidase Containing Fa 5e-12
1v5f_A589 Crystal Structure Of Pyruvate Oxidase Complexed Wit 2e-11
2pgn_A589 The Crystal Structure Of Fad And Thdp-Dependent Cyc 2e-11
1upb_A573 Carboxyethylarginine Synthase From Streptomyces Cla 2e-08
1upa_A573 Carboxyethylarginine Synthase From Streptomyces Cla 6e-08
2vjy_A563 Pyruvate Decarboxylase From Kluyveromyces Lactis In 4e-07
1pyd_A556 Catalytic Centers In The Thiamin Diphosphate Depend 1e-04
1po7_A528 High Resolution Structure Of E28a Mutant Benzoylfor 1e-04
2vbf_A570 The Holostructure Of The Branched-Chain Keto Acid D 1e-04
1pvd_A555 Crystal Structure Of The Thiamin Diphosphate Depend 1e-04
1qpb_A563 Pyruvate Decarboyxlase From Yeast (Form B) Complexe 2e-04
2w93_A563 Crystal Structure Of The Saccharomyces Cerevisiae P 2e-04
2fwn_A528 Phosphorylation Of An Active Site Serine In A Thdp- 2e-04
2fn3_A528 High Resolution Structure Of S26a Mutant Of Benzoyl 2e-04
1pi3_A528 E28q Mutant Benzoylformate Decarboxylase From Pseud 3e-04
1yno_A527 High Resolution Structure Of Benzoylformate Decarbo 3e-04
3fzn_A534 Intermediate Analogue In Benzoylformate Decarboxyla 3e-04
1mcz_A528 Benzoylformate Decarboxylase From Pseudomonas Putid 3e-04
2v3w_A528 Crystal Structure Of The Benzoylformate Decarboxyla 3e-04
3f6b_X525 Crystal Structure Of Benzoylformate Decarboxylase I 3e-04
2vk1_A563 Crystal Structure Of The Saccharomyces Cerevisiae P 7e-04
2vk8_A563 Crystal Structure Of The Saccharomyces Cerevisiae P 8e-04
>pdb|2Q27|A Chain A, Crystal Structure Of Oxalyl-Coa Decarboxylase From Escherichia Coli Length = 564 Back     alignment and structure

Iteration: 1

Score = 220 bits (560), Expect = 4e-57, Method: Compositional matrix adjust. Identities = 143/386 (37%), Positives = 218/386 (56%), Gaps = 46/386 (11%) Query: 271 QVIAQALKFQGIEYVFGIVGIPVIELAMACQQEGIHYIGMRNEQAACYAAQAIGYLTKKP 330 +I +ALK I+ ++G+VGIPV ++A Q EGI YIG R+EQ+A YAA A G+LT+KP Sbjct: 12 HIIVEALKQNNIDTIYGVVGIPVTDMARHAQAEGIRYIGFRHEQSAGYAAAASGFLTQKP 71 Query: 331 GVCLVVSGPGLLHTFGGMANAQINCWPMLVIGGSCAQDHEGI--GGFQECPQVELARPYC 388 G+CL VS PG L+ +ANA +N +PM++I GS + + G ++E Q+ A+PY Sbjct: 72 GICLTVSAPGFLNGLTALANATVNGFPMIMISGSSDRAIVDLQQGDYEELDQMNAAKPYA 131 Query: 389 KYSARPPNIHLIGQHVEKAVRLSTFGKPGVSYLDFPANLLAQRINQS-ALVPTPKVLEPT 447 K + R +G + +A+R+S G+PG YLD PAN+LA + + AL KV P+ Sbjct: 132 KAAFRVNQPQDLGIALARAIRVSVSGRPGGVYLDLPANVLAATMEKDEALTTIVKVENPS 191 Query: 448 ---LPWPGIAELKQASQLILEAKAPLVIIGKVLEPTLPWPGIAELKQASRLILEAKAPLV 504 LP P + A L+ +A+ PL + Sbjct: 192 PALLPCP--KSVTSAISLLAKAERPL---------------------------------I 216 Query: 505 IIGKGAAYSQAETELLSFVNSFNLPFLPTPMGKGVVPDAHPNCVSAARTHALQNADLVLL 564 I+GKGAAYSQA+ +L F+ S +PFLP M KG++ D HP +AAR+ AL NAD+V+L Sbjct: 217 ILGKGAAYSQADEQLREFIESAQIPFLPMSMAKGILEDTHPLSAAAARSFALANADVVML 276 Query: 565 LGARLNWILHFGRAPRFKSNVKIIQVDLNAEELHNSVQAAVAIQSDVRLTVQQLKQMLSH 624 +GARLNW+L G+ + ++ + IQ+D+ +E+ ++ AV + D+ ++Q ML+ Sbjct: 277 VGARLNWLLAHGKKG-WAADTQFIQLDIEPQEIDSNRPIAVPVVGDIASSMQ---GMLAE 332 Query: 625 TQRNWSFSATSPWWQELKLKCQTNRQ 650 ++N +F+ W L + Q N Q Sbjct: 333 LKQN-TFTTPLVWRDILNIHKQQNAQ 357
>pdb|2Q27|A Chain A, Crystal Structure Of Oxalyl-Coa Decarboxylase From Escherichia Coli Length = 564 Back     alignment and structure
>pdb|2C31|A Chain A, Crystal Structure Of Oxalyl-Coa Decarboxylase In Complex With The Cofactor Derivative Thiamin-2-Thiazolone Diphosphate And Adenosine Diphosphate Length = 568 Back     alignment and structure
>pdb|1YBH|A Chain A, Crystal Structure Of Arabidopsis Thaliana Acetohydroxyacid Synthase In Complex With A Sulfonylurea Herbicide Chlorimuron Ethyl Length = 590 Back     alignment and structure
>pdb|3E9Y|A Chain A, Arabidopsis Thaliana Acetohydroxyacid Synthase In Complex With Monosulfuron Length = 584 Back     alignment and structure
>pdb|1N0H|A Chain A, Crystal Structure Of Yeast Acetohydroxyacid Synthase In Complex With A Sulfonylurea Herbicide, Chlorimuron Ethyl Length = 677 Back     alignment and structure
>pdb|1JSC|A Chain A, Crystal Structure Of The Catalytic Subunit Of Yeast Acetohydroxyacid Synthase: A Target For Herbicidal Inhibitors Length = 630 Back     alignment and structure
>pdb|1POX|A Chain A, The Refined Structures Of A Stabilized Mutant And Of Wild-Type Pyruvate Oxidase From Lactobacillus Plantarum Length = 585 Back     alignment and structure
>pdb|1POW|A Chain A, The Refined Structures Of A Stabilized Mutant And Of Wild-Type Pyruvate Oxidase From Lactobacillus Plantarum Length = 585 Back     alignment and structure
>pdb|4FEE|A Chain A, High-Resolution Structure Of Pyruvate Oxidase In Complex With Reaction Intermediate 2-Hydroxyethyl-Thiamin Diphosphate Carbanion-Enamine, Crystal B Length = 603 Back     alignment and structure
>pdb|2EZ4|A Chain A, Pyruvate Oxidase Variant F479w Length = 603 Back     alignment and structure
>pdb|1Y9D|A Chain A, Pyruvate Oxidase Variant V265a From Lactobacillus Plantarum Length = 603 Back     alignment and structure
>pdb|3IAF|A Chain A, Structure Of Benzaldehyde Lyase A28s Mutant With Monomethyl Benzoylphosphonate Length = 570 Back     alignment and structure
>pdb|3D7K|A Chain A, Crystal Structure Of Benzaldehyde Lyase In Complex With The Inhibitor Mbp Length = 570 Back     alignment and structure
>pdb|2AG0|A Chain A, Crystal Structure Of Benzaldehyde Lyase (Bal)- Native Length = 563 Back     alignment and structure
>pdb|2UZ1|B Chain B, 1.65 Angstrom Structure Of Benzaldehyde Lyase Complexed With 2-Methyl-2,4-Pentanediol Length = 563 Back     alignment and structure
>pdb|3IAE|A Chain A, Structure Of Benzaldehyde Lyase A28s Mutant With Benzoylphosphonate Length = 570 Back     alignment and structure
>pdb|2AG1|A Chain A, Crystal Structure Of Benzaldehyde Lyase (Bal)- Semet Length = 563 Back     alignment and structure
>pdb|1OZG|A Chain A, The Crystal Structure Of Klebsiella Pneumoniae Acetolactate Synthase With Enzyme-bound Cofactor And With An Unusual Intermediate Length = 566 Back     alignment and structure
>pdb|2PAN|A Chain A, Crystal Structure Of E. Coli Glyoxylate Carboligase Length = 616 Back     alignment and structure
>pdb|3EYA|A Chain A, Structural Basis For Membrane Binding And Catalytic Activation Of The Peripheral Membrane Enzyme Pyruvate Oxidase From Escherichia Coli Length = 549 Back     alignment and structure
>pdb|3EY9|A Chain A, Structural Basis For Membrane Binding And Catalytic Activation Of The Peripheral Membrane Enzyme Pyruvate Oxidase From Escherichia Coli Length = 572 Back     alignment and structure
>pdb|1V5E|A Chain A, Crystal Structure Of Pyruvate Oxidase Containing Fad, From Aerococcus Viridans Length = 590 Back     alignment and structure
>pdb|1V5F|A Chain A, Crystal Structure Of Pyruvate Oxidase Complexed With Fad And Tpp, From Aerococcus Viridans Length = 589 Back     alignment and structure
>pdb|2PGN|A Chain A, The Crystal Structure Of Fad And Thdp-Dependent Cyclohexane-1,2-Dione Hydrolase In Complex With Cyclohexane-1,2-Dione Length = 589 Back     alignment and structure
>pdb|1UPB|A Chain A, Carboxyethylarginine Synthase From Streptomyces Clavuligerus Length = 573 Back     alignment and structure
>pdb|1UPA|A Chain A, Carboxyethylarginine Synthase From Streptomyces Clavuligerus (semet Structure) Length = 573 Back     alignment and structure
>pdb|2VJY|A Chain A, Pyruvate Decarboxylase From Kluyveromyces Lactis In Complex With The Substrate Analogue Methyl Acetylphosphonate Length = 563 Back     alignment and structure
>pdb|1PYD|A Chain A, Catalytic Centers In The Thiamin Diphosphate Dependent Enzyme Pyruvate Decarboxylase At 2.4 Angstroms Resolution Length = 556 Back     alignment and structure
>pdb|1PO7|A Chain A, High Resolution Structure Of E28a Mutant Benzoylformate Decarboxylase From Pseudomonas Putida Length = 528 Back     alignment and structure
>pdb|2VBF|A Chain A, The Holostructure Of The Branched-Chain Keto Acid Decarboxylase (Kdca) From Lactococcus Lactis Length = 570 Back     alignment and structure
>pdb|1PVD|A Chain A, Crystal Structure Of The Thiamin Diphosphate Dependent Enzyme Pyruvate Decarboxylase From The Yeast Saccharomyces Cerevisiae At 2.3 Angstroms Resolution Length = 555 Back     alignment and structure
>pdb|1QPB|A Chain A, Pyruvate Decarboyxlase From Yeast (Form B) Complexed With Pyruvamide Length = 563 Back     alignment and structure
>pdb|2W93|A Chain A, Crystal Structure Of The Saccharomyces Cerevisiae Pyruvate Decarboxylase Variant E477q In Complex With The Surrogate Pyruvamide Length = 563 Back     alignment and structure
>pdb|2FWN|A Chain A, Phosphorylation Of An Active Site Serine In A Thdp- Dependent Enzyme By Phosphonate Inactivation Length = 528 Back     alignment and structure
>pdb|2FN3|A Chain A, High Resolution Structure Of S26a Mutant Of Benzoylformate Decarboxylase From Pseudomonas Putida Complexed With Thiamine Thiazolone Diphosphate Length = 528 Back     alignment and structure
>pdb|1PI3|A Chain A, E28q Mutant Benzoylformate Decarboxylase From Pseudomonas Putida Length = 528 Back     alignment and structure
>pdb|1YNO|A Chain A, High Resolution Structure Of Benzoylformate Decarboxylase From Pseudomonas Putida Complexed With Thiamine Thiazolone Diphosphate Length = 527 Back     alignment and structure
>pdb|3FZN|A Chain A, Intermediate Analogue In Benzoylformate Decarboxylase Length = 534 Back     alignment and structure
>pdb|1MCZ|A Chain A, Benzoylformate Decarboxylase From Pseudomonas Putida Complexed With An Inhibitor, R-Mandelate Length = 528 Back     alignment and structure
>pdb|2V3W|A Chain A, Crystal Structure Of The Benzoylformate Decarboxylase Variant L461a From Pseudomonas Putida Length = 528 Back     alignment and structure
>pdb|3F6B|X Chain X, Crystal Structure Of Benzoylformate Decarboxylase In Complex With The Pyridyl Inhibitor Paa Length = 525 Back     alignment and structure
>pdb|2VK1|A Chain A, Crystal Structure Of The Saccharomyces Cerevisiae Pyruvate Decarboxylase Variant D28a In Complex With Its Substrate Length = 563 Back     alignment and structure
>pdb|2VK8|A Chain A, Crystal Structure Of The Saccharomyces Cerevisiae Pyruvate Decarboxylase Variant E477q In Complex With Its Substrate Length = 563 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1065
2c31_A568 Oxalyl-COA decarboxylase; oxalate, thiamin diphosp 1e-94
2c31_A568 Oxalyl-COA decarboxylase; oxalate, thiamin diphosp 1e-42
2c31_A568 Oxalyl-COA decarboxylase; oxalate, thiamin diphosp 2e-25
2c31_A568 Oxalyl-COA decarboxylase; oxalate, thiamin diphosp 3e-08
2q28_A564 Oxalyl-COA decarboxylase; lyase, oxalate degradati 4e-80
2q28_A564 Oxalyl-COA decarboxylase; lyase, oxalate degradati 1e-36
2q28_A564 Oxalyl-COA decarboxylase; lyase, oxalate degradati 1e-23
2q28_A564 Oxalyl-COA decarboxylase; lyase, oxalate degradati 4e-08
4feg_A603 Pyruvate oxidase; carbanion, structure activity re 6e-52
4feg_A603 Pyruvate oxidase; carbanion, structure activity re 3e-22
4feg_A603 Pyruvate oxidase; carbanion, structure activity re 5e-11
1v5e_A590 Pyruvate oxidase; oxidoreductase, flavoprotein; HE 3e-51
1v5e_A590 Pyruvate oxidase; oxidoreductase, flavoprotein; HE 3e-22
1v5e_A590 Pyruvate oxidase; oxidoreductase, flavoprotein; HE 4e-12
3eya_A549 Pyruvate dehydrogenase [cytochrome]; pyruvate oxid 4e-49
3eya_A549 Pyruvate dehydrogenase [cytochrome]; pyruvate oxid 3e-20
3eya_A549 Pyruvate dehydrogenase [cytochrome]; pyruvate oxid 4e-11
2nxw_A565 Phenyl-3-pyruvate decarboxylase; thiamine pyrophos 3e-46
2nxw_A565 Phenyl-3-pyruvate decarboxylase; thiamine pyrophos 7e-18
2nxw_A565 Phenyl-3-pyruvate decarboxylase; thiamine pyrophos 4e-12
2nxw_A565 Phenyl-3-pyruvate decarboxylase; thiamine pyrophos 3e-04
2iht_A573 Carboxyethylarginine synthase; thiamin diphosphate 3e-45
2iht_A573 Carboxyethylarginine synthase; thiamin diphosphate 2e-16
2iht_A573 Carboxyethylarginine synthase; thiamin diphosphate 7e-11
1ozh_A566 ALS, acetolactate synthase, catabolic; acetohydrox 3e-44
1ozh_A566 ALS, acetolactate synthase, catabolic; acetohydrox 3e-20
1ozh_A566 ALS, acetolactate synthase, catabolic; acetohydrox 4e-14
2uz1_A563 Benzaldehyde lyase; thiamine diphosphate, thiamine 1e-43
2uz1_A563 Benzaldehyde lyase; thiamine diphosphate, thiamine 5e-16
2uz1_A563 Benzaldehyde lyase; thiamine diphosphate, thiamine 2e-11
1ybh_A590 Acetolactate synthase, chloroplast; acetohydroxyac 2e-43
1ybh_A590 Acetolactate synthase, chloroplast; acetohydroxyac 5e-17
1ybh_A590 Acetolactate synthase, chloroplast; acetohydroxyac 7e-10
2pgn_A589 Cyclohexane-1,2-dione hydrolase (CDH); three alpha 7e-43
2pgn_A589 Cyclohexane-1,2-dione hydrolase (CDH); three alpha 2e-16
2pgn_A589 Cyclohexane-1,2-dione hydrolase (CDH); three alpha 5e-11
2pan_A616 Glyoxylate carboligase; thiamin-diphosphate (THDP) 2e-42
2pan_A616 Glyoxylate carboligase; thiamin-diphosphate (THDP) 4e-16
2pan_A616 Glyoxylate carboligase; thiamin-diphosphate (THDP) 3e-11
1t9b_A677 Acetolactate synthase, mitochondrial; acetohydroxy 1e-37
1t9b_A677 Acetolactate synthase, mitochondrial; acetohydroxy 8e-16
1t9b_A677 Acetolactate synthase, mitochondrial; acetohydroxy 2e-10
1q6z_A528 BFD, BFDC, benzoylformate decarboxylase; lyase, ca 1e-37
1q6z_A528 BFD, BFDC, benzoylformate decarboxylase; lyase, ca 2e-15
1q6z_A528 BFD, BFDC, benzoylformate decarboxylase; lyase, ca 3e-10
2vbf_A570 Branched-chain alpha-ketoacid decarboxylase; KDCA, 6e-35
2vbf_A570 Branched-chain alpha-ketoacid decarboxylase; KDCA, 5e-13
2vbf_A570 Branched-chain alpha-ketoacid decarboxylase; KDCA, 5e-11
2vbf_A570 Branched-chain alpha-ketoacid decarboxylase; KDCA, 4e-04
2vbi_A566 Pyruvate decarboxylase; thiamine pyrophosphate, ly 7e-35
2vbi_A566 Pyruvate decarboxylase; thiamine pyrophosphate, ly 3e-10
2vbi_A566 Pyruvate decarboxylase; thiamine pyrophosphate, ly 4e-10
2wvg_A568 PDC, pyruvate decarboxylase; thiamine diphosphate, 3e-33
2wvg_A568 PDC, pyruvate decarboxylase; thiamine diphosphate, 3e-10
2wvg_A568 PDC, pyruvate decarboxylase; thiamine diphosphate, 1e-09
2vk8_A563 Pyruvate decarboxylase isozyme 1; asymmetric activ 3e-33
2vk8_A563 Pyruvate decarboxylase isozyme 1; asymmetric activ 4e-12
2vk8_A563 Pyruvate decarboxylase isozyme 1; asymmetric activ 3e-09
1ovm_A552 Indole-3-pyruvate decarboxylase; thiamine diphosph 6e-32
1ovm_A552 Indole-3-pyruvate decarboxylase; thiamine diphosph 2e-10
1ovm_A552 Indole-3-pyruvate decarboxylase; thiamine diphosph 6e-10
2x7j_A604 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene - 1e-29
2x7j_A604 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene - 3e-18
2x7j_A604 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene - 2e-09
3lq1_A578 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 9e-29
3lq1_A578 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 1e-17
3lq1_A578 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 7e-08
3hww_A556 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 2e-24
3hww_A556 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 1e-16
3hww_A556 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 3e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-08
3cf4_G170 Acetyl-COA decarboxylase/synthase epsilon subunit; 2e-06
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 9e-05
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 9e-05
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 9e-05
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 9e-05
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 9e-05
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 2e-04
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 6e-04
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 6e-04
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 6e-04
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 6e-04
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 6e-04
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 6e-04
>2c31_A Oxalyl-COA decarboxylase; oxalate, thiamin diphosphate, flavoprotein, lyase, thiamine pyrophosphate; HET: TZD ADP; 1.73A {Oxalobacter formigenes} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 2ji6_A* 2ji7_A* 2ji8_A* 2ji9_A* 2jib_A* Length = 568 Back     alignment and structure
 Score =  311 bits (799), Expect = 1e-94
 Identities = 129/396 (32%), Positives = 201/396 (50%), Gaps = 40/396 (10%)

Query: 259 MSEDYD-EELSANQVIAQALKFQGIEYVFGIVGIPVIELAMACQQEGIHYIGMRNEQAAC 317
           MS D + E      V+  ALK   I+ ++G+VGIP+  LA   Q +G  +   R+EQ A 
Sbjct: 1   MSNDDNVELTDGFHVLIDALKMNDIDTMYGVVGIPITNLARMWQDDGQRFYSFRHEQHAG 60

Query: 318 YAAQAIGYLTKKPGVCLVVSGPGLLHTFGGMANAQINCWPMLVIGGSCAQDHEGIGG--F 375
           YAA   GY+  KPGVCL VS PG L+    +A+A  NC+PM+++ GS  ++   +    +
Sbjct: 61  YAASIAGYIEGKPGVCLTVSAPGFLNGVTSLAHATTNCFPMILLSGSSEREIVDLQQGDY 120

Query: 376 QECPQVELARPYCKYSARPPNIHLIGQHVEKAVRLSTFGKPGVSYLDFPANLLAQRINQS 435
           +E  Q+ +ARP+CK S R  +I  I   + +AVR +  G+PG  Y+D PA L  Q I+  
Sbjct: 121 EEMDQMNVARPHCKASFRINSIKDIPIGIARAVRTAVSGRPGGVYVDLPAKLFGQTISVE 180

Query: 436 ALVPTPKVLEPTLPWPGIAELKQASQLILEAKAPLVIIGKVLEPTLPWPGIAELKQASRL 495
                  + +P  P P                                P    + +A+ L
Sbjct: 181 E--ANKLLFKPIDPAPAQI-----------------------------PAEDAIARAADL 209

Query: 496 ILEAKAPLVIIGKGAAYSQAETELLSFVNSFNLPFLPTPMGKGVVPDAHPNCVSAARTHA 555
           I  AK P++++GKGAAY+Q + E+ + V    +PFLP  M KG++PD HP   +A R  A
Sbjct: 210 IKNAKRPVIMLGKGAAYAQCDDEIRALVEETGIPFLPMGMAKGLLPDNHPQSAAATRAFA 269

Query: 556 LQNADLVLLLGARLNWILHFGRAPRFKSNV-KIIQVDLNAEELHNSVQAAVAIQSDVRLT 614
           L   D+ +L+GARLNW++  G+   +   + K +Q+D+ A E+ ++   A  +  D++  
Sbjct: 270 LAQCDVCVLIGARLNWLMQHGKGKTWGDELKKYVQIDIQANEMDSNQPIAAPVVGDIKSA 329

Query: 615 VQQLKQMLSHTQRNWSFSATSPWWQELKLKCQTNRQ 650
           V  L++ L    +     A + W   LK K   N+ 
Sbjct: 330 VSLLRKALKGAPK-----ADAEWTGALKAKVDGNKA 360


>2c31_A Oxalyl-COA decarboxylase; oxalate, thiamin diphosphate, flavoprotein, lyase, thiamine pyrophosphate; HET: TZD ADP; 1.73A {Oxalobacter formigenes} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 2ji6_A* 2ji7_A* 2ji8_A* 2ji9_A* 2jib_A* Length = 568 Back     alignment and structure
>2c31_A Oxalyl-COA decarboxylase; oxalate, thiamin diphosphate, flavoprotein, lyase, thiamine pyrophosphate; HET: TZD ADP; 1.73A {Oxalobacter formigenes} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 2ji6_A* 2ji7_A* 2ji8_A* 2ji9_A* 2jib_A* Length = 568 Back     alignment and structure
>2c31_A Oxalyl-COA decarboxylase; oxalate, thiamin diphosphate, flavoprotein, lyase, thiamine pyrophosphate; HET: TZD ADP; 1.73A {Oxalobacter formigenes} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 2ji6_A* 2ji7_A* 2ji8_A* 2ji9_A* 2jib_A* Length = 568 Back     alignment and structure
>2q28_A Oxalyl-COA decarboxylase; lyase, oxalate degradation, thiami diphosphate, lyase; HET: TPP ADP MES; 1.74A {Escherichia coli} PDB: 2q27_A* 2q29_A* Length = 564 Back     alignment and structure
>2q28_A Oxalyl-COA decarboxylase; lyase, oxalate degradation, thiami diphosphate, lyase; HET: TPP ADP MES; 1.74A {Escherichia coli} PDB: 2q27_A* 2q29_A* Length = 564 Back     alignment and structure
>2q28_A Oxalyl-COA decarboxylase; lyase, oxalate degradation, thiami diphosphate, lyase; HET: TPP ADP MES; 1.74A {Escherichia coli} PDB: 2q27_A* 2q29_A* Length = 564 Back     alignment and structure
>2q28_A Oxalyl-COA decarboxylase; lyase, oxalate degradation, thiami diphosphate, lyase; HET: TPP ADP MES; 1.74A {Escherichia coli} PDB: 2q27_A* 2q29_A* Length = 564 Back     alignment and structure
>4feg_A Pyruvate oxidase; carbanion, structure activity relationship, oxidation-reduct umpolung, thiamine diphosphate, reaction intermediate; HET: TDM FAD GOL; 1.09A {Lactobacillus plantarum} PDB: 4fee_A* 1y9d_A* 2ez9_A* 2ez4_A* 2ez8_A* 2ezt_A* 2ezu_A* 1pow_A* 1pox_A* Length = 603 Back     alignment and structure
>4feg_A Pyruvate oxidase; carbanion, structure activity relationship, oxidation-reduct umpolung, thiamine diphosphate, reaction intermediate; HET: TDM FAD GOL; 1.09A {Lactobacillus plantarum} PDB: 4fee_A* 1y9d_A* 2ez9_A* 2ez4_A* 2ez8_A* 2ezt_A* 2ezu_A* 1pow_A* 1pox_A* Length = 603 Back     alignment and structure
>4feg_A Pyruvate oxidase; carbanion, structure activity relationship, oxidation-reduct umpolung, thiamine diphosphate, reaction intermediate; HET: TDM FAD GOL; 1.09A {Lactobacillus plantarum} PDB: 4fee_A* 1y9d_A* 2ez9_A* 2ez4_A* 2ez8_A* 2ezt_A* 2ezu_A* 1pow_A* 1pox_A* Length = 603 Back     alignment and structure
>1v5e_A Pyruvate oxidase; oxidoreductase, flavoprotein; HET: FAD; 1.60A {Aerococcus viridans} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 2dji_A* 1v5f_A* 1v5g_A* Length = 590 Back     alignment and structure
>1v5e_A Pyruvate oxidase; oxidoreductase, flavoprotein; HET: FAD; 1.60A {Aerococcus viridans} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 2dji_A* 1v5f_A* 1v5g_A* Length = 590 Back     alignment and structure
>1v5e_A Pyruvate oxidase; oxidoreductase, flavoprotein; HET: FAD; 1.60A {Aerococcus viridans} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 2dji_A* 1v5f_A* 1v5g_A* Length = 590 Back     alignment and structure
>3eya_A Pyruvate dehydrogenase [cytochrome]; pyruvate oxidase, membrane-associated flavoprotein dehydrogenase, interactions with lipids cell membrane; HET: TDP FAD; 2.50A {Escherichia coli} PDB: 3ey9_A* Length = 549 Back     alignment and structure
>3eya_A Pyruvate dehydrogenase [cytochrome]; pyruvate oxidase, membrane-associated flavoprotein dehydrogenase, interactions with lipids cell membrane; HET: TDP FAD; 2.50A {Escherichia coli} PDB: 3ey9_A* Length = 549 Back     alignment and structure
>3eya_A Pyruvate dehydrogenase [cytochrome]; pyruvate oxidase, membrane-associated flavoprotein dehydrogenase, interactions with lipids cell membrane; HET: TDP FAD; 2.50A {Escherichia coli} PDB: 3ey9_A* Length = 549 Back     alignment and structure
>2nxw_A Phenyl-3-pyruvate decarboxylase; thiamine pyrophosphate, asymmetric dimer of dimers, open ACT loops, lyase; HET: TPP; 1.50A {Azospirillum brasilense} PDB: 2q5j_A* 2q5l_A* 2q5o_A* 2q5q_A* Length = 565 Back     alignment and structure
>2nxw_A Phenyl-3-pyruvate decarboxylase; thiamine pyrophosphate, asymmetric dimer of dimers, open ACT loops, lyase; HET: TPP; 1.50A {Azospirillum brasilense} PDB: 2q5j_A* 2q5l_A* 2q5o_A* 2q5q_A* Length = 565 Back     alignment and structure
>2nxw_A Phenyl-3-pyruvate decarboxylase; thiamine pyrophosphate, asymmetric dimer of dimers, open ACT loops, lyase; HET: TPP; 1.50A {Azospirillum brasilense} PDB: 2q5j_A* 2q5l_A* 2q5o_A* 2q5q_A* Length = 565 Back     alignment and structure
>2nxw_A Phenyl-3-pyruvate decarboxylase; thiamine pyrophosphate, asymmetric dimer of dimers, open ACT loops, lyase; HET: TPP; 1.50A {Azospirillum brasilense} PDB: 2q5j_A* 2q5l_A* 2q5o_A* 2q5q_A* Length = 565 Back     alignment and structure
>2iht_A Carboxyethylarginine synthase; thiamin diphosphate complex, transferase; HET: MSE TPP; 2.00A {Streptomyces clavuligerus} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1upb_A* 1upc_A* 1upa_A* 2ihu_A* 2ihv_A* Length = 573 Back     alignment and structure
>2iht_A Carboxyethylarginine synthase; thiamin diphosphate complex, transferase; HET: MSE TPP; 2.00A {Streptomyces clavuligerus} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1upb_A* 1upc_A* 1upa_A* 2ihu_A* 2ihv_A* Length = 573 Back     alignment and structure
>2iht_A Carboxyethylarginine synthase; thiamin diphosphate complex, transferase; HET: MSE TPP; 2.00A {Streptomyces clavuligerus} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1upb_A* 1upc_A* 1upa_A* 2ihu_A* 2ihv_A* Length = 573 Back     alignment and structure
>1ozh_A ALS, acetolactate synthase, catabolic; acetohydroxyacid synthase, thiamin diphosphate, lyase; HET: PGE HE3; 2.00A {Klebsiella pneumoniae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1ozg_A* 1ozf_A* Length = 566 Back     alignment and structure
>1ozh_A ALS, acetolactate synthase, catabolic; acetohydroxyacid synthase, thiamin diphosphate, lyase; HET: PGE HE3; 2.00A {Klebsiella pneumoniae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1ozg_A* 1ozf_A* Length = 566 Back     alignment and structure
>1ozh_A ALS, acetolactate synthase, catabolic; acetohydroxyacid synthase, thiamin diphosphate, lyase; HET: PGE HE3; 2.00A {Klebsiella pneumoniae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1ozg_A* 1ozf_A* Length = 566 Back     alignment and structure
>2uz1_A Benzaldehyde lyase; thiamine diphosphate, thiamine pyrophosphate, benzoin, flavoprotein; HET: TPP; 1.65A {Pseudomonas fluorescens} PDB: 2ag1_A* 2ag0_A* 2uz1_B* 3iae_A* 3iaf_A* 3d7k_A* Length = 563 Back     alignment and structure
>2uz1_A Benzaldehyde lyase; thiamine diphosphate, thiamine pyrophosphate, benzoin, flavoprotein; HET: TPP; 1.65A {Pseudomonas fluorescens} PDB: 2ag1_A* 2ag0_A* 2uz1_B* 3iae_A* 3iaf_A* 3d7k_A* Length = 563 Back     alignment and structure
>2uz1_A Benzaldehyde lyase; thiamine diphosphate, thiamine pyrophosphate, benzoin, flavoprotein; HET: TPP; 1.65A {Pseudomonas fluorescens} PDB: 2ag1_A* 2ag0_A* 2uz1_B* 3iae_A* 3iaf_A* 3d7k_A* Length = 563 Back     alignment and structure
>1ybh_A Acetolactate synthase, chloroplast; acetohydroxyacid synthase, herbicide, sulfonylurea, thiamin diphosphate, FAD, inhibitor; HET: CIE NHE FAD P22; 2.50A {Arabidopsis thaliana} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1yhy_A* 1yhz_A* 1yi0_A* 1yi1_A* 1z8n_A* 3ea4_A* 3e9y_A* Length = 590 Back     alignment and structure
>1ybh_A Acetolactate synthase, chloroplast; acetohydroxyacid synthase, herbicide, sulfonylurea, thiamin diphosphate, FAD, inhibitor; HET: CIE NHE FAD P22; 2.50A {Arabidopsis thaliana} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1yhy_A* 1yhz_A* 1yi0_A* 1yi1_A* 1z8n_A* 3ea4_A* 3e9y_A* Length = 590 Back     alignment and structure
>2pgn_A Cyclohexane-1,2-dione hydrolase (CDH); three alpha/beta domains; HET: P6G FAD TPP; 1.20A {Azoarcus SP} PDB: 2pgo_A* Length = 589 Back     alignment and structure
>2pgn_A Cyclohexane-1,2-dione hydrolase (CDH); three alpha/beta domains; HET: P6G FAD TPP; 1.20A {Azoarcus SP} PDB: 2pgo_A* Length = 589 Back     alignment and structure
>2pgn_A Cyclohexane-1,2-dione hydrolase (CDH); three alpha/beta domains; HET: P6G FAD TPP; 1.20A {Azoarcus SP} PDB: 2pgo_A* Length = 589 Back     alignment and structure
>2pan_A Glyoxylate carboligase; thiamin-diphosphate (THDP), thimain-dependent enzymes, FAD, lyase; HET: FAD TDP 1PE; 2.70A {Escherichia coli} Length = 616 Back     alignment and structure
>2pan_A Glyoxylate carboligase; thiamin-diphosphate (THDP), thimain-dependent enzymes, FAD, lyase; HET: FAD TDP 1PE; 2.70A {Escherichia coli} Length = 616 Back     alignment and structure
>2pan_A Glyoxylate carboligase; thiamin-diphosphate (THDP), thimain-dependent enzymes, FAD, lyase; HET: FAD TDP 1PE; 2.70A {Escherichia coli} Length = 616 Back     alignment and structure
>1t9b_A Acetolactate synthase, mitochondrial; acetohydroxyacid synthase, herbicide, sulfonylurea, thiamin diphosphate, FAD, inhibitor; HET: 1CS P25 FAD NSP P22 YF3; 2.20A {Saccharomyces cerevisiae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1n0h_A* 1t9a_A* 1t9c_A* 1t9d_A* 1jsc_A* Length = 677 Back     alignment and structure
>1t9b_A Acetolactate synthase, mitochondrial; acetohydroxyacid synthase, herbicide, sulfonylurea, thiamin diphosphate, FAD, inhibitor; HET: 1CS P25 FAD NSP P22 YF3; 2.20A {Saccharomyces cerevisiae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1n0h_A* 1t9a_A* 1t9c_A* 1t9d_A* 1jsc_A* Length = 677 Back     alignment and structure
>1t9b_A Acetolactate synthase, mitochondrial; acetohydroxyacid synthase, herbicide, sulfonylurea, thiamin diphosphate, FAD, inhibitor; HET: 1CS P25 FAD NSP P22 YF3; 2.20A {Saccharomyces cerevisiae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1n0h_A* 1t9a_A* 1t9c_A* 1t9d_A* 1jsc_A* Length = 677 Back     alignment and structure
>1q6z_A BFD, BFDC, benzoylformate decarboxylase; lyase, carbon-carbon, mandelate catabolism, T thiazolone diphosphate, inhibitor, high resolution; HET: TZD; 1.00A {Pseudomonas putida} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1po7_A* 1pi3_A* 3fsj_X* 1mcz_A* 1bfd_A* 2fwn_A* 3fzn_A* 2fn3_A* 2v3w_A* 1yno_A* 3f6b_X* 3f6e_X* Length = 528 Back     alignment and structure
>1q6z_A BFD, BFDC, benzoylformate decarboxylase; lyase, carbon-carbon, mandelate catabolism, T thiazolone diphosphate, inhibitor, high resolution; HET: TZD; 1.00A {Pseudomonas putida} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1po7_A* 1pi3_A* 3fsj_X* 1mcz_A* 1bfd_A* 2fwn_A* 3fzn_A* 2fn3_A* 2v3w_A* 1yno_A* 3f6b_X* 3f6e_X* Length = 528 Back     alignment and structure
>1q6z_A BFD, BFDC, benzoylformate decarboxylase; lyase, carbon-carbon, mandelate catabolism, T thiazolone diphosphate, inhibitor, high resolution; HET: TZD; 1.00A {Pseudomonas putida} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1po7_A* 1pi3_A* 3fsj_X* 1mcz_A* 1bfd_A* 2fwn_A* 3fzn_A* 2fn3_A* 2v3w_A* 1yno_A* 3f6b_X* 3f6e_X* Length = 528 Back     alignment and structure
>2vbf_A Branched-chain alpha-ketoacid decarboxylase; KDCA, flavoprotein, THDP-dependent enzymes, thiamine pyrophosphate, lyase; HET: TPP; 1.60A {Lactococcus lactis} PDB: 2vbg_A* Length = 570 Back     alignment and structure
>2vbf_A Branched-chain alpha-ketoacid decarboxylase; KDCA, flavoprotein, THDP-dependent enzymes, thiamine pyrophosphate, lyase; HET: TPP; 1.60A {Lactococcus lactis} PDB: 2vbg_A* Length = 570 Back     alignment and structure
>2vbf_A Branched-chain alpha-ketoacid decarboxylase; KDCA, flavoprotein, THDP-dependent enzymes, thiamine pyrophosphate, lyase; HET: TPP; 1.60A {Lactococcus lactis} PDB: 2vbg_A* Length = 570 Back     alignment and structure
>2vbf_A Branched-chain alpha-ketoacid decarboxylase; KDCA, flavoprotein, THDP-dependent enzymes, thiamine pyrophosphate, lyase; HET: TPP; 1.60A {Lactococcus lactis} PDB: 2vbg_A* Length = 570 Back     alignment and structure
>2vbi_A Pyruvate decarboxylase; thiamine pyrophosphate, lyase, pyruv flavoprotein, THDP-dependent enzyme; HET: TPP; 2.75A {Acetobacter pasteurianus} Length = 566 Back     alignment and structure
>2vbi_A Pyruvate decarboxylase; thiamine pyrophosphate, lyase, pyruv flavoprotein, THDP-dependent enzyme; HET: TPP; 2.75A {Acetobacter pasteurianus} Length = 566 Back     alignment and structure
>2vbi_A Pyruvate decarboxylase; thiamine pyrophosphate, lyase, pyruv flavoprotein, THDP-dependent enzyme; HET: TPP; 2.75A {Acetobacter pasteurianus} Length = 566 Back     alignment and structure
>2wvg_A PDC, pyruvate decarboxylase; thiamine diphosphate, lyase, flavoprotein, metal-binding, alcohol fermentation; HET: TPU; 1.75A {Zymomonas mobilis} PDB: 2wva_A* 2wvh_A 3oe1_A* 1zpd_A* Length = 568 Back     alignment and structure
>2wvg_A PDC, pyruvate decarboxylase; thiamine diphosphate, lyase, flavoprotein, metal-binding, alcohol fermentation; HET: TPU; 1.75A {Zymomonas mobilis} PDB: 2wva_A* 2wvh_A 3oe1_A* 1zpd_A* Length = 568 Back     alignment and structure
>2wvg_A PDC, pyruvate decarboxylase; thiamine diphosphate, lyase, flavoprotein, metal-binding, alcohol fermentation; HET: TPU; 1.75A {Zymomonas mobilis} PDB: 2wva_A* 2wvh_A 3oe1_A* 1zpd_A* Length = 568 Back     alignment and structure
>2vk8_A Pyruvate decarboxylase isozyme 1; asymmetric active sites, phenylalanine catabolism, tryptophan catabolism, thiamine pyrophosphate; HET: TPP; 1.42A {Saccharomyces cerevisiae} PDB: 1qpb_A* 2vk1_A* 2w93_A* 1pyd_A* 1pvd_A* 2vk4_A* 2vjy_A* 2g1i_A* Length = 563 Back     alignment and structure
>2vk8_A Pyruvate decarboxylase isozyme 1; asymmetric active sites, phenylalanine catabolism, tryptophan catabolism, thiamine pyrophosphate; HET: TPP; 1.42A {Saccharomyces cerevisiae} PDB: 1qpb_A* 2vk1_A* 2w93_A* 1pyd_A* 1pvd_A* 2vk4_A* 2vjy_A* 2g1i_A* Length = 563 Back     alignment and structure
>2vk8_A Pyruvate decarboxylase isozyme 1; asymmetric active sites, phenylalanine catabolism, tryptophan catabolism, thiamine pyrophosphate; HET: TPP; 1.42A {Saccharomyces cerevisiae} PDB: 1qpb_A* 2vk1_A* 2w93_A* 1pyd_A* 1pvd_A* 2vk4_A* 2vjy_A* 2g1i_A* Length = 563 Back     alignment and structure
>1ovm_A Indole-3-pyruvate decarboxylase; thiamine diphosphate, indole-3-acetic acid, TDP dependent enzyme, lyase; HET: TPP; 2.65A {Enterobacter cloacae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 Length = 552 Back     alignment and structure
>1ovm_A Indole-3-pyruvate decarboxylase; thiamine diphosphate, indole-3-acetic acid, TDP dependent enzyme, lyase; HET: TPP; 2.65A {Enterobacter cloacae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 Length = 552 Back     alignment and structure
>1ovm_A Indole-3-pyruvate decarboxylase; thiamine diphosphate, indole-3-acetic acid, TDP dependent enzyme, lyase; HET: TPP; 2.65A {Enterobacter cloacae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 Length = 552 Back     alignment and structure
>2x7j_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene -1-carboxylate synthase; transferase, metal-binding; HET: TPP; 2.35A {Bacillus subtilis} Length = 604 Back     alignment and structure
>2x7j_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene -1-carboxylate synthase; transferase, metal-binding; HET: TPP; 2.35A {Bacillus subtilis} Length = 604 Back     alignment and structure
>2x7j_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene -1-carboxylate synthase; transferase, metal-binding; HET: TPP; 2.35A {Bacillus subtilis} Length = 604 Back     alignment and structure
>3lq1_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 1-carboxylate synthase; menaquinone biosynthesis, sephchc synthase, structural genomics; 2.60A {Listeria monocytogenes} Length = 578 Back     alignment and structure
>3lq1_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 1-carboxylate synthase; menaquinone biosynthesis, sephchc synthase, structural genomics; 2.60A {Listeria monocytogenes} Length = 578 Back     alignment and structure
>3lq1_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 1-carboxylate synthase; menaquinone biosynthesis, sephchc synthase, structural genomics; 2.60A {Listeria monocytogenes} Length = 578 Back     alignment and structure
>3hww_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- carboxylate synthase; menaquinone, THDP, Mg, vitamin K2, carboxylase, magnesium; HET: AKG; 1.95A {Escherichia coli k-12} PDB: 3flm_A* 3hwx_A* 2jlc_A* 2jla_A* Length = 556 Back     alignment and structure
>3hww_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- carboxylate synthase; menaquinone, THDP, Mg, vitamin K2, carboxylase, magnesium; HET: AKG; 1.95A {Escherichia coli k-12} PDB: 3flm_A* 3hwx_A* 2jlc_A* 2jla_A* Length = 556 Back     alignment and structure
>3hww_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- carboxylate synthase; menaquinone, THDP, Mg, vitamin K2, carboxylase, magnesium; HET: AKG; 1.95A {Escherichia coli k-12} PDB: 3flm_A* 3hwx_A* 2jlc_A* 2jla_A* Length = 556 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3cf4_G Acetyl-COA decarboxylase/synthase epsilon subunit; methanomicrobia, iron-nikel-sulfur, 4Fe-NI-4S, oxidoreductas; 2.00A {Methanosarcina barkeri} Length = 170 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1065
2c31_A568 Oxalyl-COA decarboxylase; oxalate, thiamin diphosp 100.0
2q28_A564 Oxalyl-COA decarboxylase; lyase, oxalate degradati 100.0
3eya_A549 Pyruvate dehydrogenase [cytochrome]; pyruvate oxid 100.0
4feg_A603 Pyruvate oxidase; carbanion, structure activity re 100.0
3lq1_A578 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 100.0
1ozh_A566 ALS, acetolactate synthase, catabolic; acetohydrox 100.0
1ybh_A590 Acetolactate synthase, chloroplast; acetohydroxyac 100.0
1t9b_A677 Acetolactate synthase, mitochondrial; acetohydroxy 100.0
2pgn_A589 Cyclohexane-1,2-dione hydrolase (CDH); three alpha 100.0
2uz1_A563 Benzaldehyde lyase; thiamine diphosphate, thiamine 100.0
2x7j_A604 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene - 100.0
2pan_A616 Glyoxylate carboligase; thiamin-diphosphate (THDP) 100.0
1q6z_A528 BFD, BFDC, benzoylformate decarboxylase; lyase, ca 100.0
2iht_A573 Carboxyethylarginine synthase; thiamin diphosphate 100.0
1v5e_A590 Pyruvate oxidase; oxidoreductase, flavoprotein; HE 100.0
3hww_A556 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 100.0
2wvg_A568 PDC, pyruvate decarboxylase; thiamine diphosphate, 100.0
2vbi_A566 Pyruvate decarboxylase; thiamine pyrophosphate, ly 100.0
2vk8_A563 Pyruvate decarboxylase isozyme 1; asymmetric activ 100.0
2nxw_A565 Phenyl-3-pyruvate decarboxylase; thiamine pyrophos 100.0
1ovm_A552 Indole-3-pyruvate decarboxylase; thiamine diphosph 100.0
2vbf_A570 Branched-chain alpha-ketoacid decarboxylase; KDCA, 100.0
3eya_A549 Pyruvate dehydrogenase [cytochrome]; pyruvate oxid 100.0
1ybh_A590 Acetolactate synthase, chloroplast; acetohydroxyac 100.0
4feg_A603 Pyruvate oxidase; carbanion, structure activity re 100.0
1t9b_A677 Acetolactate synthase, mitochondrial; acetohydroxy 100.0
2c31_A568 Oxalyl-COA decarboxylase; oxalate, thiamin diphosp 100.0
1ozh_A566 ALS, acetolactate synthase, catabolic; acetohydrox 100.0
2q28_A564 Oxalyl-COA decarboxylase; lyase, oxalate degradati 100.0
2pan_A616 Glyoxylate carboligase; thiamin-diphosphate (THDP) 100.0
1q6z_A528 BFD, BFDC, benzoylformate decarboxylase; lyase, ca 100.0
3lq1_A578 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 100.0
2uz1_A563 Benzaldehyde lyase; thiamine diphosphate, thiamine 100.0
3hww_A556 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 100.0
2x7j_A604 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene - 100.0
2pgn_A589 Cyclohexane-1,2-dione hydrolase (CDH); three alpha 100.0
2iht_A573 Carboxyethylarginine synthase; thiamin diphosphate 100.0
1v5e_A590 Pyruvate oxidase; oxidoreductase, flavoprotein; HE 100.0
2wvg_A568 PDC, pyruvate decarboxylase; thiamine diphosphate, 100.0
2vbi_A566 Pyruvate decarboxylase; thiamine pyrophosphate, ly 100.0
2vk8_A563 Pyruvate decarboxylase isozyme 1; asymmetric activ 100.0
2nxw_A565 Phenyl-3-pyruvate decarboxylase; thiamine pyrophos 100.0
1ovm_A552 Indole-3-pyruvate decarboxylase; thiamine diphosph 100.0
2vbf_A570 Branched-chain alpha-ketoacid decarboxylase; KDCA, 100.0
3cf4_G170 Acetyl-COA decarboxylase/synthase epsilon subunit; 99.48
1ytl_A174 Acetyl-COA decarboxylase/synthase complex epsilon 99.37
1yd7_A395 2-keto acid:ferredoxin oxidoreductase subunit alph 99.33
1yd7_A395 2-keto acid:ferredoxin oxidoreductase subunit alph 99.28
2o1x_A629 1-deoxy-D-xylulose-5-phosphate synthase; thiamin, 99.11
2o1s_A621 1-deoxy-D-xylulose-5-phosphate synthase; DXS, thia 99.01
3mos_A616 Transketolase, TK; thiamin diphosphate TPP THDP en 98.99
2c42_A 1231 Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron, 98.98
2bfd_A400 2-oxoisovalerate dehydrogenase alpha subunit; oxid 98.89
1umd_A367 E1-alpha, 2-OXO acid dehydrogenase alpha subunit; 98.85
2e6k_A651 Transketolase; structural genomics, NPPSFA, nation 98.85
3l84_A632 Transketolase; TKT, structural genomics, center fo 98.84
2r8o_A669 Transketolase 1, TK 1; reaction intermediate, calc 98.81
1umd_A367 E1-alpha, 2-OXO acid dehydrogenase alpha subunit; 98.78
1w85_A368 Pyruvate dehydrogenase E1 component, alpha subunit 98.78
1w85_A368 Pyruvate dehydrogenase E1 component, alpha subunit 98.72
1qs0_A407 2-oxoisovalerate dehydrogenase alpha-subunit; hete 98.72
1qs0_A407 2-oxoisovalerate dehydrogenase alpha-subunit; hete 98.71
3l84_A 632 Transketolase; TKT, structural genomics, center fo 98.69
3m49_A 690 Transketolase; alpha-beta-alpha sandwich, csgid, t 98.68
2bfd_A400 2-oxoisovalerate dehydrogenase alpha subunit; oxid 98.68
3mos_A 616 Transketolase, TK; thiamin diphosphate TPP THDP en 98.66
2r8o_A 669 Transketolase 1, TK 1; reaction intermediate, calc 98.65
1gpu_A 680 Transketolase; transferase(ketone residues); HET: 98.63
3kom_A 663 Transketolase; rossmann fold, csgid, transferase, 98.61
3uk1_A 711 Transketolase; structural genomics, seattle struct 98.6
1itz_A 675 Transketolase; calvin cycle, cofactor, thiamine py 98.58
2e6k_A 651 Transketolase; structural genomics, NPPSFA, nation 98.58
3uk1_A711 Transketolase; structural genomics, seattle struct 98.51
3kom_A663 Transketolase; rossmann fold, csgid, transferase, 98.49
2o1s_A 621 1-deoxy-D-xylulose-5-phosphate synthase; DXS, thia 98.49
3m49_A690 Transketolase; alpha-beta-alpha sandwich, csgid, t 98.48
2o1x_A 629 1-deoxy-D-xylulose-5-phosphate synthase; thiamin, 98.48
1itz_A675 Transketolase; calvin cycle, cofactor, thiamine py 98.47
1r9j_A 673 Transketolase; domains, EACH of the alpha/beta typ 98.46
2c42_A1231 Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron, 98.42
2ozl_A365 PDHE1-A type I, pyruvate dehydrogenase E1 componen 98.41
1gpu_A680 Transketolase; transferase(ketone residues); HET: 98.39
1r9j_A673 Transketolase; domains, EACH of the alpha/beta typ 98.33
2ozl_A365 PDHE1-A type I, pyruvate dehydrogenase E1 componen 98.3
3rim_A 700 Transketolase, TK; TPP, transferase; HET: TPP; 2.4 97.95
3rim_A700 Transketolase, TK; TPP, transferase; HET: TPP; 2.4 97.76
2qtc_A886 Pyruvate dehydrogenase E1 component; thiamin dipho 97.74
2yic_A868 2-oxoglutarate decarboxylase; lyase; HET: TPP; 1.9 97.6
2xt6_A1113 2-oxoglutarate decarboxylase; lyase, KDH, KGD; HET 97.41
2yic_A 868 2-oxoglutarate decarboxylase; lyase; HET: TPP; 1.9 97.33
2jgd_A933 2-oxoglutarate dehydrogenase E1 component; flavopr 97.0
2qtc_A 886 Pyruvate dehydrogenase E1 component; thiamin dipho 96.98
2jgd_A 933 2-oxoglutarate dehydrogenase E1 component; flavopr 96.79
2xt6_A 1113 2-oxoglutarate decarboxylase; lyase, KDH, KGD; HET 96.62
3ahc_A845 Phosphoketolase, xylulose 5-phosphate/fructose 6-p 94.47
3glr_A285 NAD-dependent deacetylase sirtuin-3, mitochondria; 94.2
1j8f_A323 SIRT2, sirtuin 2, isoform 1, silencing INFO; gene 93.15
1efv_A315 Electron transfer flavoprotein; electron transport 90.52
2hjh_A354 NAD-dependent histone deacetylase SIR2; protein, s 90.43
3ahc_A 845 Phosphoketolase, xylulose 5-phosphate/fructose 6-p 90.25
4iao_A492 NAD-dependent histone deacetylase SIR2; protein co 89.76
2fsv_C203 NAD(P) transhydrogenase subunit beta; NAD(P) trans 89.64
1pno_A180 NAD(P) transhydrogenase subunit beta; nucleotide b 89.59
1qs0_B338 2-oxoisovalerate dehydrogenase beta-subunit; heter 89.16
1djl_A207 Transhydrogenase DIII; rossmann fold dinucleotide 89.14
1q1a_A289 HST2 protein; ternary complex, histone deacetylase 88.89
1d4o_A184 NADP(H) transhydrogenase; nucleotide-binding fold, 88.35
1efp_A307 ETF, protein (electron transfer flavoprotein); ele 87.98
1q14_A361 HST2 protein; histone deacetylase, hydrolase; 2.50 87.71
1o97_D320 Electron transferring flavoprotein alpha-subunit; 87.68
1w85_B324 Pyruvate dehydrogenase E1 component, beta subunit; 87.12
2ozl_B341 PDHE1-B, pyruvate dehydrogenase E1 component subun 87.01
1s5p_A235 NAD-dependent deacetylase; protein deacetylase, SI 86.66
2bfd_B342 2-oxoisovalerate dehydrogenase beta subunit; oxido 86.38
1umd_B324 E1-beta, 2-OXO acid dehydrogenase beta subunit; al 85.88
2bru_C186 NAD(P) transhydrogenase subunit beta; paramagnetic 85.82
3pki_A355 NAD-dependent deacetylase sirtuin-6; ADP ribose, s 84.35
1umd_B324 E1-beta, 2-OXO acid dehydrogenase beta subunit; al 83.66
1yc5_A246 NAD-dependent deacetylase; SIR2, sirtuin, SIR2TM, 83.48
3k35_A318 NAD-dependent deacetylase sirtuin-6; rossmann fold 83.36
1ma3_A253 SIR2-AF2, transcriptional regulatory protein, SIR2 82.54
1m2k_A249 Silent information regulator 2; protein-ligand com 81.38
3riy_A273 NAD-dependent deacetylase sirtuin-5; desuccinylase 80.37
>2c31_A Oxalyl-COA decarboxylase; oxalate, thiamin diphosphate, flavoprotein, lyase, thiamine pyrophosphate; HET: TZD ADP; 1.73A {Oxalobacter formigenes} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 2ji6_A* 2ji7_A* 2ji8_A* 2ji9_A* 2jib_A* Back     alignment and structure
Probab=100.00  E-value=7.2e-79  Score=741.62  Aligned_cols=551  Identities=32%  Similarity=0.535  Sum_probs=440.0

Q ss_pred             ccCccHHHHHHHHHHhcCceEEEeecCCchhhhHHHhhcCCceEEEccCCchHHHHHHHHHHHhCCCeEEEEeccccccc
Q psy14416        264 DEELSANQVIAQALKFQGIEYVFGIVGIPVIELAMACQQEGIHYIGMRNEQAACYAAQAIGYLTKKPGVCLVVSGPGLLH  343 (1065)
Q Consensus       264 ~~~~~~~~~l~~~L~~~GV~~vfg~pG~~~~~l~~al~~~~i~~i~~~~E~~A~~~A~g~ar~tgkpgv~~~tsGpG~~N  343 (1065)
                      +..++++++|++.|+++||+++||+||++++++++++.+++|++|.++||++|+|||+||||+||||+||+||||||++|
T Consensus         7 ~~~~~~a~~l~~~L~~~GV~~vfg~PG~~~~~l~~al~~~~i~~i~~~~E~~Aa~~A~GyAr~tg~pgv~~~TsGpG~~N   86 (568)
T 2c31_A            7 VELTDGFHVLIDALKMNDIDTMYGVVGIPITNLARMWQDDGQRFYSFRHEQHAGYAASIAGYIEGKPGVCLTVSAPGFLN   86 (568)
T ss_dssp             CCEEEHHHHHHHHHHHTTCCEEEECCCTTTHHHHHHHHHTTCEEEECSSHHHHHHHHHHHHHHHSSCEEEEECSHHHHHH
T ss_pred             CCcccHHHHHHHHHHHcCCCEEEEeCCCccHHHHHHHHhCCCcEEEeCcHHHHHHHHHHHHHHhCCCEEEEEcCCccHHH
Confidence            34689999999999999999999999999999999997778999999999999999999999999999999999999999


Q ss_pred             cccccccccccCcceEeecCCCccCCCC--CCCCCccChhhhhcccccEEeeCCChhhHHHHHHHHHHHhhcCCCCEEEE
Q psy14416        344 TFGGMANAQINCWPMLVIGGSCAQDHEG--IGGFQECPQVELARPYCKYSARPPNIHLIGQHVEKAVRLSTFGKPGVSYL  421 (1065)
Q Consensus       344 ~~~av~eA~~~~vPLlvItg~~p~~~~g--~ga~Q~idQ~~l~~~~~k~s~~l~~~~~i~~~i~~A~~~A~~~~~GPV~L  421 (1065)
                      +++||++|+.+++|||+|||++|.++++  ++++|++||.++|+++|||++++++++++++.+++|++.|.+++||||||
T Consensus        87 ~~~~i~~A~~~~vPll~itg~~~~~~~~~~~~~~Q~~dq~~~~~~~tk~~~~v~~~~~~~~~i~~A~~~A~~~~~GPV~l  166 (568)
T 2c31_A           87 GVTSLAHATTNCFPMILLSGSSEREIVDLQQGDYEEMDQMNVARPHCKASFRINSIKDIPIGIARAVRTAVSGRPGGVYV  166 (568)
T ss_dssp             HHHHHHHHHHHTCCEEEEEEECCHHHHHTTCCCTTCCCHHHHSGGGSSEEEECCSGGGHHHHHHHHHHHHHSSSCCEEEE
T ss_pred             HHHHHHHHHhcCCCEEEEccCCCccccCCCCCcccccCHHHHHHhhhheeeecCCHHHHHHHHHHHHHHhcCCCCceEEE
Confidence            9999999999999999999999999888  69999999999999999999999999999999999999999999999999


Q ss_pred             ecChhhhhhccccccCCCCCCCCCCCCCCCchhhhhHhHHHHHhhcccccccccccCCCCCCCCHHHHHHHHHHHHhCCC
Q psy14416        422 DFPANLLAQRINQSALVPTPKVLEPTLPWPGIAELKQASQLILEAKAPLVIIGKVLEPTLPWPGIAELKQASRLILEAKA  501 (1065)
Q Consensus       422 ~iP~Dv~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~v~~~ae~L~~Akr  501 (1065)
                      +||.|++.++.+..... .+..  .                      +      ........++.+.+++++++|++|||
T Consensus       167 ~iP~dv~~~~~~~~~~~-~~~~--~----------------------~------~~~~~~~~~~~~~i~~~~~~l~~a~r  215 (568)
T 2c31_A          167 DLPAKLFGQTISVEEAN-KLLF--K----------------------P------IDPAPAQIPAEDAIARAADLIKNAKR  215 (568)
T ss_dssp             EEETHHHHCEEEHHHHH-HHCC--C----------------------C------SCSSCCCCCCHHHHHHHHHHHHTCSS
T ss_pred             eCCHHHhhccccccccc-cccc--c----------------------c------cCCCCCCCCCHHHHHHHHHHHHhCCC
Confidence            99999886654321000 0000  0                      0      00112235678899999999999999


Q ss_pred             cEEEEccCCCchhHHHHHHHHHhhcCCCEEecCCCCCCCCCCCcccccHHHHhhhcCCCEEEEeCCccccccccCCCccc
Q psy14416        502 PLVIIGKGAAYSQAETELLSFVNSFNLPFLPTPMGKGVVPDAHPNCVSAARTHALQNADLVLLLGARLNWILHFGRAPRF  581 (1065)
Q Consensus       502 PvIlvG~g~~~~~a~~~L~~LAe~lg~PV~tt~~gkg~v~~~hpl~lg~~~~~al~~aDlVI~iG~~~~~~~~~g~~~~~  581 (1065)
                      |+|++|.++.++++.+++++|||++|+||+++++|||.+|++||+++|...++++++||+||.+|+++++..+.++...|
T Consensus       216 pvIl~G~g~~~~~a~~~l~~lae~~~~Pv~~t~~~~g~~~~~~p~~~G~~~~~~l~~aDlvl~iG~~~~~~~~~~~~~~~  295 (568)
T 2c31_A          216 PVIMLGKGAAYAQCDDEIRALVEETGIPFLPMGMAKGLLPDNHPQSAAATRAFALAQCDVCVLIGARLNWLMQHGKGKTW  295 (568)
T ss_dssp             EEEEECHHHHHHTCHHHHHHHHHHHTCCEEECGGGTTSSCTTCTTBCGGGHHHHHHHCSEEEEESCCCSGGGGGGCSGGG
T ss_pred             CEEEECcccccccHHHHHHHHHHHhCCCEEecccccccCCCCChhhcchHHHhhhccCCEEEEECCCCccccccCccccc
Confidence            99999999877777899999999999999999999999999999999987777889999999999999877665655556


Q ss_pred             c-CCCeEEEecCChhhcccccccceEEEcCHHHHHHHHHHhhcccccCCCCCCCchHHHHHHHHHHhhhhcccchhhhhh
Q psy14416        582 K-SNVKIIQVDLNAEELHNSVQAAVAIQSDVRLTVQQLKQMLSHTQRNWSFSATSPWWQELKLKCQTNRQVKLPVILVIV  660 (1065)
Q Consensus       582 ~-~~~~iI~Vd~d~~~~~~~~~~~~~I~~D~~~~L~~L~~~l~~~~~~~~~~~~~~W~~~~~~~~~~~~~~~~~~~~~~~  660 (1065)
                      . ++.++||||.|+.++++++.+++.+++|++.+|++|.+.++...     .....|.+++++..+.......+..    
T Consensus       296 ~~~~~~ii~id~d~~~~~~~~~~~~~i~~d~~~~l~~L~~~l~~~~-----~~~~~w~~~~~~~~~~~~~~~~~~~----  366 (568)
T 2c31_A          296 GDELKKYVQIDIQANEMDSNQPIAAPVVGDIKSAVSLLRKALKGAP-----KADAEWTGALKAKVDGNKAKLAGKM----  366 (568)
T ss_dssp             TTSCCEEEEEESCGGGTTSSSCCSEEEESCHHHHHHHHHHHHTTCC-----CCCHHHHHHHHHHHHHHHHHHHHHH----
T ss_pred             CCCCCeEEEEeCCHHHhcCCcCCCceeeCCHHHHHHHHHHhhhhcC-----CCcHHHHHHHHHHHHhhhhhhhhhh----
Confidence            5 67899999999999999999999999999999999998875211     1245788776655443322211110    


Q ss_pred             ccCCccCCCCccccccccccCccccccceEEeecccccccccccccccccccchhhhhhcC--CCcEEEEECCCCcCccc
Q psy14416        661 NNNGIYGGFDETTYASIVESGEVTTVLPVILVIVNNNGIYGGFDETTYASIVESGEVTTVL--PVILVIVNNNGIYGGFD  738 (1065)
Q Consensus       661 ~~~~~~~~~~~~~~~~~~~~~~~~~~~pl~~~~~~~~~~~~~~~~~~~~~~~~~g~L~~~L--P~d~ilv~d~G~~~~~~  738 (1065)
                                    ..     . .+..|+     +   +..++.           .|.+.+  |++.+++.|+|+.+.|.
T Consensus       367 --------------~~-----~-~~~~~~-----~---~~~~~~-----------~l~~~l~~~~~~iv~~dg~~~~~~~  407 (568)
T 2c31_A          367 --------------TA-----E-TPSGMM-----N---YSNSLG-----------VVRDFMLANPDISLVNEGANALDNT  407 (568)
T ss_dssp             --------------HC-----C-CCTTCB-----C---HHHHHH-----------HHHHHHHHCCSSEEEEESSHHHHHH
T ss_pred             --------------cc-----c-ccCCCc-----C---HHHHHH-----------HHHHHhcCCCCeEEEECChhHHHHH
Confidence                          00     0 002345     6   777888           999999  99999998876533321


Q ss_pred             ccchhhhccccccccccceEEEEeeCCCcccCCCcccccccccccccccccceeeeeecCCCcccccCcccccccccccc
Q psy14416        739 ETTYASIVESGEVTTVLPVILVIVNNNGIYGGFDETTYASIVESGEVTTVLPVILVIVNNNGIYGGFDETTYASIVESGE  818 (1065)
Q Consensus       739 ~~~~~~~~~~~~~~~~lp~~~~~~~n~g~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~  818 (1065)
                      ..++                                               +...|       +.+              
T Consensus       408 ~~~~-----------------------------------------------~~~~p-------~~~--------------  419 (568)
T 2c31_A          408 RMIV-----------------------------------------------DMLKP-------RKR--------------  419 (568)
T ss_dssp             HHHC-----------------------------------------------CCCST-------TCE--------------
T ss_pred             HHHh-----------------------------------------------cccCC-------CeE--------------
Confidence            1100                                               00011       001              


Q ss_pred             eeeccceEEEEEcCCcccccccccccceeecccceeeecceEEEEeccccccccccchhhhhheeccccccccccEEEEE
Q psy14416        819 VTTVLPVILVIVNNNGIYGGFDETTYASIVESGEVTTVLPVILVIVNNNGIYGGFDETTYASIVESGEVTTVLPVILVIV  898 (1065)
Q Consensus       819 ~~~~~~~~~~~~~n~Gi~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~g~~~~~~~~~~~~~~~~~~~~~~~v~~  898 (1065)
                                  -|+|.+|+|                            |+++|+++  |++++         |+++|+ 
T Consensus       420 ------------~~~g~~g~~----------------------------G~~l~~Ai--Gaala---------~~~~vv-  447 (568)
T 2c31_A          420 ------------LDSGTWGVM----------------------------GIGMGYCV--AAAAV---------TGKPVI-  447 (568)
T ss_dssp             ------------EESTTTTCS----------------------------SCHHHHHH--HHHHH---------HCSCEE-
T ss_pred             ------------EcCCCCccc----------------------------cccHHHHH--HHHhC---------CCCcEE-
Confidence                        135557777                            88888888  77775         467899 


Q ss_pred             ccCcccCCccccccceeccccceeeeccceEEEEeccccccCcchhhHHHhhccCccccCCCEEEEEEcCCcccCCCchh
Q psy14416        899 NNNGIYGGFDETTYASIVESGEVTTVLPVILVIVNNNGIYGGFDETTYASIVESGEVTTVLPVILVIVNNNGIYGGFDEA  978 (1065)
Q Consensus       899 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~gd~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nn~g~~~~~~~~  978 (1065)
                                                      +++|||+| +|+.++++++     +++++|++|||+||+|||.+....
T Consensus       448 --------------------------------~i~GDGsf-~~~~~el~ta-----~~~~l~~~ivv~NN~~~~~~~~~~  489 (568)
T 2c31_A          448 --------------------------------AVEGDSAF-GFSGMELETI-----CRYNLPVTVIIMNNGGIYKGNEAD  489 (568)
T ss_dssp             --------------------------------EEEEHHHH-HTTGGGHHHH-----HHTTCCEEEEEEESSBSSCSCCCC
T ss_pred             --------------------------------EEEcchHh-hccHHHHHHH-----HHhCCCeEEEEEeCchhHHHHHHH
Confidence                                            99999999 9999999999     999999999999999977754322


Q ss_pred             hHhHHhhcCCcccCCCCCCCCCCccHHHHHHHcCCCeEeeCCHHHHHHHHHHHHhcCCCCEEEEEEeCCCCCCCcchhhh
Q psy14416        979 TYASIVESGEVTTVSPPTSLGPSLRYEKMMAVFGHDGYLCTTVPQIKQAMKKCLQTTTRPSLINILINPSADRKPQNFSW 1058 (1065)
Q Consensus       979 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~l~~~~~~~~~~~~~~~li~~~~~~~~~~~~~~~~~ 1058 (1065)
                      .+      +.  ... .+. .+.+||.++|++||+++++|++.+||+++|+++++. ++|+||||.++++++.+.+..+|
T Consensus       490 ~~------~~--~~~-~~~-~~~~d~~~~a~a~G~~~~~v~~~~el~~al~~a~~~-~~p~liev~~~~~~~~~~~~~~~  558 (568)
T 2c31_A          490 PQ------PG--VIS-CTR-LTRGRYDMMMEAFGGKGYVANTPAELKAALEEAVAS-GKPCLINAMIDPDAGVESGRIKS  558 (568)
T ss_dssp             SB------TT--BCC-TTB-CCCCCHHHHHHTTTCEEEEESSHHHHHHHHHHHHHH-TSCEEEEEEBCTTSSCC------
T ss_pred             hh------cC--Ccc-cCc-CCCCCHHHHHHHcCCeEEEeCCHHHHHHHHHHHHhC-CCCEEEEEEeccccCCCcccccc
Confidence            10      00  111 122 467999999999999999999999999999999976 89999999999999999999999


Q ss_pred             hHhh
Q psy14416       1059 LTNL 1062 (1065)
Q Consensus      1059 ~~~~ 1062 (1065)
                      ++.-
T Consensus       559 ~~~~  562 (568)
T 2c31_A          559 LNVV  562 (568)
T ss_dssp             ----
T ss_pred             cchh
Confidence            8654



>2q28_A Oxalyl-COA decarboxylase; lyase, oxalate degradation, thiami diphosphate, lyase; HET: TPP ADP MES; 1.74A {Escherichia coli} PDB: 2q27_A* 2q29_A* Back     alignment and structure
>3eya_A Pyruvate dehydrogenase [cytochrome]; pyruvate oxidase, membrane-associated flavoprotein dehydrogenase, interactions with lipids cell membrane; HET: TDP FAD; 2.50A {Escherichia coli} PDB: 3ey9_A* Back     alignment and structure
>4feg_A Pyruvate oxidase; carbanion, structure activity relationship, oxidation-reduct umpolung, thiamine diphosphate, reaction intermediate; HET: TDM FAD GOL; 1.09A {Lactobacillus plantarum} PDB: 4fee_A* 1y9d_A* 2ez9_A* 2ez4_A* 2ez8_A* 2ezt_A* 2ezu_A* 1pow_A* 1pox_A* Back     alignment and structure
>3lq1_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 1-carboxylate synthase; menaquinone biosynthesis, sephchc synthase, structural genomics; 2.60A {Listeria monocytogenes} Back     alignment and structure
>1ozh_A ALS, acetolactate synthase, catabolic; acetohydroxyacid synthase, thiamin diphosphate, lyase; HET: PGE HE3; 2.00A {Klebsiella pneumoniae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1ozg_A* 1ozf_A* Back     alignment and structure
>1t9b_A Acetolactate synthase, mitochondrial; acetohydroxyacid synthase, herbicide, sulfonylurea, thiamin diphosphate, FAD, inhibitor; HET: 1CS P25 FAD NSP P22 YF3; 2.20A {Saccharomyces cerevisiae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1n0h_A* 1t9a_A* 1t9c_A* 1t9d_A* 1jsc_A* Back     alignment and structure
>2pgn_A Cyclohexane-1,2-dione hydrolase (CDH); three alpha/beta domains; HET: P6G FAD TPP; 1.20A {Azoarcus SP} PDB: 2pgo_A* Back     alignment and structure
>2uz1_A Benzaldehyde lyase; thiamine diphosphate, thiamine pyrophosphate, benzoin, flavoprotein; HET: TPP; 1.65A {Pseudomonas fluorescens} PDB: 2ag1_A* 2ag0_A* 2uz1_B* 3iae_A* 3iaf_A* 3d7k_A* Back     alignment and structure
>2x7j_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene -1-carboxylate synthase; transferase, metal-binding; HET: TPP; 2.35A {Bacillus subtilis} Back     alignment and structure
>2pan_A Glyoxylate carboligase; thiamin-diphosphate (THDP), thimain-dependent enzymes, FAD, lyase; HET: FAD TDP 1PE; 2.70A {Escherichia coli} Back     alignment and structure
>1q6z_A BFD, BFDC, benzoylformate decarboxylase; lyase, carbon-carbon, mandelate catabolism, T thiazolone diphosphate, inhibitor, high resolution; HET: TZD; 1.00A {Pseudomonas putida} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1po7_A* 1pi3_A* 3fsj_X* 1mcz_A* 1bfd_A* 2fwn_A* 3fzn_A* 2fn3_A* 2v3w_A* 1yno_A* 3f6b_X* 3f6e_X* Back     alignment and structure
>2iht_A Carboxyethylarginine synthase; thiamin diphosphate complex, transferase; HET: MSE TPP; 2.00A {Streptomyces clavuligerus} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1upb_A* 1upc_A* 1upa_A* 2ihu_A* 2ihv_A* Back     alignment and structure
>1v5e_A Pyruvate oxidase; oxidoreductase, flavoprotein; HET: FAD; 1.60A {Aerococcus viridans} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 2dji_A* 1v5f_A* 1v5g_A* Back     alignment and structure
>3hww_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- carboxylate synthase; menaquinone, THDP, Mg, vitamin K2, carboxylase, magnesium; HET: AKG; 1.95A {Escherichia coli k-12} PDB: 3flm_A* 3hwx_A* 2jlc_A* 2jla_A* Back     alignment and structure
>2wvg_A PDC, pyruvate decarboxylase; thiamine diphosphate, lyase, flavoprotein, metal-binding, alcohol fermentation; HET: TPU; 1.75A {Zymomonas mobilis} PDB: 2wva_A* 2wvh_A 3oe1_A* 1zpd_A* Back     alignment and structure
>2vbi_A Pyruvate decarboxylase; thiamine pyrophosphate, lyase, pyruv flavoprotein, THDP-dependent enzyme; HET: TPP; 2.75A {Acetobacter pasteurianus} Back     alignment and structure
>2vk8_A Pyruvate decarboxylase isozyme 1; asymmetric active sites, phenylalanine catabolism, tryptophan catabolism, thiamine pyrophosphate; HET: TPP; 1.42A {Saccharomyces cerevisiae} PDB: 1qpb_A* 2vk1_A* 2w93_A* 1pyd_A* 1pvd_A* 2vk4_A* 2vjy_A* 2g1i_A* Back     alignment and structure
>2nxw_A Phenyl-3-pyruvate decarboxylase; thiamine pyrophosphate, asymmetric dimer of dimers, open ACT loops, lyase; HET: TPP; 1.50A {Azospirillum brasilense} PDB: 2q5j_A* 2q5l_A* 2q5o_A* 2q5q_A* Back     alignment and structure
>1ovm_A Indole-3-pyruvate decarboxylase; thiamine diphosphate, indole-3-acetic acid, TDP dependent enzyme, lyase; HET: TPP; 2.65A {Enterobacter cloacae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 Back     alignment and structure
>2vbf_A Branched-chain alpha-ketoacid decarboxylase; KDCA, flavoprotein, THDP-dependent enzymes, thiamine pyrophosphate, lyase; HET: TPP; 1.60A {Lactococcus lactis} PDB: 2vbg_A* Back     alignment and structure
>3eya_A Pyruvate dehydrogenase [cytochrome]; pyruvate oxidase, membrane-associated flavoprotein dehydrogenase, interactions with lipids cell membrane; HET: TDP FAD; 2.50A {Escherichia coli} PDB: 3ey9_A* Back     alignment and structure
>1ybh_A Acetolactate synthase, chloroplast; acetohydroxyacid synthase, herbicide, sulfonylurea, thiamin diphosphate, FAD, inhibitor; HET: CIE NHE FAD P22; 2.50A {Arabidopsis thaliana} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1yhy_A* 1yhz_A* 1yi0_A* 1yi1_A* 1z8n_A* 3ea4_A* 3e9y_A* Back     alignment and structure
>4feg_A Pyruvate oxidase; carbanion, structure activity relationship, oxidation-reduct umpolung, thiamine diphosphate, reaction intermediate; HET: TDM FAD GOL; 1.09A {Lactobacillus plantarum} PDB: 4fee_A* 1y9d_A* 2ez9_A* 2ez4_A* 2ez8_A* 2ezt_A* 2ezu_A* 1pow_A* 1pox_A* Back     alignment and structure
>1t9b_A Acetolactate synthase, mitochondrial; acetohydroxyacid synthase, herbicide, sulfonylurea, thiamin diphosphate, FAD, inhibitor; HET: 1CS P25 FAD NSP P22 YF3; 2.20A {Saccharomyces cerevisiae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1n0h_A* 1t9a_A* 1t9c_A* 1t9d_A* 1jsc_A* Back     alignment and structure
>2c31_A Oxalyl-COA decarboxylase; oxalate, thiamin diphosphate, flavoprotein, lyase, thiamine pyrophosphate; HET: TZD ADP; 1.73A {Oxalobacter formigenes} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 2ji6_A* 2ji7_A* 2ji8_A* 2ji9_A* 2jib_A* Back     alignment and structure
>1ozh_A ALS, acetolactate synthase, catabolic; acetohydroxyacid synthase, thiamin diphosphate, lyase; HET: PGE HE3; 2.00A {Klebsiella pneumoniae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1ozg_A* 1ozf_A* Back     alignment and structure
>2q28_A Oxalyl-COA decarboxylase; lyase, oxalate degradation, thiami diphosphate, lyase; HET: TPP ADP MES; 1.74A {Escherichia coli} PDB: 2q27_A* 2q29_A* Back     alignment and structure
>2pan_A Glyoxylate carboligase; thiamin-diphosphate (THDP), thimain-dependent enzymes, FAD, lyase; HET: FAD TDP 1PE; 2.70A {Escherichia coli} Back     alignment and structure
>1q6z_A BFD, BFDC, benzoylformate decarboxylase; lyase, carbon-carbon, mandelate catabolism, T thiazolone diphosphate, inhibitor, high resolution; HET: TZD; 1.00A {Pseudomonas putida} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1po7_A* 1pi3_A* 3fsj_X* 1mcz_A* 1bfd_A* 2fwn_A* 3fzn_A* 2fn3_A* 2v3w_A* 1yno_A* 3f6b_X* 3f6e_X* Back     alignment and structure
>3lq1_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 1-carboxylate synthase; menaquinone biosynthesis, sephchc synthase, structural genomics; 2.60A {Listeria monocytogenes} Back     alignment and structure
>2uz1_A Benzaldehyde lyase; thiamine diphosphate, thiamine pyrophosphate, benzoin, flavoprotein; HET: TPP; 1.65A {Pseudomonas fluorescens} PDB: 2ag1_A* 2ag0_A* 2uz1_B* 3iae_A* 3iaf_A* 3d7k_A* Back     alignment and structure
>3hww_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- carboxylate synthase; menaquinone, THDP, Mg, vitamin K2, carboxylase, magnesium; HET: AKG; 1.95A {Escherichia coli k-12} PDB: 3flm_A* 3hwx_A* 2jlc_A* 2jla_A* Back     alignment and structure
>2x7j_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene -1-carboxylate synthase; transferase, metal-binding; HET: TPP; 2.35A {Bacillus subtilis} Back     alignment and structure
>2pgn_A Cyclohexane-1,2-dione hydrolase (CDH); three alpha/beta domains; HET: P6G FAD TPP; 1.20A {Azoarcus SP} PDB: 2pgo_A* Back     alignment and structure
>2iht_A Carboxyethylarginine synthase; thiamin diphosphate complex, transferase; HET: MSE TPP; 2.00A {Streptomyces clavuligerus} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1upb_A* 1upc_A* 1upa_A* 2ihu_A* 2ihv_A* Back     alignment and structure
>1v5e_A Pyruvate oxidase; oxidoreductase, flavoprotein; HET: FAD; 1.60A {Aerococcus viridans} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 2dji_A* 1v5f_A* 1v5g_A* Back     alignment and structure
>2wvg_A PDC, pyruvate decarboxylase; thiamine diphosphate, lyase, flavoprotein, metal-binding, alcohol fermentation; HET: TPU; 1.75A {Zymomonas mobilis} PDB: 2wva_A* 2wvh_A 3oe1_A* 1zpd_A* Back     alignment and structure
>2vbi_A Pyruvate decarboxylase; thiamine pyrophosphate, lyase, pyruv flavoprotein, THDP-dependent enzyme; HET: TPP; 2.75A {Acetobacter pasteurianus} Back     alignment and structure
>2vk8_A Pyruvate decarboxylase isozyme 1; asymmetric active sites, phenylalanine catabolism, tryptophan catabolism, thiamine pyrophosphate; HET: TPP; 1.42A {Saccharomyces cerevisiae} PDB: 1qpb_A* 2vk1_A* 2w93_A* 1pyd_A* 1pvd_A* 2vk4_A* 2vjy_A* 2g1i_A* Back     alignment and structure
>2nxw_A Phenyl-3-pyruvate decarboxylase; thiamine pyrophosphate, asymmetric dimer of dimers, open ACT loops, lyase; HET: TPP; 1.50A {Azospirillum brasilense} PDB: 2q5j_A* 2q5l_A* 2q5o_A* 2q5q_A* Back     alignment and structure
>1ovm_A Indole-3-pyruvate decarboxylase; thiamine diphosphate, indole-3-acetic acid, TDP dependent enzyme, lyase; HET: TPP; 2.65A {Enterobacter cloacae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 Back     alignment and structure
>2vbf_A Branched-chain alpha-ketoacid decarboxylase; KDCA, flavoprotein, THDP-dependent enzymes, thiamine pyrophosphate, lyase; HET: TPP; 1.60A {Lactococcus lactis} PDB: 2vbg_A* Back     alignment and structure
>3cf4_G Acetyl-COA decarboxylase/synthase epsilon subunit; methanomicrobia, iron-nikel-sulfur, 4Fe-NI-4S, oxidoreductas; 2.00A {Methanosarcina barkeri} Back     alignment and structure
>1ytl_A Acetyl-COA decarboxylase/synthase complex epsilon 2; structural genomics; 1.80A {Archaeoglobus fulgidus} SCOP: c.31.1.6 Back     alignment and structure
>1yd7_A 2-keto acid:ferredoxin oxidoreductase subunit alpha; structural genomics, southeast collaboratory for structural genomics, secsg; 2.30A {Pyrococcus furiosus} Back     alignment and structure
>1yd7_A 2-keto acid:ferredoxin oxidoreductase subunit alpha; structural genomics, southeast collaboratory for structural genomics, secsg; 2.30A {Pyrococcus furiosus} Back     alignment and structure
>2o1x_A 1-deoxy-D-xylulose-5-phosphate synthase; thiamin, isoprenoid, DXS, transferase; HET: TDP; 2.90A {Deinococcus radiodurans} Back     alignment and structure
>2o1s_A 1-deoxy-D-xylulose-5-phosphate synthase; DXS, thiamine, isoprenoid, transferase; HET: TDP; 2.40A {Escherichia coli} Back     alignment and structure
>3mos_A Transketolase, TK; thiamin diphosphate TPP THDP enzyme catalysis sugar metaboli transferase; HET: TPP; 1.75A {Homo sapiens} PDB: 3ooy_A* Back     alignment and structure
>2c42_A Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron, iron-sulfur, iron-sulfur cluster, pyruvate catabolism, TPP-dependent enzyme; HET: TPP; 1.78A {Desulfovibrio africanus} SCOP: c.36.1.8 c.36.1.12 c.48.1.3 c.64.1.1 d.58.1.5 PDB: 1b0p_A* 1kek_A* 2c3o_A* 2c3p_A* 2c3u_A* 2c3y_A* 2c3m_A* 2pda_A* 2uza_A* Back     alignment and structure
>2bfd_A 2-oxoisovalerate dehydrogenase alpha subunit; oxidoreductase, multi-enzyme complex, acylation, oxidative decarboxylation, maple syrup urine disease; HET: TDP; 1.39A {Homo sapiens} SCOP: c.36.1.11 PDB: 1v16_A* 2bfc_A* 1v1r_A* 1olu_A* 2bfb_A* 1v1m_A* 2bew_A* 1dtw_A* 1olx_A* 1ols_A* 1wci_A* 1x80_A* 2beu_A* 1u5b_A* 2bev_A* 1v11_A* 1x7x_A* 1x7y_A* 1x7w_A* 1x7z_A* ... Back     alignment and structure
>1umd_A E1-alpha, 2-OXO acid dehydrogenase alpha subunit; alpha(2)beta(2) tetramer, structural genomics; HET: TDP; 1.90A {Thermus thermophilus} SCOP: c.36.1.11 PDB: 1um9_A* 1umc_A* 1umb_A* Back     alignment and structure
>2e6k_A Transketolase; structural genomics, NPPSFA, national project protein structural and functional analyses; 2.09A {Thermus thermophilus} Back     alignment and structure
>3l84_A Transketolase; TKT, structural genomics, center for structur genomics of infectious diseases, csgid, transferase; HET: MSE; 1.36A {Campylobacter jejuni} PDB: 3m6l_A* 3m34_A* 3m7i_A* Back     alignment and structure
>2r8o_A Transketolase 1, TK 1; reaction intermediate, calcium, metal-binding, thiamine pyrophosphate, transferase; HET: T5X; 1.47A {Escherichia coli K12} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 PDB: 2r5n_A* 2r8p_A* 1qgd_A* Back     alignment and structure
>1umd_A E1-alpha, 2-OXO acid dehydrogenase alpha subunit; alpha(2)beta(2) tetramer, structural genomics; HET: TDP; 1.90A {Thermus thermophilus} SCOP: c.36.1.11 PDB: 1um9_A* 1umc_A* 1umb_A* Back     alignment and structure
>1w85_A Pyruvate dehydrogenase E1 component, alpha subunit; dehydrogenase, multienzyme complex, oxidoreductase; HET: TDP; 2.0A {Geobacillus stearothermophilus} SCOP: c.36.1.11 PDB: 3duf_A* 3dv0_A* 3dva_A* 1w88_A* Back     alignment and structure
>1w85_A Pyruvate dehydrogenase E1 component, alpha subunit; dehydrogenase, multienzyme complex, oxidoreductase; HET: TDP; 2.0A {Geobacillus stearothermophilus} SCOP: c.36.1.11 PDB: 3duf_A* 3dv0_A* 3dva_A* 1w88_A* Back     alignment and structure
>1qs0_A 2-oxoisovalerate dehydrogenase alpha-subunit; heterotetramer, THDP cofactor, oxidoreductase; HET: TDP; 2.40A {Pseudomonas putida} SCOP: c.36.1.11 PDB: 2bp7_A Back     alignment and structure
>1qs0_A 2-oxoisovalerate dehydrogenase alpha-subunit; heterotetramer, THDP cofactor, oxidoreductase; HET: TDP; 2.40A {Pseudomonas putida} SCOP: c.36.1.11 PDB: 2bp7_A Back     alignment and structure
>3l84_A Transketolase; TKT, structural genomics, center for structur genomics of infectious diseases, csgid, transferase; HET: MSE; 1.36A {Campylobacter jejuni} PDB: 3m6l_A* 3m34_A* 3m7i_A* Back     alignment and structure
>3m49_A Transketolase; alpha-beta-alpha sandwich, csgid, transferase, structural genomics, center for structural genomics of infectious diseases; HET: MSE TDP PG5 TRS BTB; 2.00A {Bacillus anthracis} PDB: 3hyl_A* Back     alignment and structure
>2bfd_A 2-oxoisovalerate dehydrogenase alpha subunit; oxidoreductase, multi-enzyme complex, acylation, oxidative decarboxylation, maple syrup urine disease; HET: TDP; 1.39A {Homo sapiens} SCOP: c.36.1.11 PDB: 1v16_A* 2bfc_A* 1v1r_A* 1olu_A* 2bfb_A* 1v1m_A* 2bew_A* 1dtw_A* 1olx_A* 1ols_A* 1wci_A* 1x80_A* 2beu_A* 1u5b_A* 2bev_A* 1v11_A* 1x7x_A* 1x7y_A* 1x7w_A* 1x7z_A* ... Back     alignment and structure
>3mos_A Transketolase, TK; thiamin diphosphate TPP THDP enzyme catalysis sugar metaboli transferase; HET: TPP; 1.75A {Homo sapiens} PDB: 3ooy_A* Back     alignment and structure
>2r8o_A Transketolase 1, TK 1; reaction intermediate, calcium, metal-binding, thiamine pyrophosphate, transferase; HET: T5X; 1.47A {Escherichia coli K12} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 PDB: 2r5n_A* 2r8p_A* 1qgd_A* Back     alignment and structure
>1gpu_A Transketolase; transferase(ketone residues); HET: THD; 1.86A {Saccharomyces cerevisiae} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 PDB: 1ngs_A* 1trk_A* 1ay0_A* 1tkb_A* 1tka_A* 1tkc_A* Back     alignment and structure
>3kom_A Transketolase; rossmann fold, csgid, transferase, structural genomics, center for structural genomics of infectious DISE; HET: MSE; 1.60A {Francisella tularensis subsp} Back     alignment and structure
>3uk1_A Transketolase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, thiamine pyrophosphate; 2.15A {Burkholderia thailandensis} PDB: 3upt_A* Back     alignment and structure
>1itz_A Transketolase; calvin cycle, cofactor, thiamine pyrophosphate, plant, transferase; HET: TPP; 2.30A {Zea mays} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 Back     alignment and structure
>2e6k_A Transketolase; structural genomics, NPPSFA, national project protein structural and functional analyses; 2.09A {Thermus thermophilus} Back     alignment and structure
>3uk1_A Transketolase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, thiamine pyrophosphate; 2.15A {Burkholderia thailandensis} PDB: 3upt_A* Back     alignment and structure
>3kom_A Transketolase; rossmann fold, csgid, transferase, structural genomics, center for structural genomics of infectious DISE; HET: MSE; 1.60A {Francisella tularensis subsp} Back     alignment and structure
>2o1s_A 1-deoxy-D-xylulose-5-phosphate synthase; DXS, thiamine, isoprenoid, transferase; HET: TDP; 2.40A {Escherichia coli} Back     alignment and structure
>3m49_A Transketolase; alpha-beta-alpha sandwich, csgid, transferase, structural genomics, center for structural genomics of infectious diseases; HET: MSE TDP PG5 TRS BTB; 2.00A {Bacillus anthracis} PDB: 3hyl_A* Back     alignment and structure
>2o1x_A 1-deoxy-D-xylulose-5-phosphate synthase; thiamin, isoprenoid, DXS, transferase; HET: TDP; 2.90A {Deinococcus radiodurans} Back     alignment and structure
>1itz_A Transketolase; calvin cycle, cofactor, thiamine pyrophosphate, plant, transferase; HET: TPP; 2.30A {Zea mays} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 Back     alignment and structure
>1r9j_A Transketolase; domains, EACH of the alpha/beta type, thiamine diphosphate binding domain, transferase; HET: TPP; 2.22A {Leishmania mexicana mexicana} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 Back     alignment and structure
>2c42_A Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron, iron-sulfur, iron-sulfur cluster, pyruvate catabolism, TPP-dependent enzyme; HET: TPP; 1.78A {Desulfovibrio africanus} SCOP: c.36.1.8 c.36.1.12 c.48.1.3 c.64.1.1 d.58.1.5 PDB: 1b0p_A* 1kek_A* 2c3o_A* 2c3p_A* 2c3u_A* 2c3y_A* 2c3m_A* 2pda_A* 2uza_A* Back     alignment and structure
>2ozl_A PDHE1-A type I, pyruvate dehydrogenase E1 component alpha subunit, somatic form; pyruvate_dehydrogenase_complex, human, multienzyme_complex_component; HET: TPP; 1.90A {Homo sapiens} SCOP: c.36.1.11 PDB: 1ni4_A* 3exe_A* 3exi_A 3exh_A* 3exg_A 3exf_A* Back     alignment and structure
>1gpu_A Transketolase; transferase(ketone residues); HET: THD; 1.86A {Saccharomyces cerevisiae} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 PDB: 1ngs_A* 1trk_A* 1ay0_A* 1tkb_A* 1tka_A* 1tkc_A* Back     alignment and structure
>1r9j_A Transketolase; domains, EACH of the alpha/beta type, thiamine diphosphate binding domain, transferase; HET: TPP; 2.22A {Leishmania mexicana mexicana} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 Back     alignment and structure
>2ozl_A PDHE1-A type I, pyruvate dehydrogenase E1 component alpha subunit, somatic form; pyruvate_dehydrogenase_complex, human, multienzyme_complex_component; HET: TPP; 1.90A {Homo sapiens} SCOP: c.36.1.11 PDB: 1ni4_A* 3exe_A* 3exi_A 3exh_A* 3exg_A 3exf_A* Back     alignment and structure
>3rim_A Transketolase, TK; TPP, transferase; HET: TPP; 2.49A {Mycobacterium tuberculosis} Back     alignment and structure
>3rim_A Transketolase, TK; TPP, transferase; HET: TPP; 2.49A {Mycobacterium tuberculosis} Back     alignment and structure
>2qtc_A Pyruvate dehydrogenase E1 component; thiamin diphosphate, glycolysis, MAG metal-binding, oxidoreductase, thiamine pyrophosphate; HET: TDK; 1.77A {Escherichia coli} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 PDB: 2qta_A* 1l8a_A* 1rp7_A* 2g25_A* 2g28_A* 2g67_A 2iea_A* 3lpl_A* 3lq2_A* 3lq4_A* Back     alignment and structure
>2yic_A 2-oxoglutarate decarboxylase; lyase; HET: TPP; 1.96A {Mycobacterium smegmatis} PDB: 2xta_A* 2y0p_A* 2xt9_A* 2yid_A* Back     alignment and structure
>2xt6_A 2-oxoglutarate decarboxylase; lyase, KDH, KGD; HET: TPP; 2.74A {Mycobacterium smegmatis} Back     alignment and structure
>2yic_A 2-oxoglutarate decarboxylase; lyase; HET: TPP; 1.96A {Mycobacterium smegmatis} PDB: 2xta_A* 2y0p_A* 2xt9_A* 2yid_A* Back     alignment and structure
>2jgd_A 2-oxoglutarate dehydrogenase E1 component; flavoprotein, oxidoreductase, thiamine diphosphate, thiamine pyrophosphate, adenosine monophosphate; HET: AMP; 2.6A {Escherichia coli} PDB: 2jgd_B* Back     alignment and structure
>2qtc_A Pyruvate dehydrogenase E1 component; thiamin diphosphate, glycolysis, MAG metal-binding, oxidoreductase, thiamine pyrophosphate; HET: TDK; 1.77A {Escherichia coli} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 PDB: 2qta_A* 1l8a_A* 1rp7_A* 2g25_A* 2g28_A* 2g67_A 2iea_A* 3lpl_A* 3lq2_A* 3lq4_A* Back     alignment and structure
>2jgd_A 2-oxoglutarate dehydrogenase E1 component; flavoprotein, oxidoreductase, thiamine diphosphate, thiamine pyrophosphate, adenosine monophosphate; HET: AMP; 2.6A {Escherichia coli} PDB: 2jgd_B* Back     alignment and structure
>2xt6_A 2-oxoglutarate decarboxylase; lyase, KDH, KGD; HET: TPP; 2.74A {Mycobacterium smegmatis} Back     alignment and structure
>3ahc_A Phosphoketolase, xylulose 5-phosphate/fructose 6-phosphate phospho; thiamine diphosphate-dependent enzyme, alpha-beta fold; HET: TPP 2PE; 1.70A {Bifidobacterium breve} PDB: 3ahd_A* 3ahe_A* 3ahf_A* 3ahj_A* 3ahi_A* 3ahh_A* 3ahg_A* 3ai7_A* Back     alignment and structure
>3glr_A NAD-dependent deacetylase sirtuin-3, mitochondria; NAD dependent deacetylase, sirtuin, substrate peptide comple hydrolase, metal-binding; HET: ALY; 1.80A {Homo sapiens} PDB: 3gls_A 3glt_A* 3glu_A 4hd8_A* 4fvt_A* Back     alignment and structure
>1j8f_A SIRT2, sirtuin 2, isoform 1, silencing INFO; gene regulation, transferase; 1.70A {Homo sapiens} SCOP: c.31.1.5 Back     alignment and structure
>1efv_A Electron transfer flavoprotein; electron transport, glutaric acidemia type II; HET: FAD AMP; 2.10A {Homo sapiens} SCOP: c.26.2.3 c.31.1.2 PDB: 2a1u_A* 1t9g_R* 2a1t_R* Back     alignment and structure
>2hjh_A NAD-dependent histone deacetylase SIR2; protein, sirtuin, acetyl-ADP-ribose, nicotinamide, hydrolase; HET: XYQ; 1.85A {Saccharomyces cerevisiae} Back     alignment and structure
>3ahc_A Phosphoketolase, xylulose 5-phosphate/fructose 6-phosphate phospho; thiamine diphosphate-dependent enzyme, alpha-beta fold; HET: TPP 2PE; 1.70A {Bifidobacterium breve} PDB: 3ahd_A* 3ahe_A* 3ahf_A* 3ahj_A* 3ahi_A* 3ahh_A* 3ahg_A* 3ai7_A* Back     alignment and structure
>4iao_A NAD-dependent histone deacetylase SIR2; protein complex, deacetylase, nucleus, hydrolase-trans complex; HET: APR; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2fsv_C NAD(P) transhydrogenase subunit beta; NAD(P) transhydrogenase subunits, oxidoreductas; HET: NAD NAP; 2.30A {Rhodospirillum rubrum} SCOP: c.31.1.4 PDB: 1e3t_A* 1hzz_C* 1nm5_C* 1u28_C* 1u2d_C* 1u2g_C* 2fr8_C* 2frd_C* Back     alignment and structure
>1pno_A NAD(P) transhydrogenase subunit beta; nucleotide binding fold, oxidoreductase; HET: NAP; 2.10A {Rhodospirillum rubrum} SCOP: c.31.1.4 PDB: 1pnq_A* 1xlt_C* 2oor_C* 1ptj_C* 2oo5_C* Back     alignment and structure
>1qs0_B 2-oxoisovalerate dehydrogenase beta-subunit; heterotetramer, THDP cofactor, oxidoreductase; HET: TDP; 2.40A {Pseudomonas putida} SCOP: c.36.1.7 c.48.1.2 PDB: 2bp7_B Back     alignment and structure
>1djl_A Transhydrogenase DIII; rossmann fold dinucleotide binding fold reverse binding of N oxidoreductase; HET: NAP; 2.00A {Homo sapiens} SCOP: c.31.1.4 PDB: 1pt9_A* 1u31_A* Back     alignment and structure
>1q1a_A HST2 protein; ternary complex, histone deacetylase, 2'-O-ADP ribose,, gene regulation; HET: ALY OAD; 1.50A {Saccharomyces cerevisiae} SCOP: c.31.1.5 PDB: 1szd_A* 1szc_A* 2od7_A* 2od9_A* 2qqf_A* 2qqg_A* 1q17_A* 2od2_A* Back     alignment and structure
>1d4o_A NADP(H) transhydrogenase; nucleotide-binding fold, protein-NADP(H) complex, inverted binding of NADP(H), oxidoreductase; HET: NAP; 1.21A {Bos taurus} SCOP: c.31.1.4 Back     alignment and structure
>1efp_A ETF, protein (electron transfer flavoprotein); electron transport, glutaric acidemia type II; HET: FAD AMP; 2.60A {Paracoccus denitrificans} SCOP: c.26.2.3 c.31.1.2 Back     alignment and structure
>1q14_A HST2 protein; histone deacetylase, hydrolase; 2.50A {Saccharomyces cerevisiae} SCOP: c.31.1.5 Back     alignment and structure
>1o97_D Electron transferring flavoprotein alpha-subunit; FAD binding; HET: AMP FAD; 1.6A {Methylophilus methylotrophus} SCOP: c.26.2.3 c.31.1.2 PDB: 1o95_D* 1o96_B* 1o94_D* 3clu_D* 3clt_D* 3clr_D* 3cls_D* Back     alignment and structure
>1w85_B Pyruvate dehydrogenase E1 component, beta subunit; dehydrogenase, multienzyme complex, oxidoreductase; HET: TDP; 2.0A {Geobacillus stearothermophilus} SCOP: c.36.1.7 c.48.1.2 PDB: 1w88_B* 3dva_B* 3dv0_B* 3duf_B* Back     alignment and structure
>2ozl_B PDHE1-B, pyruvate dehydrogenase E1 component subunit beta; pyruvate_dehydrogenase_complex, human, multienzyme_complex_component; HET: TPP; 1.90A {Homo sapiens} SCOP: c.36.1.7 c.48.1.2 PDB: 1ni4_B* 3exe_B* 3exf_B* 3exg_B 3exh_B* 3exi_B Back     alignment and structure
>1s5p_A NAD-dependent deacetylase; protein deacetylase, SIR2 homologue, hydrolase; HET: ALY; 1.96A {Escherichia coli} SCOP: c.31.1.5 Back     alignment and structure
>2bfd_B 2-oxoisovalerate dehydrogenase beta subunit; oxidoreductase, multi-enzyme complex, acylation, oxidative decarboxylation, maple syrup urine disease; HET: TDP; 1.39A {Homo sapiens} SCOP: c.36.1.7 c.48.1.2 PDB: 1dtw_B* 1olu_B* 1ols_B* 1v11_B* 1v16_B* 1v1m_B* 1u5b_B* 1wci_B* 1v1r_B* 1x7x_B* 1x7w_B* 1x7z_B* 1x80_B* 2beu_B* 2bev_B* 2bew_B* 2bfb_B* 2bfc_B* 1x7y_B* 2bfe_B* ... Back     alignment and structure
>1umd_B E1-beta, 2-OXO acid dehydrogenase beta subunit; alpha(2)beta(2) tetramer, structural genomics; HET: TDP; 1.90A {Thermus thermophilus} SCOP: c.36.1.7 c.48.1.2 PDB: 1um9_B* 1umc_B* 1umb_B* Back     alignment and structure
>3pki_A NAD-dependent deacetylase sirtuin-6; ADP ribose, structural genomics, structural genomics consortium, SGC, hydrolase; HET: AR6; 2.04A {Homo sapiens} PDB: 3pkj_A* Back     alignment and structure
>1umd_B E1-beta, 2-OXO acid dehydrogenase beta subunit; alpha(2)beta(2) tetramer, structural genomics; HET: TDP; 1.90A {Thermus thermophilus} SCOP: c.36.1.7 c.48.1.2 PDB: 1um9_B* 1umc_B* 1umb_B* Back     alignment and structure
>1yc5_A NAD-dependent deacetylase; SIR2, sirtuin, SIR2TM, SIRT1, nicotinamide, hydrolase; HET: ALY; 1.40A {Thermotoga maritima} SCOP: c.31.1.5 PDB: 2h2d_A* 2h2f_A 2h2g_A* 2h2h_A* 2h2i_A* 2h4f_A* 2h4j_A* 3d4b_A* 3d81_A* 3pdh_A* 2h4h_A* 3jr3_A* 2h59_A* Back     alignment and structure
>3k35_A NAD-dependent deacetylase sirtuin-6; rossmann fold, Zn-binding domain, structural genomics, struc genomics consortium, SGC, ADP-ribosylation; HET: APR; 2.00A {Homo sapiens} Back     alignment and structure
>1ma3_A SIR2-AF2, transcriptional regulatory protein, SIR2 family; enzyme-substrate complex, protein binding, transcription; HET: ALY MES; 2.00A {Archaeoglobus fulgidus} SCOP: c.31.1.5 PDB: 1s7g_A* 1yc2_A* Back     alignment and structure
>1m2k_A Silent information regulator 2; protein-ligand complex, gene regulation; HET: APR; 1.47A {Archaeoglobus fulgidus} SCOP: c.31.1.5 PDB: 1m2g_A* 1m2h_A* 1m2j_A* 1m2n_A* 1ici_A* Back     alignment and structure
>3riy_A NAD-dependent deacetylase sirtuin-5; desuccinylase, demalonylase, posttranslational modification, binding domain, rossmann fold domain; HET: SLL NAD; 1.55A {Homo sapiens} SCOP: c.31.1.5 PDB: 3rig_A* 4f4u_A* 4f56_A* 4hda_A* 2b4y_A* 2nyr_A* 4g1c_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1065
d1t9ba2175 c.36.1.5 (A:89-263) Acetohydroxyacid synthase cata 1e-33
d1t9ba2175 c.36.1.5 (A:89-263) Acetohydroxyacid synthase cata 1e-29
d1ybha2195 c.36.1.5 (A:86-280) Acetohydroxyacid synthase cata 2e-32
d1ybha2195 c.36.1.5 (A:86-280) Acetohydroxyacid synthase cata 1e-28
d1ozha2181 c.36.1.5 (A:7-187) Catabolic acetolactate synthase 2e-25
d1ozha2181 c.36.1.5 (A:7-187) Catabolic acetolactate synthase 1e-20
d2ji7a2188 c.36.1.5 (A:7-194) Oxalyl-CoA decarboxylase {Oxalo 5e-23
d2ji7a2188 c.36.1.5 (A:7-194) Oxalyl-CoA decarboxylase {Oxalo 8e-18
d2ihta2186 c.36.1.5 (A:12-197) Carboxyethylarginine synthase 2e-21
d2ihta2186 c.36.1.5 (A:12-197) Carboxyethylarginine synthase 1e-14
d2ji7a1175 c.31.1.3 (A:195-369) Oxalyl-CoA decarboxylase {Oxa 8e-21
d2djia2184 c.36.1.5 (A:3-186) Pyruvate oxidase {Aerococcus vi 1e-20
d2djia2184 c.36.1.5 (A:3-186) Pyruvate oxidase {Aerococcus vi 2e-16
d2ez9a2174 c.36.1.5 (A:9-182) Pyruvate oxidase {Lactobacillus 4e-20
d2ez9a2174 c.36.1.5 (A:9-182) Pyruvate oxidase {Lactobacillus 6e-16
d1q6za1160 c.31.1.3 (A:182-341) Benzoylformate decarboxylase 8e-19
d1pvda2180 c.36.1.5 (A:2-181) Pyruvate decarboxylase {Baker's 1e-18
d1pvda2180 c.36.1.5 (A:2-181) Pyruvate decarboxylase {Baker's 2e-14
d1ozha1179 c.31.1.3 (A:188-366) Catabolic acetolactate syntha 1e-18
d1ybha1179 c.31.1.3 (A:281-459) Acetohydroxyacid synthase cat 1e-17
d1q6za2180 c.36.1.5 (A:2-181) Benzoylformate decarboxylase {P 2e-17
d1q6za2180 c.36.1.5 (A:2-181) Benzoylformate decarboxylase {P 8e-14
d1ovma1161 c.31.1.3 (A:181-341) Indole-3-pyruvate decarboxyla 2e-17
d2ihta1177 c.31.1.3 (A:198-374) Carboxyethylarginine synthase 4e-17
d1pvda1179 c.31.1.3 (A:182-360) Pyruvate decarboxylase {Baker 1e-16
d1ytla1158 c.31.1.6 (A:17-174) Acetyl-CoA decarbonylase/synth 1e-16
d1ovma2178 c.36.1.5 (A:3-180) Indole-3-pyruvate decarboxylase 7e-16
d1ovma2178 c.36.1.5 (A:3-180) Indole-3-pyruvate decarboxylase 2e-13
d1zpda2186 c.36.1.5 (A:2-187) Pyruvate decarboxylase {Zymomon 1e-15
d1zpda2186 c.36.1.5 (A:2-187) Pyruvate decarboxylase {Zymomon 2e-12
d1zpda1175 c.31.1.3 (A:188-362) Pyruvate decarboxylase {Zymom 6e-15
d2ez9a1183 c.31.1.3 (A:183-365) Pyruvate oxidase {Lactobacill 6e-13
d1t9ba1171 c.31.1.3 (A:290-460) Acetohydroxyacid synthase cat 6e-12
d2djia1177 c.31.1.3 (A:187-363) Pyruvate oxidase {Aerococcus 3e-09
d1zpda3204 c.36.1.9 (A:363-566) Pyruvate decarboxylase {Zymom 5e-06
d1pvda3196 c.36.1.9 (A:361-556) Pyruvate decarboxylase {Baker 3e-05
d2ji7a3183 c.36.1.9 (A:370-552) Oxalyl-CoA decarboxylase {Oxa 2e-04
d2ji7a3183 c.36.1.9 (A:370-552) Oxalyl-CoA decarboxylase {Oxa 0.004
d1ybha3208 c.36.1.9 (A:460-667) Acetohydroxyacid synthase cat 0.001
>d1t9ba2 c.36.1.5 (A:89-263) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 175 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Thiamin diphosphate-binding fold (THDP-binding)
superfamily: Thiamin diphosphate-binding fold (THDP-binding)
family: Pyruvate oxidase and decarboxylase Pyr module
domain: Acetohydroxyacid synthase catalytic subunit
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
 Score =  125 bits (314), Expect = 1e-33
 Identities = 44/167 (26%), Positives = 82/167 (49%), Gaps = 1/167 (0%)

Query: 267 LSANQVIAQALKFQGIEYVFGIVGIPVIELAMA-CQQEGIHYIGMRNEQAACYAAQAIGY 325
           L+  Q+  + +  Q ++ VFG  G  ++ +  A    +  +++  ++EQ A + A+    
Sbjct: 4   LTGGQIFNEMMSRQNVDTVFGYPGGAILPVYDAIHNSDKFNFVLPKHEQGAGHMAEGYAR 63

Query: 326 LTKKPGVCLVVSGPGLLHTFGGMANAQINCWPMLVIGGSCAQDHEGIGGFQECPQVELAR 385
            + KPGV LV SGPG  +    MA+A  +  PM+V  G       G   FQE   V ++R
Sbjct: 64  ASGKPGVVLVTSGPGATNVVTPMADAFADGIPMVVFTGQVPTSAIGTDAFQEADVVGISR 123

Query: 386 PYCKYSARPPNIHLIGQHVEKAVRLSTFGKPGVSYLDFPANLLAQRI 432
              K++    ++  +   + +A  ++T G+PG   +D P ++ A  +
Sbjct: 124 SCTKWNVMVKSVEELPLRINEAFEIATSGRPGPVLVDLPKDVTAAIL 170


>d1t9ba2 c.36.1.5 (A:89-263) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 175 Back     information, alignment and structure
>d1ybha2 c.36.1.5 (A:86-280) Acetohydroxyacid synthase catalytic subunit {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} Length = 195 Back     information, alignment and structure
>d1ybha2 c.36.1.5 (A:86-280) Acetohydroxyacid synthase catalytic subunit {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} Length = 195 Back     information, alignment and structure
>d1ozha2 c.36.1.5 (A:7-187) Catabolic acetolactate synthase {Klebsiella pneumoniae [TaxId: 573]} Length = 181 Back     information, alignment and structure
>d1ozha2 c.36.1.5 (A:7-187) Catabolic acetolactate synthase {Klebsiella pneumoniae [TaxId: 573]} Length = 181 Back     information, alignment and structure
>d2ji7a2 c.36.1.5 (A:7-194) Oxalyl-CoA decarboxylase {Oxalobacter formigenes [TaxId: 847]} Length = 188 Back     information, alignment and structure
>d2ji7a2 c.36.1.5 (A:7-194) Oxalyl-CoA decarboxylase {Oxalobacter formigenes [TaxId: 847]} Length = 188 Back     information, alignment and structure
>d2ihta2 c.36.1.5 (A:12-197) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]} Length = 186 Back     information, alignment and structure
>d2ihta2 c.36.1.5 (A:12-197) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]} Length = 186 Back     information, alignment and structure
>d2ji7a1 c.31.1.3 (A:195-369) Oxalyl-CoA decarboxylase {Oxalobacter formigenes [TaxId: 847]} Length = 175 Back     information, alignment and structure
>d2djia2 c.36.1.5 (A:3-186) Pyruvate oxidase {Aerococcus viridans [TaxId: 1377]} Length = 184 Back     information, alignment and structure
>d2djia2 c.36.1.5 (A:3-186) Pyruvate oxidase {Aerococcus viridans [TaxId: 1377]} Length = 184 Back     information, alignment and structure
>d2ez9a2 c.36.1.5 (A:9-182) Pyruvate oxidase {Lactobacillus plantarum [TaxId: 1590]} Length = 174 Back     information, alignment and structure
>d2ez9a2 c.36.1.5 (A:9-182) Pyruvate oxidase {Lactobacillus plantarum [TaxId: 1590]} Length = 174 Back     information, alignment and structure
>d1q6za1 c.31.1.3 (A:182-341) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]} Length = 160 Back     information, alignment and structure
>d1pvda2 c.36.1.5 (A:2-181) Pyruvate decarboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 180 Back     information, alignment and structure
>d1pvda2 c.36.1.5 (A:2-181) Pyruvate decarboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 180 Back     information, alignment and structure
>d1ozha1 c.31.1.3 (A:188-366) Catabolic acetolactate synthase {Klebsiella pneumoniae [TaxId: 573]} Length = 179 Back     information, alignment and structure
>d1ybha1 c.31.1.3 (A:281-459) Acetohydroxyacid synthase catalytic subunit {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} Length = 179 Back     information, alignment and structure
>d1q6za2 c.36.1.5 (A:2-181) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]} Length = 180 Back     information, alignment and structure
>d1q6za2 c.36.1.5 (A:2-181) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]} Length = 180 Back     information, alignment and structure
>d1ovma1 c.31.1.3 (A:181-341) Indole-3-pyruvate decarboxylase {Enterobacter cloacae [TaxId: 550]} Length = 161 Back     information, alignment and structure
>d2ihta1 c.31.1.3 (A:198-374) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]} Length = 177 Back     information, alignment and structure
>d1pvda1 c.31.1.3 (A:182-360) Pyruvate decarboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 179 Back     information, alignment and structure
>d1ytla1 c.31.1.6 (A:17-174) Acetyl-CoA decarbonylase/synthase complex epsilon subunit 2, ACDE2 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 158 Back     information, alignment and structure
>d1ovma2 c.36.1.5 (A:3-180) Indole-3-pyruvate decarboxylase {Enterobacter cloacae [TaxId: 550]} Length = 178 Back     information, alignment and structure
>d1ovma2 c.36.1.5 (A:3-180) Indole-3-pyruvate decarboxylase {Enterobacter cloacae [TaxId: 550]} Length = 178 Back     information, alignment and structure
>d1zpda2 c.36.1.5 (A:2-187) Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 542]} Length = 186 Back     information, alignment and structure
>d1zpda2 c.36.1.5 (A:2-187) Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 542]} Length = 186 Back     information, alignment and structure
>d1zpda1 c.31.1.3 (A:188-362) Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 542]} Length = 175 Back     information, alignment and structure
>d2ez9a1 c.31.1.3 (A:183-365) Pyruvate oxidase {Lactobacillus plantarum [TaxId: 1590]} Length = 183 Back     information, alignment and structure
>d1t9ba1 c.31.1.3 (A:290-460) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 171 Back     information, alignment and structure
>d2djia1 c.31.1.3 (A:187-363) Pyruvate oxidase {Aerococcus viridans [TaxId: 1377]} Length = 177 Back     information, alignment and structure
>d1zpda3 c.36.1.9 (A:363-566) Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 542]} Length = 204 Back     information, alignment and structure
>d1pvda3 c.36.1.9 (A:361-556) Pyruvate decarboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 196 Back     information, alignment and structure
>d2ji7a3 c.36.1.9 (A:370-552) Oxalyl-CoA decarboxylase {Oxalobacter formigenes [TaxId: 847]} Length = 183 Back     information, alignment and structure
>d2ji7a3 c.36.1.9 (A:370-552) Oxalyl-CoA decarboxylase {Oxalobacter formigenes [TaxId: 847]} Length = 183 Back     information, alignment and structure
>d1ybha3 c.36.1.9 (A:460-667) Acetohydroxyacid synthase catalytic subunit {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} Length = 208 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1065
d2ez9a2174 Pyruvate oxidase {Lactobacillus plantarum [TaxId: 100.0
d1ozha2181 Catabolic acetolactate synthase {Klebsiella pneumo 100.0
d1t9ba2175 Acetohydroxyacid synthase catalytic subunit {Baker 100.0
d1ybha2195 Acetohydroxyacid synthase catalytic subunit {Thale 100.0
d2djia2184 Pyruvate oxidase {Aerococcus viridans [TaxId: 1377 100.0
d1q6za2180 Benzoylformate decarboxylase {Pseudomonas putida [ 100.0
d2ji7a2188 Oxalyl-CoA decarboxylase {Oxalobacter formigenes [ 100.0
d2ihta2186 Carboxyethylarginine synthase {Streptomyces clavul 100.0
d2ez9a2174 Pyruvate oxidase {Lactobacillus plantarum [TaxId: 100.0
d1ozha2181 Catabolic acetolactate synthase {Klebsiella pneumo 100.0
d2djia2184 Pyruvate oxidase {Aerococcus viridans [TaxId: 1377 100.0
d1ybha2195 Acetohydroxyacid synthase catalytic subunit {Thale 100.0
d1t9ba2175 Acetohydroxyacid synthase catalytic subunit {Baker 100.0
d2ji7a2188 Oxalyl-CoA decarboxylase {Oxalobacter formigenes [ 100.0
d1q6za2180 Benzoylformate decarboxylase {Pseudomonas putida [ 100.0
d1zpda2186 Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 100.0
d1pvda2180 Pyruvate decarboxylase {Baker's yeast (Saccharomyc 100.0
d2ihta2186 Carboxyethylarginine synthase {Streptomyces clavul 100.0
d1zpda2186 Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 99.97
d1ovma2178 Indole-3-pyruvate decarboxylase {Enterobacter cloa 99.97
d1pvda2180 Pyruvate decarboxylase {Baker's yeast (Saccharomyc 99.97
d1ovma2178 Indole-3-pyruvate decarboxylase {Enterobacter cloa 99.96
d2ji7a1175 Oxalyl-CoA decarboxylase {Oxalobacter formigenes [ 99.89
d1ybha3208 Acetohydroxyacid synthase catalytic subunit {Thale 99.89
d2ez9a1183 Pyruvate oxidase {Lactobacillus plantarum [TaxId: 99.88
d2ez9a3228 Pyruvate oxidase {Lactobacillus plantarum [TaxId: 99.88
d2djia1177 Pyruvate oxidase {Aerococcus viridans [TaxId: 1377 99.87
d1ybha1179 Acetohydroxyacid synthase catalytic subunit {Thale 99.87
d2djia3229 Pyruvate oxidase {Aerococcus viridans [TaxId: 1377 99.86
d1ozha3192 Catabolic acetolactate synthase {Klebsiella pneumo 99.86
d1ozha1179 Catabolic acetolactate synthase {Klebsiella pneumo 99.86
d1t9ba3227 Acetohydroxyacid synthase catalytic subunit {Baker 99.86
d2ihta1177 Carboxyethylarginine synthase {Streptomyces clavul 99.86
d1t9ba1171 Acetohydroxyacid synthase catalytic subunit {Baker 99.86
d2ji7a3183 Oxalyl-CoA decarboxylase {Oxalobacter formigenes [ 99.85
d1zpda3204 Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 99.85
d2ihta3198 Carboxyethylarginine synthase {Streptomyces clavul 99.84
d1q6za3183 Benzoylformate decarboxylase {Pseudomonas putida [ 99.84
d1ovma3196 Indole-3-pyruvate decarboxylase {Enterobacter cloa 99.8
d1pvda3196 Pyruvate decarboxylase {Baker's yeast (Saccharomyc 99.78
d1q6za1160 Benzoylformate decarboxylase {Pseudomonas putida [ 99.78
d1pvda1179 Pyruvate decarboxylase {Baker's yeast (Saccharomyc 99.77
d1zpda1175 Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 99.76
d1ovma1161 Indole-3-pyruvate decarboxylase {Enterobacter cloa 99.75
d2ihta3198 Carboxyethylarginine synthase {Streptomyces clavul 99.74
d1ybha3208 Acetohydroxyacid synthase catalytic subunit {Thale 99.73
d2ez9a3228 Pyruvate oxidase {Lactobacillus plantarum [TaxId: 99.71
d1t9ba3227 Acetohydroxyacid synthase catalytic subunit {Baker 99.67
d2djia3229 Pyruvate oxidase {Aerococcus viridans [TaxId: 1377 99.67
d1zpda3204 Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 99.65
d1pvda3196 Pyruvate decarboxylase {Baker's yeast (Saccharomyc 99.62
d1q6za3183 Benzoylformate decarboxylase {Pseudomonas putida [ 99.59
d2ji7a3183 Oxalyl-CoA decarboxylase {Oxalobacter formigenes [ 99.58
d1ozha3192 Catabolic acetolactate synthase {Klebsiella pneumo 99.57
d1ovma3196 Indole-3-pyruvate decarboxylase {Enterobacter cloa 99.53
d1ytla1158 Acetyl-CoA decarbonylase/synthase complex epsilon 99.39
d2c42a1257 Pyruvate-ferredoxin oxidoreductase, PFOR, domain I 97.68
d2c42a1257 Pyruvate-ferredoxin oxidoreductase, PFOR, domain I 97.44
d2r8oa2331 Transketolase (TK), PP module {Escherichia coli [T 97.32
d2c42a2 447 Pyruvate-ferredoxin oxidoreductase, PFOR, domains 97.28
d1umda_362 Branched-chain alpha-keto acid dehydrogenase, PP m 97.22
d2bfda1395 Branched-chain alpha-keto acid dehydrogenase, PP m 97.18
d1umda_362 Branched-chain alpha-keto acid dehydrogenase, PP m 97.17
d1qs0a_407 2-oxoisovalerate dehydrogenase (E1B), PP module {P 97.12
d1qs0a_407 2-oxoisovalerate dehydrogenase (E1B), PP module {P 97.08
d1w85a_365 Pyruvate dehydrogenase E1-alpha, PdhA {Bacillus st 96.79
d2bfda1395 Branched-chain alpha-keto acid dehydrogenase, PP m 96.78
d1w85a_365 Pyruvate dehydrogenase E1-alpha, PdhA {Bacillus st 96.72
d1gpua1335 Transketolase (TK), PP module {Baker's yeast (Sacc 96.68
d1r9ja2336 Transketolase (TK), PP module {Leishmania mexicana 96.64
d1itza1338 Transketolase (TK), PP module {Maize (Zea mays) [T 96.6
d2r8oa2331 Transketolase (TK), PP module {Escherichia coli [T 96.21
d2ozla1361 E1-beta subunit of pyruvate dehydrogenase (PP modu 96.17
d2ozla1361 E1-beta subunit of pyruvate dehydrogenase (PP modu 95.93
d1r9ja2336 Transketolase (TK), PP module {Leishmania mexicana 95.91
d1itza1338 Transketolase (TK), PP module {Maize (Zea mays) [T 95.89
d1gpua1335 Transketolase (TK), PP module {Baker's yeast (Sacc 95.82
d1efva2124 C-terminal domain of the electron transfer flavopr 95.47
d1gpua2197 Transketolase (TK), Pyr module {Baker's yeast (Sac 94.99
d1itza2192 Transketolase (TK), Pyr module {Maize (Zea mays) [ 94.51
d3clsd2123 C-terminal domain of the electron transfer flavopr 94.19
d2c42a2447 Pyruvate-ferredoxin oxidoreductase, PFOR, domains 93.72
d1j8fa_323 Sirt2 histone deacetylase {Human (Homo sapiens) [T 93.15
d1r9ja1190 Transketolase (TK), Pyr module {Leishmania mexican 92.82
d2r8oa1195 Transketolase (TK), Pyr module {Escherichia coli [ 90.72
d1pnoa_180 Transhydrogenase domain III (dIII) {Rhodospirillum 90.16
d1d4oa_177 Transhydrogenase domain III (dIII) {Cow (Bos tauru 89.84
d1s5pa_235 NAD-dependent deacetylase CobB {Escherichia coli [ 89.25
d2b4ya1267 NAD-dependent deacetylase sirtuin-5 {Human (Homo s 88.36
d1yc5a1245 NAD-dependent deacetylase NpdA {Thermotoga maritim 87.71
d1ma3a_252 AF0112, Sir2 homolog (Sir2-AF2) {Archaeon Archaeog 87.7
d1m2ka_249 AF1676, Sir2 homolog (Sir2-AF1?) {Archaeon Archaeo 87.54
d1q1aa_289 Hst2 {Baker's yeast (Saccharomyces cerevisiae) [Ta 86.06
d2ieaa2415 Pyruvate dehydrogenase E1 component, PP module {Es 84.83
d1gpua2197 Transketolase (TK), Pyr module {Baker's yeast (Sac 83.83
d2ieaa2415 Pyruvate dehydrogenase E1 component, PP module {Es 81.16
d1itza2192 Transketolase (TK), Pyr module {Maize (Zea mays) [ 80.48
>d2ez9a2 c.36.1.5 (A:9-182) Pyruvate oxidase {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Thiamin diphosphate-binding fold (THDP-binding)
superfamily: Thiamin diphosphate-binding fold (THDP-binding)
family: Pyruvate oxidase and decarboxylase Pyr module
domain: Pyruvate oxidase
species: Lactobacillus plantarum [TaxId: 1590]
Probab=100.00  E-value=2.3e-38  Score=323.89  Aligned_cols=169  Identities=26%  Similarity=0.415  Sum_probs=162.0

Q ss_pred             CccHHHHHHHHHHhcCceEEEeecCCchhhhHHHhh--cCCceEEEccCCchHHHHHHHHHHHhCCCeEEEEeccccccc
Q psy14416        266 ELSANQVIAQALKFQGIEYVFGIVGIPVIELAMACQ--QEGIHYIGMRNEQAACYAAQAIGYLTKKPGVCLVVSGPGLLH  343 (1065)
Q Consensus       266 ~~~~~~~l~~~L~~~GV~~vfg~pG~~~~~l~~al~--~~~i~~i~~~~E~~A~~~A~g~ar~tgkpgv~~~tsGpG~~N  343 (1065)
                      +|+++++|++.|+++||+++||+||+.+.+|++++.  +.+|++|.+|||++|+|||+||+|+||||++|++|+|||++|
T Consensus         2 ~m~~~~~i~~~L~~~Gv~~vFgipG~~~~~l~dal~~~~~~i~~i~~r~E~~A~~~A~gyar~tgk~gv~~~t~GpG~~N   81 (174)
T d2ez9a2           2 NILAGAAVIKVLEAWGVDHLYGIPGGSINSIMDALSAERDRIHYIQVRHEEVGAMAAAADAKLTGKIGVCFGSAGPGGTH   81 (174)
T ss_dssp             EEEHHHHHHHHHHHTTCCEEEECCCGGGHHHHHHHHHTTTTSEEEECSSHHHHHHHHHHHHHHHSSCEEEEECTTHHHHT
T ss_pred             CchHHHHHHHHHHHCCCCEEEEECCHhHHHHHHHHHhcCCCcEEEEecccchhHHHHHHHHhhcCceeEEeecccccccc
Confidence            578999999999999999999999999999999994  357999999999999999999999999999999999999999


Q ss_pred             cccccccccccCcceEeecCCCccCCCCCCCCCccChhhhhcccccEEeeCCChhhHHHHHHHHHHHhhcCCCCEEEEec
Q psy14416        344 TFGGMANAQINCWPMLVIGGSCAQDHEGIGGFQECPQVELARPYCKYSARPPNIHLIGQHVEKAVRLSTFGKPGVSYLDF  423 (1065)
Q Consensus       344 ~~~av~eA~~~~vPLlvItg~~p~~~~g~ga~Q~idQ~~l~~~~~k~s~~l~~~~~i~~~i~~A~~~A~~~~~GPV~L~i  423 (1065)
                      +++|+++|+.+++|||+|+|+.+....+++.+|++||.++++++|||+.++.+++++++.+++|++.|.+ +||||||+|
T Consensus        82 ~~~gl~~A~~~~~P~l~i~g~~~~~~~~~~~~Q~~d~~~~~~~itk~~~~v~~~~~~~~~i~~A~~~A~~-~pGPv~l~i  160 (174)
T d2ez9a2          82 LMNGLYDAREDHVPVLALIGQFGTTGMNMDTFQEMNENPIYADVADYNVTAVNAATLPHVIDEAIRRAYA-HQGVAVVQI  160 (174)
T ss_dssp             THHHHHHHHHTTCCEEEEEEECCTTTTTSCCTTCCCCHHHHTTTCSEEEECCCSTTHHHHHHHHHHHHHH-HTSEEEEEE
T ss_pred             hhhhHHHHHhcCccceeeeccccccccCccccccchhhhhhccccccccccccHHHHHHHHHHHHHHHhC-CCCCEEEEe
Confidence            9999999999999999999999999999999999999999999999999999999999999999999986 569999999


Q ss_pred             Chhhhhhccccc
Q psy14416        424 PANLLAQRINQS  435 (1065)
Q Consensus       424 P~Dv~~~~~~~~  435 (1065)
                      |.|++.++++.+
T Consensus       161 P~Dv~~~~i~~~  172 (174)
T d2ez9a2         161 PVDLPWQQIPAE  172 (174)
T ss_dssp             ETTGGGSEEETT
T ss_pred             CcccccCcCCcC
Confidence            999999988653



>d1ozha2 c.36.1.5 (A:7-187) Catabolic acetolactate synthase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1t9ba2 c.36.1.5 (A:89-263) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ybha2 c.36.1.5 (A:86-280) Acetohydroxyacid synthase catalytic subunit {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} Back     information, alignment and structure
>d2djia2 c.36.1.5 (A:3-186) Pyruvate oxidase {Aerococcus viridans [TaxId: 1377]} Back     information, alignment and structure
>d1q6za2 c.36.1.5 (A:2-181) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2ji7a2 c.36.1.5 (A:7-194) Oxalyl-CoA decarboxylase {Oxalobacter formigenes [TaxId: 847]} Back     information, alignment and structure
>d2ihta2 c.36.1.5 (A:12-197) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d2ez9a2 c.36.1.5 (A:9-182) Pyruvate oxidase {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d1ozha2 c.36.1.5 (A:7-187) Catabolic acetolactate synthase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2djia2 c.36.1.5 (A:3-186) Pyruvate oxidase {Aerococcus viridans [TaxId: 1377]} Back     information, alignment and structure
>d1ybha2 c.36.1.5 (A:86-280) Acetohydroxyacid synthase catalytic subunit {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} Back     information, alignment and structure
>d1t9ba2 c.36.1.5 (A:89-263) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ji7a2 c.36.1.5 (A:7-194) Oxalyl-CoA decarboxylase {Oxalobacter formigenes [TaxId: 847]} Back     information, alignment and structure
>d1q6za2 c.36.1.5 (A:2-181) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1zpda2 c.36.1.5 (A:2-187) Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1pvda2 c.36.1.5 (A:2-181) Pyruvate decarboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ihta2 c.36.1.5 (A:12-197) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d1zpda2 c.36.1.5 (A:2-187) Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1ovma2 c.36.1.5 (A:3-180) Indole-3-pyruvate decarboxylase {Enterobacter cloacae [TaxId: 550]} Back     information, alignment and structure
>d1pvda2 c.36.1.5 (A:2-181) Pyruvate decarboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ovma2 c.36.1.5 (A:3-180) Indole-3-pyruvate decarboxylase {Enterobacter cloacae [TaxId: 550]} Back     information, alignment and structure
>d2ji7a1 c.31.1.3 (A:195-369) Oxalyl-CoA decarboxylase {Oxalobacter formigenes [TaxId: 847]} Back     information, alignment and structure
>d1ybha3 c.36.1.9 (A:460-667) Acetohydroxyacid synthase catalytic subunit {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} Back     information, alignment and structure
>d2ez9a1 c.31.1.3 (A:183-365) Pyruvate oxidase {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d2ez9a3 c.36.1.9 (A:366-593) Pyruvate oxidase {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d2djia1 c.31.1.3 (A:187-363) Pyruvate oxidase {Aerococcus viridans [TaxId: 1377]} Back     information, alignment and structure
>d1ybha1 c.31.1.3 (A:281-459) Acetohydroxyacid synthase catalytic subunit {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} Back     information, alignment and structure
>d2djia3 c.36.1.9 (A:364-592) Pyruvate oxidase {Aerococcus viridans [TaxId: 1377]} Back     information, alignment and structure
>d1ozha3 c.36.1.9 (A:367-558) Catabolic acetolactate synthase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1ozha1 c.31.1.3 (A:188-366) Catabolic acetolactate synthase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1t9ba3 c.36.1.9 (A:461-687) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ihta1 c.31.1.3 (A:198-374) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d1t9ba1 c.31.1.3 (A:290-460) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ji7a3 c.36.1.9 (A:370-552) Oxalyl-CoA decarboxylase {Oxalobacter formigenes [TaxId: 847]} Back     information, alignment and structure
>d1zpda3 c.36.1.9 (A:363-566) Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d2ihta3 c.36.1.9 (A:375-572) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d1q6za3 c.36.1.9 (A:342-524) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ovma3 c.36.1.9 (A:356-551) Indole-3-pyruvate decarboxylase {Enterobacter cloacae [TaxId: 550]} Back     information, alignment and structure
>d1pvda3 c.36.1.9 (A:361-556) Pyruvate decarboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q6za1 c.31.1.3 (A:182-341) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1pvda1 c.31.1.3 (A:182-360) Pyruvate decarboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zpda1 c.31.1.3 (A:188-362) Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1ovma1 c.31.1.3 (A:181-341) Indole-3-pyruvate decarboxylase {Enterobacter cloacae [TaxId: 550]} Back     information, alignment and structure
>d2ihta3 c.36.1.9 (A:375-572) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d1ybha3 c.36.1.9 (A:460-667) Acetohydroxyacid synthase catalytic subunit {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} Back     information, alignment and structure
>d2ez9a3 c.36.1.9 (A:366-593) Pyruvate oxidase {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d1t9ba3 c.36.1.9 (A:461-687) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2djia3 c.36.1.9 (A:364-592) Pyruvate oxidase {Aerococcus viridans [TaxId: 1377]} Back     information, alignment and structure
>d1zpda3 c.36.1.9 (A:363-566) Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1pvda3 c.36.1.9 (A:361-556) Pyruvate decarboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q6za3 c.36.1.9 (A:342-524) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2ji7a3 c.36.1.9 (A:370-552) Oxalyl-CoA decarboxylase {Oxalobacter formigenes [TaxId: 847]} Back     information, alignment and structure
>d1ozha3 c.36.1.9 (A:367-558) Catabolic acetolactate synthase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1ovma3 c.36.1.9 (A:356-551) Indole-3-pyruvate decarboxylase {Enterobacter cloacae [TaxId: 550]} Back     information, alignment and structure
>d1ytla1 c.31.1.6 (A:17-174) Acetyl-CoA decarbonylase/synthase complex epsilon subunit 2, ACDE2 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2c42a1 c.36.1.8 (A:2-258) Pyruvate-ferredoxin oxidoreductase, PFOR, domain I {Desulfovibrio africanus [TaxId: 873]} Back     information, alignment and structure
>d2c42a1 c.36.1.8 (A:2-258) Pyruvate-ferredoxin oxidoreductase, PFOR, domain I {Desulfovibrio africanus [TaxId: 873]} Back     information, alignment and structure
>d2r8oa2 c.36.1.10 (A:2-332) Transketolase (TK), PP module {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c42a2 c.36.1.12 (A:786-1232) Pyruvate-ferredoxin oxidoreductase, PFOR, domains VI {Desulfovibrio africanus [TaxId: 873]} Back     information, alignment and structure
>d1umda_ c.36.1.11 (A:) Branched-chain alpha-keto acid dehydrogenase, PP module {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2bfda1 c.36.1.11 (A:6-400) Branched-chain alpha-keto acid dehydrogenase, PP module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1umda_ c.36.1.11 (A:) Branched-chain alpha-keto acid dehydrogenase, PP module {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qs0a_ c.36.1.11 (A:) 2-oxoisovalerate dehydrogenase (E1B), PP module {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1qs0a_ c.36.1.11 (A:) 2-oxoisovalerate dehydrogenase (E1B), PP module {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1w85a_ c.36.1.11 (A:) Pyruvate dehydrogenase E1-alpha, PdhA {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2bfda1 c.36.1.11 (A:6-400) Branched-chain alpha-keto acid dehydrogenase, PP module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w85a_ c.36.1.11 (A:) Pyruvate dehydrogenase E1-alpha, PdhA {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1gpua1 c.36.1.10 (A:3-337) Transketolase (TK), PP module {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r9ja2 c.36.1.10 (A:1-336) Transketolase (TK), PP module {Leishmania mexicana mexicana [TaxId: 44270]} Back     information, alignment and structure
>d1itza1 c.36.1.10 (A:10-347) Transketolase (TK), PP module {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2r8oa2 c.36.1.10 (A:2-332) Transketolase (TK), PP module {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ozla1 c.36.1.11 (A:1-361) E1-beta subunit of pyruvate dehydrogenase (PP module) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ozla1 c.36.1.11 (A:1-361) E1-beta subunit of pyruvate dehydrogenase (PP module) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r9ja2 c.36.1.10 (A:1-336) Transketolase (TK), PP module {Leishmania mexicana mexicana [TaxId: 44270]} Back     information, alignment and structure
>d1itza1 c.36.1.10 (A:10-347) Transketolase (TK), PP module {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1gpua1 c.36.1.10 (A:3-337) Transketolase (TK), PP module {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1efva2 c.31.1.2 (A:208-331) C-terminal domain of the electron transfer flavoprotein alpha subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gpua2 c.36.1.6 (A:338-534) Transketolase (TK), Pyr module {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1itza2 c.36.1.6 (A:348-539) Transketolase (TK), Pyr module {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d3clsd2 c.31.1.2 (D:196-318) C-terminal domain of the electron transfer flavoprotein alpha subunit {Methylophilus methylotrophus [TaxId: 17]} Back     information, alignment and structure
>d2c42a2 c.36.1.12 (A:786-1232) Pyruvate-ferredoxin oxidoreductase, PFOR, domains VI {Desulfovibrio africanus [TaxId: 873]} Back     information, alignment and structure
>d1j8fa_ c.31.1.5 (A:) Sirt2 histone deacetylase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r9ja1 c.36.1.6 (A:337-526) Transketolase (TK), Pyr module {Leishmania mexicana mexicana [TaxId: 44270]} Back     information, alignment and structure
>d2r8oa1 c.36.1.6 (A:333-527) Transketolase (TK), Pyr module {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pnoa_ c.31.1.4 (A:) Transhydrogenase domain III (dIII) {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1d4oa_ c.31.1.4 (A:) Transhydrogenase domain III (dIII) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1s5pa_ c.31.1.5 (A:) NAD-dependent deacetylase CobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b4ya1 c.31.1.5 (A:36-302) NAD-dependent deacetylase sirtuin-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yc5a1 c.31.1.5 (A:1-245) NAD-dependent deacetylase NpdA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ma3a_ c.31.1.5 (A:) AF0112, Sir2 homolog (Sir2-AF2) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1m2ka_ c.31.1.5 (A:) AF1676, Sir2 homolog (Sir2-AF1?) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1q1aa_ c.31.1.5 (A:) Hst2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ieaa2 c.36.1.10 (A:56-470) Pyruvate dehydrogenase E1 component, PP module {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gpua2 c.36.1.6 (A:338-534) Transketolase (TK), Pyr module {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ieaa2 c.36.1.10 (A:56-470) Pyruvate dehydrogenase E1 component, PP module {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1itza2 c.36.1.6 (A:348-539) Transketolase (TK), Pyr module {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure