Psyllid ID: psy14417

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120
MGKGVVPDAHPNCVSAARTHALQNADLVLLLGARLNWMLHFGRAPRFKSNVKIIQVDLNAEELHNSVQAAVAIQSDVRLTVQQLKQMLSHTQRNWSFSATSPWWQELKLKCQTNRQFKKQ
cccccccccccccccHHHHHHHccccEEEEEcccccccccccccccccccccEEEEEcccccccccccccccEEccHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHcccccccc
cccccccccccccHHHHHHHHHHHccEEEEEEccHcHHHHcccccccccccEEEEEEccHHHHcccccccccEEccHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHcc
mgkgvvpdahpncvSAARTHALQNADLVLLLGARLNWmlhfgraprfksnVKIIQVDLNAEELHNSVQAAVAIQSDVRLTVQQLKQMLSHTqrnwsfsatspwwQELKLKCQtnrqfkkq
mgkgvvpdAHPNCVSAARTHALQNADLVLLLGARLNWMLHFGRAPRFKSNVKIIQVDLNAEELHNSVQAAVAIQSDVRLTVQQLKQMLSHTQRNWSFSATSPWWQELKLKCQtnrqfkkq
MGKGVVPDAHPNCVSAARTHALQNADLVLLLGARLNWMLHFGRAPRFKSNVKIIQVDLNAEELHNSVQAAVAIQSDVRLTVQQLKQMLSHTQRNWSFSATSPWWQELKLKCQTNRQFKKQ
************CVSAARTHALQNADLVLLLGARLNWMLHFGRAPRFKSNVKIIQVDLNAEELHNSVQAAVAIQSDVRLTVQQLKQMLSHTQRNWSFSATSPWWQELKLKC*********
*GKGVVPDAHPNCVSAARTHALQNADLVLLLGARLNWMLHFGRAPRFKSNVKIIQVDLNAEELHNSVQAAVAIQSDVRLTVQQLKQMLSHT******SATSPWWQELKL***********
MGKGVVPDAHPNCVSAARTHALQNADLVLLLGARLNWMLHFGRAPRFKSNVKIIQVDLNAEELHNSVQAAVAIQSDVRLTVQQLKQMLSHTQRNWSFSATSPWWQELKLKCQTNRQFKKQ
*****VPDAHPNCVSAARTHALQNADLVLLLGARLNWMLHFGRAPRFKSNVKIIQVDLNAEELHNSVQAAVAIQSDVRLTVQQLKQMLSHTQRNWSFSATSPWWQELKLKCQTNRQ****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGKGVVPDAHPNCVSAARTHALQNADLVLLLGARLNWMLHFGRAPRFKSNVKIIQVDLNAEELHNSVQAAVAIQSDVRLTVQQLKQMLSHTQRNWSFSATSPWWQELKLKCQTNRQFKKQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query120 2.2.26 [Sep-21-2011]
Q9QXE0 581 2-hydroxyacyl-CoA lyase 1 yes N/A 0.983 0.203 0.483 7e-30
Q8CHM7 581 2-hydroxyacyl-CoA lyase 1 yes N/A 0.983 0.203 0.483 8e-30
Q9UJ83 578 2-hydroxyacyl-CoA lyase 1 yes N/A 0.983 0.204 0.491 2e-29
P39994 560 Putative 2-hydroxyacyl-Co yes N/A 0.933 0.2 0.432 2e-19
Q9Y7M1 568 Putative 2-hydroxyacyl-Co yes N/A 0.858 0.181 0.436 3e-19
Q54DA9 580 Probable 2-hydroxyacyl-Co yes N/A 0.733 0.151 0.456 8e-19
Q9LF46 572 2-hydroxyacyl-CoA lyase O yes N/A 0.525 0.110 0.492 8e-14
P0AFI0 564 Probable oxalyl-CoA decar N/A N/A 0.925 0.196 0.353 2e-10
P0AFI1 564 Probable oxalyl-CoA decar N/A N/A 0.925 0.196 0.353 2e-10
P40149 568 Oxalyl-CoA decarboxylase N/A N/A 0.916 0.193 0.310 8e-10
>sp|Q9QXE0|HACL1_MOUSE 2-hydroxyacyl-CoA lyase 1 OS=Mus musculus GN=Hacl1 PE=1 SV=2 Back     alignment and function desciption
 Score =  129 bits (323), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 58/120 (48%), Positives = 82/120 (68%), Gaps = 2/120 (1%)

Query: 1   MGKGVVPDAHPNCVSAARTHALQNADLVLLLGARLNWMLHFGRAPRFKSNVKIIQVDLNA 60
           MGKGVVPD HPNCV AAR+ ALQ+AD+++L GARLNW+LHFG  PR++++VK IQ+D+ A
Sbjct: 252 MGKGVVPDNHPNCVGAARSRALQSADVIVLFGARLNWILHFGLPPRYQADVKFIQIDICA 311

Query: 61  EELHNSVQAAVAIQSDVRLTVQQLKQMLSHTQRNWSFSATSPWWQELKLKCQTNRQFKKQ 120
           EEL N+V+ +V +  D+    +QL +    T   W     S WW+ L+ K ++N    K+
Sbjct: 312 EELGNNVRPSVILLGDIDAVSKQLLEQFDKTP--WQCPPDSQWWKTLREKMKSNEAISKE 369
Catalyzes a carbon-carbon cleavage reaction; cleaves a 2-hydroxy-3-methylacyl-CoA into formyl-CoA and a 2-methyl-branched fatty aldehyde.
Mus musculus (taxid: 10090)
EC: 4EC: .EC: 1EC: .EC: -EC: .EC: -
>sp|Q8CHM7|HACL1_RAT 2-hydroxyacyl-CoA lyase 1 OS=Rattus norvegicus GN=Hacl1 PE=1 SV=1 Back     alignment and function description
>sp|Q9UJ83|HACL1_HUMAN 2-hydroxyacyl-CoA lyase 1 OS=Homo sapiens GN=HACL1 PE=1 SV=2 Back     alignment and function description
>sp|P39994|YEC0_YEAST Putative 2-hydroxyacyl-CoA lyase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YEL020C PE=1 SV=1 Back     alignment and function description
>sp|Q9Y7M1|YGK4_SCHPO Putative 2-hydroxyacyl-CoA lyase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC725.04 PE=3 SV=1 Back     alignment and function description
>sp|Q54DA9|HACL1_DICDI Probable 2-hydroxyacyl-CoA lyase 1 OS=Dictyostelium discoideum GN=hacl1 PE=3 SV=1 Back     alignment and function description
>sp|Q9LF46|HACL_ARATH 2-hydroxyacyl-CoA lyase OS=Arabidopsis thaliana GN=HACL PE=2 SV=1 Back     alignment and function description
>sp|P0AFI0|OXC_ECOLI Probable oxalyl-CoA decarboxylase OS=Escherichia coli (strain K12) GN=oxc PE=1 SV=1 Back     alignment and function description
>sp|P0AFI1|OXC_ECO57 Probable oxalyl-CoA decarboxylase OS=Escherichia coli O157:H7 GN=oxc PE=3 SV=1 Back     alignment and function description
>sp|P40149|OXC_OXAFO Oxalyl-CoA decarboxylase OS=Oxalobacter formigenes GN=oxc PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query120
158289987 567 AGAP010368-PA [Anopheles gambiae str. PE 0.95 0.201 0.594 8e-35
157124089 567 2-hydroxyphytanoyl-coa lyase [Aedes aegy 0.983 0.208 0.591 1e-34
157106544 567 2-hydroxyphytanoyl-coa lyase [Aedes aegy 0.983 0.208 0.591 2e-34
340721824 566 PREDICTED: 2-hydroxyacyl-CoA lyase 1-lik 0.941 0.199 0.6 4e-34
195585025 540 GD25296 [Drosophila simulans] gi|1941943 0.941 0.209 0.591 4e-34
91088717 568 PREDICTED: similar to 2-hydroxyphytanoyl 0.95 0.200 0.603 5e-34
195336038 568 GM19803 [Drosophila sechellia] gi|194126 0.941 0.198 0.591 6e-34
19922626 568 CG11208 [Drosophila melanogaster] gi|730 0.941 0.198 0.591 6e-34
350408018 566 PREDICTED: 2-hydroxyacyl-CoA lyase 1-lik 0.941 0.199 0.6 6e-34
170066022 567 2-hydroxyphytanoyl-coa lyase [Culex quin 0.95 0.201 0.594 7e-34
>gi|158289987|ref|XP_311576.3| AGAP010368-PA [Anopheles gambiae str. PEST] gi|157018423|gb|EAA07115.3| AGAP010368-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
 Score =  150 bits (380), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 69/116 (59%), Positives = 89/116 (76%), Gaps = 2/116 (1%)

Query: 1   MGKGVVPDAHPNCVSAARTHALQNADLVLLLGARLNWMLHFGRAPRFKSNVKIIQVDLNA 60
           MGKGVVPD  P C++ ART ALQ AD+VLLLGARLNW+LHFGR PR+ S+VKIIQVD+NA
Sbjct: 238 MGKGVVPDLDPQCIAPARTLALQKADVVLLLGARLNWILHFGRPPRYSSDVKIIQVDVNA 297

Query: 61  EELHNSVQAAVAIQSDVRLTVQQLKQMLSHTQRNWSFSATSPWWQELKLKCQTNRQ 116
           EE+HNSV + VAIQS +    +QL   L+  + ++ F   + WW++LK KC+TNR+
Sbjct: 298 EEMHNSVPSKVAIQSHITPFTEQLIDALA--KNHFRFGYENAWWKDLKAKCETNRK 351

Source: Anopheles gambiae str. PEST

Species: Anopheles gambiae

Genus: Anopheles

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|157124089|ref|XP_001660326.1| 2-hydroxyphytanoyl-coa lyase [Aedes aegypti] gi|108874127|gb|EAT38352.1| AAEL009748-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|157106544|ref|XP_001649370.1| 2-hydroxyphytanoyl-coa lyase [Aedes aegypti] gi|108868813|gb|EAT33038.1| AAEL014707-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|340721824|ref|XP_003399314.1| PREDICTED: 2-hydroxyacyl-CoA lyase 1-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|195585025|ref|XP_002082295.1| GD25296 [Drosophila simulans] gi|194194304|gb|EDX07880.1| GD25296 [Drosophila simulans] Back     alignment and taxonomy information
>gi|91088717|ref|XP_975143.1| PREDICTED: similar to 2-hydroxyphytanoyl-coa lyase [Tribolium castaneum] gi|270011662|gb|EFA08110.1| hypothetical protein TcasGA2_TC005714 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|195336038|ref|XP_002034654.1| GM19803 [Drosophila sechellia] gi|194126624|gb|EDW48667.1| GM19803 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|19922626|ref|NP_611460.1| CG11208 [Drosophila melanogaster] gi|7302414|gb|AAF57501.1| CG11208 [Drosophila melanogaster] gi|16198201|gb|AAL13912.1| LD40177p [Drosophila melanogaster] gi|220946180|gb|ACL85633.1| CG11208-PA [synthetic construct] gi|220955878|gb|ACL90482.1| CG11208-PA [synthetic construct] Back     alignment and taxonomy information
>gi|350408018|ref|XP_003488274.1| PREDICTED: 2-hydroxyacyl-CoA lyase 1-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|170066022|ref|XP_001868099.1| 2-hydroxyphytanoyl-coa lyase [Culex quinquefasciatus] gi|167862705|gb|EDS26088.1| 2-hydroxyphytanoyl-coa lyase [Culex quinquefasciatus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query120
FB|FBgn0034488 568 CG11208 [Drosophila melanogast 0.941 0.198 0.591 6e-32
ZFIN|ZDB-GENE-040426-2058 568 hacl1 "2-hydroxyacyl-CoA lyase 0.975 0.205 0.546 2.9e-30
UNIPROTKB|E2R9K1 581 HACL1 "Uncharacterized protein 0.983 0.203 0.508 5.3e-29
UNIPROTKB|J9NS82 763 HACL1 "Uncharacterized protein 0.983 0.154 0.508 1.2e-28
UNIPROTKB|F1MVP8 581 HACL1 "Uncharacterized protein 0.983 0.203 0.5 1.1e-27
MGI|MGI:1929657 581 Hacl1 "2-hydroxyacyl-CoA lyase 0.983 0.203 0.483 2.3e-27
RGD|619849 581 Hacl1 "2-hydroxyacyl-CoA lyase 0.983 0.203 0.483 3e-27
UNIPROTKB|B4DXI5 496 HACL1 "2-hydroxyacyl-CoA lyase 0.983 0.237 0.491 4e-27
UNIPROTKB|B4DWI1 551 HACL1 "cDNA FLJ53672, highly s 0.983 0.214 0.491 6.8e-27
UNIPROTKB|Q9UJ83 578 HACL1 "2-hydroxyacyl-CoA lyase 0.983 0.204 0.491 8.1e-27
FB|FBgn0034488 CG11208 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 354 (129.7 bits), Expect = 6.0e-32, P = 6.0e-32
 Identities = 68/115 (59%), Positives = 87/115 (75%)

Query:     1 MGKGVVPDAHPNCVSAARTHALQNADLVLLLGARLNWMLHFGRAPRFKSNVKIIQVDLNA 60
             MGKGVV D  P CVS+ART ALQ AD+VLLLGARLNW+LHFG+APR+  +VK IQVD+N 
Sbjct:   239 MGKGVVSDTAPQCVSSARTLALQKADVVLLLGARLNWILHFGKAPRYDKDVKFIQVDINP 298

Query:    61 EELHNSVQAAVAIQSDVRLTVQQLKQMLSHTQRNWSFSATSPWWQELKLKCQTNR 115
             EELHNSV A+VAIQ+D+R   +QL + ++    N+ F     WW++L +KC+ NR
Sbjct:   299 EELHNSVVASVAIQADIRPFAEQLFEQMNAV--NFRFGYEQDWWKQLAVKCKQNR 351
GO:0008949 "oxalyl-CoA decarboxylase activity" evidence=ISS
GO:0000287 "magnesium ion binding" evidence=IEA
GO:0030976 "thiamine pyrophosphate binding" evidence=IEA
ZFIN|ZDB-GENE-040426-2058 hacl1 "2-hydroxyacyl-CoA lyase 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E2R9K1 HACL1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9NS82 HACL1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1MVP8 HACL1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1929657 Hacl1 "2-hydroxyacyl-CoA lyase 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|619849 Hacl1 "2-hydroxyacyl-CoA lyase 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|B4DXI5 HACL1 "2-hydroxyacyl-CoA lyase 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|B4DWI1 HACL1 "cDNA FLJ53672, highly similar to 2-hydroxyphytanoyl-CoA lyase (EC 4.1.-.-)" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UJ83 HACL1 "2-hydroxyacyl-CoA lyase 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query120
PRK09259 569 PRK09259, PRK09259, putative oxalyl-CoA decarboxyl 6e-30
pfam00205136 pfam00205, TPP_enzyme_M, Thiamine pyrophosphate en 5e-27
TIGR03254 554 TIGR03254, oxalate_oxc, oxalyl-CoA decarboxylase 6e-27
COG0028 550 COG0028, IlvB, Thiamine pyrophosphate-requiring en 6e-22
PRK08155 564 PRK08155, PRK08155, acetolactate synthase catalyti 5e-14
PRK07789 612 PRK07789, PRK07789, acetolactate synthase 1 cataly 9e-12
TIGR00118 558 TIGR00118, acolac_lg, acetolactate synthase, large 9e-11
PRK06048 561 PRK06048, PRK06048, acetolactate synthase 3 cataly 3e-10
PRK05858 542 PRK05858, PRK05858, hypothetical protein; Provisio 9e-10
PRK08266 542 PRK08266, PRK08266, hypothetical protein; Provisio 6e-09
PLN02470 585 PLN02470, PLN02470, acetolactate synthase 2e-08
CHL00099 585 CHL00099, ilvB, acetohydroxyacid synthase large su 3e-08
PRK08611 576 PRK08611, PRK08611, pyruvate oxidase; Provisional 3e-08
PRK07525 588 PRK07525, PRK07525, sulfoacetaldehyde acetyltransf 6e-08
TIGR03457 579 TIGR03457, sulphoacet_xsc, sulfoacetaldehyde acety 8e-08
PRK06965 587 PRK06965, PRK06965, acetolactate synthase 3 cataly 1e-07
PRK06276 586 PRK06276, PRK06276, acetolactate synthase catalyti 6e-07
PRK09124 574 PRK09124, PRK09124, pyruvate dehydrogenase; Provis 1e-06
PRK07524 535 PRK07524, PRK07524, hypothetical protein; Provisio 1e-06
PRK07979 574 PRK07979, PRK07979, acetolactate synthase 3 cataly 2e-06
PRK06725 570 PRK06725, PRK06725, acetolactate synthase 3 cataly 3e-06
PRK07064 544 PRK07064, PRK07064, hypothetical protein; Provisio 4e-06
PRK07418 616 PRK07418, PRK07418, acetolactate synthase 3 cataly 5e-06
PRK08978 548 PRK08978, PRK08978, acetolactate synthase 2 cataly 7e-06
PRK06457 549 PRK06457, PRK06457, pyruvate dehydrogenase; Provis 7e-06
PRK06466 574 PRK06466, PRK06466, acetolactate synthase 3 cataly 1e-05
PRK08322 547 PRK08322, PRK08322, acetolactate synthase; Reviewe 1e-05
PRK08527 563 PRK08527, PRK08527, acetolactate synthase 3 cataly 1e-05
PRK09107 595 PRK09107, PRK09107, acetolactate synthase 3 cataly 4e-05
PRK07282 566 PRK07282, PRK07282, acetolactate synthase catalyti 4e-05
PRK08979 572 PRK08979, PRK08979, acetolactate synthase 3 cataly 6e-05
PRK06882 574 PRK06882, PRK06882, acetolactate synthase 3 cataly 2e-04
PRK08327 569 PRK08327, PRK08327, acetolactate synthase catalyti 2e-04
PRK06154 565 PRK06154, PRK06154, hypothetical protein; Provisio 2e-04
PRK08199 557 PRK08199, PRK08199, thiamine pyrophosphate protein 5e-04
COG3960 592 COG3960, COG3960, Glyoxylate carboligase [General 8e-04
PRK06112 578 PRK06112, PRK06112, acetolactate synthase catalyti 8e-04
>gnl|CDD|236433 PRK09259, PRK09259, putative oxalyl-CoA decarboxylase; Validated Back     alignment and domain information 
 Score =  111 bits (280), Expect = 6e-30
 Identities = 42/114 (36%), Positives = 68/114 (59%), Gaps = 4/114 (3%)

Query: 1   MGKGVVPDAHPNCVSAARTHALQNADLVLLLGARLNWMLHFGRAPRFKSNVKIIQVDLNA 60
           M KG++PD HP   +AAR+ AL NAD+VLL+GARLNW+L  G+   + ++ K IQ+D+  
Sbjct: 249 MAKGLLPDTHPQSAAAARSLALANADVVLLVGARLNWLLSHGKGKTWGADKKFIQIDIEP 308

Query: 61  EELHNSVQAAVAIQSDVRLTVQQLKQMLSHTQRNWSFSATSPWWQELKLKCQTN 114
           +E+ ++   A  +  D+   +Q L   L+  ++N  F A + W   L  + + N
Sbjct: 309 QEIDSNRPIAAPVVGDIGSVMQAL---LAGLKQNT-FKAPAEWLDALAERKEKN 358

Length = 569
>gnl|CDD|215786 pfam00205, TPP_enzyme_M, Thiamine pyrophosphate enzyme, central domain Back     alignment and domain information
>gnl|CDD|132298 TIGR03254, oxalate_oxc, oxalyl-CoA decarboxylase Back     alignment and domain information
>gnl|CDD|223107 COG0028, IlvB, Thiamine pyrophosphate-requiring enzymes [acetolactate synthase, pyruvate dehydrogenase (cytochrome), glyoxylate carboligase, phosphonopyruvate decarboxylase] [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|181257 PRK08155, PRK08155, acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|236098 PRK07789, PRK07789, acetolactate synthase 1 catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|232833 TIGR00118, acolac_lg, acetolactate synthase, large subunit, biosynthetic type Back     alignment and domain information
>gnl|CDD|180368 PRK06048, PRK06048, acetolactate synthase 3 catalytic subunit; Reviewed Back     alignment and domain information
>gnl|CDD|235629 PRK05858, PRK05858, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|181337 PRK08266, PRK08266, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215261 PLN02470, PLN02470, acetolactate synthase Back     alignment and domain information
>gnl|CDD|214363 CHL00099, ilvB, acetohydroxyacid synthase large subunit Back     alignment and domain information
>gnl|CDD|181502 PRK08611, PRK08611, pyruvate oxidase; Provisional Back     alignment and domain information
>gnl|CDD|236042 PRK07525, PRK07525, sulfoacetaldehyde acetyltransferase; Validated Back     alignment and domain information
>gnl|CDD|132497 TIGR03457, sulphoacet_xsc, sulfoacetaldehyde acetyltransferase Back     alignment and domain information
>gnl|CDD|180780 PRK06965, PRK06965, acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|235766 PRK06276, PRK06276, acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>gnl|CDD|181661 PRK09124, PRK09124, pyruvate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236041 PRK07524, PRK07524, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|181185 PRK07979, PRK07979, acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|180672 PRK06725, PRK06725, acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|180820 PRK07064, PRK07064, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|236014 PRK07418, PRK07418, acetolactate synthase 3 catalytic subunit; Reviewed Back     alignment and domain information
>gnl|CDD|181601 PRK08978, PRK08978, acetolactate synthase 2 catalytic subunit; Reviewed Back     alignment and domain information
>gnl|CDD|180570 PRK06457, PRK06457, pyruvate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180578 PRK06466, PRK06466, acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|236239 PRK08322, PRK08322, acetolactate synthase; Reviewed Back     alignment and domain information
>gnl|CDD|181458 PRK08527, PRK08527, acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|236380 PRK09107, PRK09107, acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|180919 PRK07282, PRK07282, acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>gnl|CDD|181602 PRK08979, PRK08979, acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|168717 PRK06882, PRK06882, acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|236243 PRK08327, PRK08327, acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|235718 PRK06154, PRK06154, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|181285 PRK08199, PRK08199, thiamine pyrophosphate protein; Validated Back     alignment and domain information
>gnl|CDD|226469 COG3960, COG3960, Glyoxylate carboligase [General function prediction only] Back     alignment and domain information
>gnl|CDD|235700 PRK06112, PRK06112, acetolactate synthase catalytic subunit; Validated Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 120
KOG1185|consensus 571 99.86
PF00205137 TPP_enzyme_M: Thiamine pyrophosphate enzyme, centr 99.84
COG0028 550 IlvB Thiamine pyrophosphate-requiring enzymes [ace 99.79
TIGR03254 554 oxalate_oxc oxalyl-CoA decarboxylase. In a number 99.79
PRK08979 572 acetolactate synthase 3 catalytic subunit; Validat 99.78
PRK07979 574 acetolactate synthase 3 catalytic subunit; Validat 99.78
TIGR01504 588 glyox_carbo_lig glyoxylate carboligase. Glyoxylate 99.77
PRK09259 569 putative oxalyl-CoA decarboxylase; Validated 99.77
PRK07282 566 acetolactate synthase catalytic subunit; Reviewed 99.77
PRK07418 616 acetolactate synthase 3 catalytic subunit; Reviewe 99.76
PRK06725 570 acetolactate synthase 3 catalytic subunit; Validat 99.76
PRK09107 595 acetolactate synthase 3 catalytic subunit; Validat 99.75
PLN02470 585 acetolactate synthase 99.75
CHL00099 585 ilvB acetohydroxyacid synthase large subunit 99.75
PRK06154 565 hypothetical protein; Provisional 99.75
PRK06048 561 acetolactate synthase 3 catalytic subunit; Reviewe 99.75
PRK06466 574 acetolactate synthase 3 catalytic subunit; Validat 99.75
PRK08527 563 acetolactate synthase 3 catalytic subunit; Validat 99.74
PRK07789 612 acetolactate synthase 1 catalytic subunit; Validat 99.74
PRK06965 587 acetolactate synthase 3 catalytic subunit; Validat 99.73
PRK08155 564 acetolactate synthase catalytic subunit; Validated 99.73
PRK06882 574 acetolactate synthase 3 catalytic subunit; Validat 99.73
PRK11269 591 glyoxylate carboligase; Provisional 99.73
PRK07525 588 sulfoacetaldehyde acetyltransferase; Validated 99.73
PRK08273 597 thiamine pyrophosphate protein; Provisional 99.72
PRK07710 571 acetolactate synthase catalytic subunit; Reviewed 99.72
PRK08978 548 acetolactate synthase 2 catalytic subunit; Reviewe 99.72
TIGR00118 558 acolac_lg acetolactate synthase, large subunit, bi 99.71
PRK06276 586 acetolactate synthase catalytic subunit; Reviewed 99.71
PRK06112 578 acetolactate synthase catalytic subunit; Validated 99.71
KOG4166|consensus 675 99.7
PRK06456 572 acetolactate synthase catalytic subunit; Reviewed 99.7
PRK08199 557 thiamine pyrophosphate protein; Validated 99.7
PRK07524 535 hypothetical protein; Provisional 99.69
PRK05858 542 hypothetical protein; Provisional 99.69
TIGR03457 579 sulphoacet_xsc sulfoacetaldehyde acetyltransferase 99.69
PRK08611 576 pyruvate oxidase; Provisional 99.68
PRK07064 544 hypothetical protein; Provisional 99.67
PRK08266 542 hypothetical protein; Provisional 99.66
PRK06546 578 pyruvate dehydrogenase; Provisional 99.65
TIGR02720 575 pyruv_oxi_spxB pyruvate oxidase. Members of this f 99.65
TIGR02418 539 acolac_catab acetolactate synthase, catabolic. Ace 99.65
PRK09124 574 pyruvate dehydrogenase; Provisional 99.65
PRK08327 569 acetolactate synthase catalytic subunit; Validated 99.64
PRK08322 547 acetolactate synthase; Reviewed 99.64
PRK08617 552 acetolactate synthase; Reviewed 99.61
COG3960 592 Glyoxylate carboligase [General function predictio 99.59
PRK06457 549 pyruvate dehydrogenase; Provisional 99.55
TIGR03393 539 indolpyr_decarb indolepyruvate decarboxylase, Erwi 99.54
TIGR03394 535 indol_phenyl_DC indolepyruvate/phenylpyruvate deca 99.54
COG3962 617 Acetolactate synthase [Amino acid transport and me 99.54
PLN02573 578 pyruvate decarboxylase 99.51
PRK07092 530 benzoylformate decarboxylase; Reviewed 99.5
TIGR00173432 menD 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex 99.5
COG3961 557 Pyruvate decarboxylase and related thiamine pyroph 99.48
PRK07449 568 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1 99.47
KOG1184|consensus 561 99.14
PLN02980 1655 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi 99.08
PRK07586 514 hypothetical protein; Validated 98.43
PRK12474 518 hypothetical protein; Provisional 98.39
cd01408235 SIRT1 SIRT1: Eukaryotic group (class1) which inclu 98.24
PRK14138244 NAD-dependent deacetylase; Provisional 97.95
PRK05333285 NAD-dependent deacetylase; Provisional 97.8
PRK00481242 NAD-dependent deacetylase; Provisional 97.79
PTZ00408242 NAD-dependent deacetylase; Provisional 97.7
cd01409260 SIRT4 SIRT4: Eukaryotic and prokaryotic group (cla 97.62
cd01412224 SIRT5_Af1_CobB SIRT5_Af1_CobB: Eukaryotic, archaea 97.52
PTZ00409271 Sir2 (Silent Information Regulator) protein; Provi 97.49
COG0846250 SIR2 NAD-dependent protein deacetylases, SIR2 fami 97.27
cd01410206 SIRT7 SIRT7: Eukaryotic and prokaryotic group (cla 97.07
PTZ00410349 NAD-dependent SIR2; Provisional 97.07
PRK00945171 acetyl-CoA decarbonylase/synthase complex subunit 97.04
KOG2682|consensus314 96.83
cd01411225 SIR2H SIR2H: Uncharacterized prokaryotic Sir2 homo 96.5
KOG1905|consensus353 96.42
cd01413222 SIR2_Af2 SIR2_Af2: Archaeal and prokaryotic group 96.4
cd01407218 SIR2-fam SIR2 family of proteins includes silent i 96.26
cd00296222 SIR2 SIR2 superfamily of proteins includes silent 95.46
TIGR00315162 cdhB CO dehydrogenase/acetyl-CoA synthase complex, 95.13
TIGR00300407 conserved hypothetical protein TIGR00300. All memb 93.69
KOG2684|consensus412 93.46
COG1915415 Uncharacterized conserved protein [Function unknow 92.12
PRK03363313 fixB putative electron transfer flavoprotein FixB; 91.8
PRK11916312 electron transfer flavoprotein subunit YdiR; Provi 91.6
PLN00022356 electron transfer flavoprotein subunit alpha; Prov 91.35
COG2025313 FixB Electron transfer flavoprotein, alpha subunit 88.72
cd02759 477 MopB_Acetylene-hydratase The MopB_Acetylene-hydrat 81.97
>KOG1185|consensus Back     alignment and domain information 
Probab=99.86  E-value=4.7e-21  Score=143.68  Aligned_cols=116  Identities=50%  Similarity=0.831  Sum_probs=103.1

Q ss_pred             CCCCCCCCCCccccChHHHHhhhhcCEEEEeCCCCCcccccCCCCCCCCCCeEEEEcCChhhhhhc-cccceEEecCHHH
Q psy14417          1 MGKGVVPDAHPNCVSAARTHALQNADLVLLLGARLNWMLHFGRAPRFKSNVKIIQVDLNAEELHNS-VQAAVAIQSDVRL   79 (120)
Q Consensus         1 ~~kg~~~~~hp~~~G~~~~~~l~~aDlil~iG~~~~~~~~~~~~~~~~~~~~vi~Id~d~~~i~~~-~~~~~~i~~d~~~   79 (120)
                      ||||++|.+||++++.....+|+.||+||++|++++|...+|..+.|.++.++||||.++++++.+ ..++++|.||++.
T Consensus       253 MgKGll~d~hPl~v~~aRS~ALk~ADvvll~GarlnwiLhfG~~Pk~~kd~KfIqvd~n~Eel~~n~~k~~v~i~gDig~  332 (571)
T KOG1185|consen  253 MGKGLLPDNHPLNVSSARSLALKKADVVLLAGARLNWILHFGLPPKWSKDVKFIQVDINPEELGNNFVKPDVAIQGDIGL  332 (571)
T ss_pred             ccccCCCCCCchhhhHHHHHHHhhCCEEEEecceeeEEEecCCCCccCCCceEEEEeCCHHHHhcccCCCCceeeecHHH
Confidence            899999999999999888999999999999999999998888888898999999999999999998 6799999999999


Q ss_pred             HHHHHHHHhhhcccCCccCCCchHHHHHHHHHhhhhhhh
Q psy14417         80 TVQQLKQMLSHTQRNWSFSATSPWWQELKLKCQTNRQFK  118 (120)
Q Consensus        80 ~l~~L~~~l~~~~~~~~~~~~~~w~~~~~~~~~~~~~~~  118 (120)
                      ++..|.+.+.  ...|......+|.+++++..+++++.+
T Consensus       333 ~~~~L~e~l~--~~~~~~~~s~~w~k~Lrek~~~ne~~~  369 (571)
T KOG1185|consen  333 FVLQLVEELQ--DQPWTWGPSTDWVKELREKDKQNEAAV  369 (571)
T ss_pred             HHHHHHHHhc--CCCcccCCchhHHHHHHHHHHhhHHHH
Confidence            9999999997  322344455689999999887776654

>PF00205 TPP_enzyme_M: Thiamine pyrophosphate enzyme, central domain; InterPro: IPR012000 A number of enzymes require thiamine pyrophosphate (TPP) (vitamin B1) as a cofactor Back     alignment and domain information
>COG0028 IlvB Thiamine pyrophosphate-requiring enzymes [acetolactate synthase, pyruvate dehydrogenase (cytochrome), glyoxylate carboligase, phosphonopyruvate decarboxylase] [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>TIGR03254 oxalate_oxc oxalyl-CoA decarboxylase Back     alignment and domain information
>PRK08979 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK07979 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>TIGR01504 glyox_carbo_lig glyoxylate carboligase Back     alignment and domain information
>PRK09259 putative oxalyl-CoA decarboxylase; Validated Back     alignment and domain information
>PRK07282 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PRK07418 acetolactate synthase 3 catalytic subunit; Reviewed Back     alignment and domain information
>PRK06725 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK09107 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PLN02470 acetolactate synthase Back     alignment and domain information
>CHL00099 ilvB acetohydroxyacid synthase large subunit Back     alignment and domain information
>PRK06154 hypothetical protein; Provisional Back     alignment and domain information
>PRK06048 acetolactate synthase 3 catalytic subunit; Reviewed Back     alignment and domain information
>PRK06466 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK08527 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK07789 acetolactate synthase 1 catalytic subunit; Validated Back     alignment and domain information
>PRK06965 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK08155 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>PRK06882 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK11269 glyoxylate carboligase; Provisional Back     alignment and domain information
>PRK07525 sulfoacetaldehyde acetyltransferase; Validated Back     alignment and domain information
>PRK08273 thiamine pyrophosphate protein; Provisional Back     alignment and domain information
>PRK07710 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PRK08978 acetolactate synthase 2 catalytic subunit; Reviewed Back     alignment and domain information
>TIGR00118 acolac_lg acetolactate synthase, large subunit, biosynthetic type Back     alignment and domain information
>PRK06276 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PRK06112 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>KOG4166|consensus Back     alignment and domain information
>PRK06456 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PRK08199 thiamine pyrophosphate protein; Validated Back     alignment and domain information
>PRK07524 hypothetical protein; Provisional Back     alignment and domain information
>PRK05858 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03457 sulphoacet_xsc sulfoacetaldehyde acetyltransferase Back     alignment and domain information
>PRK08611 pyruvate oxidase; Provisional Back     alignment and domain information
>PRK07064 hypothetical protein; Provisional Back     alignment and domain information
>PRK08266 hypothetical protein; Provisional Back     alignment and domain information
>PRK06546 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02720 pyruv_oxi_spxB pyruvate oxidase Back     alignment and domain information
>TIGR02418 acolac_catab acetolactate synthase, catabolic Back     alignment and domain information
>PRK09124 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>PRK08327 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>PRK08322 acetolactate synthase; Reviewed Back     alignment and domain information
>PRK08617 acetolactate synthase; Reviewed Back     alignment and domain information
>COG3960 Glyoxylate carboligase [General function prediction only] Back     alignment and domain information
>PRK06457 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>TIGR03393 indolpyr_decarb indolepyruvate decarboxylase, Erwinia family Back     alignment and domain information
>TIGR03394 indol_phenyl_DC indolepyruvate/phenylpyruvate decarboxylase, Azospirillum family Back     alignment and domain information
>COG3962 Acetolactate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02573 pyruvate decarboxylase Back     alignment and domain information
>PRK07092 benzoylformate decarboxylase; Reviewed Back     alignment and domain information
>TIGR00173 menD 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase Back     alignment and domain information
>COG3961 Pyruvate decarboxylase and related thiamine pyrophosphate-requiring enzymes [Carbohydrate transport and metabolism / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>PRK07449 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase; Validated Back     alignment and domain information
>KOG1184|consensus Back     alignment and domain information
>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding Back     alignment and domain information
>PRK07586 hypothetical protein; Validated Back     alignment and domain information
>PRK12474 hypothetical protein; Provisional Back     alignment and domain information
>cd01408 SIRT1 SIRT1: Eukaryotic group (class1) which includes human sirtuins SIRT1-3 and yeast Hst1-4; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation Back     alignment and domain information
>PRK14138 NAD-dependent deacetylase; Provisional Back     alignment and domain information
>PRK05333 NAD-dependent deacetylase; Provisional Back     alignment and domain information
>PRK00481 NAD-dependent deacetylase; Provisional Back     alignment and domain information
>PTZ00408 NAD-dependent deacetylase; Provisional Back     alignment and domain information
>cd01409 SIRT4 SIRT4: Eukaryotic and prokaryotic group (class2) which includes human sirtuin SIRT4 and several bacterial homologs; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation Back     alignment and domain information
>cd01412 SIRT5_Af1_CobB SIRT5_Af1_CobB: Eukaryotic, archaeal and prokaryotic group (class3) which includes human sirtuin SIRT5, Archaeoglobus fulgidus Sir2-Af1, and E Back     alignment and domain information
>PTZ00409 Sir2 (Silent Information Regulator) protein; Provisional Back     alignment and domain information
>COG0846 SIR2 NAD-dependent protein deacetylases, SIR2 family [Transcription] Back     alignment and domain information
>cd01410 SIRT7 SIRT7: Eukaryotic and prokaryotic group (class4) which includes human sirtuin SIRT6, SIRT7, and several bacterial homologs; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation Back     alignment and domain information
>PTZ00410 NAD-dependent SIR2; Provisional Back     alignment and domain information
>PRK00945 acetyl-CoA decarbonylase/synthase complex subunit epsilon; Provisional Back     alignment and domain information
>KOG2682|consensus Back     alignment and domain information
>cd01411 SIR2H SIR2H: Uncharacterized prokaryotic Sir2 homologs from several gram positive bacterial species and Fusobacteria; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation Back     alignment and domain information
>KOG1905|consensus Back     alignment and domain information
>cd01413 SIR2_Af2 SIR2_Af2: Archaeal and prokaryotic group which includes Archaeoglobus fulgidus Sir2-Af2, Sulfolobus solfataricus ssSir2, and several bacterial homologs; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation Back     alignment and domain information
>cd01407 SIR2-fam SIR2 family of proteins includes silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation, where the acetyl group from the lysine epsilon-amino group is transferred to the ADP-ribose moiety of NAD+, producing nicotinamide and the novel metabolite O-acetyl-ADP-ribose Back     alignment and domain information
>cd00296 SIR2 SIR2 superfamily of proteins includes silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation, where the acetyl group from the lysine epsilon-amino group is transferred to the ADP-ribose moiety of NAD+, producing nicotinamide and the novel metabolite O-acetyl-ADP-ribose Back     alignment and domain information
>TIGR00315 cdhB CO dehydrogenase/acetyl-CoA synthase complex, epsilon subunit Back     alignment and domain information
>TIGR00300 conserved hypothetical protein TIGR00300 Back     alignment and domain information
>KOG2684|consensus Back     alignment and domain information
>COG1915 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK03363 fixB putative electron transfer flavoprotein FixB; Provisional Back     alignment and domain information
>PRK11916 electron transfer flavoprotein subunit YdiR; Provisional Back     alignment and domain information
>PLN00022 electron transfer flavoprotein subunit alpha; Provisional Back     alignment and domain information
>COG2025 FixB Electron transfer flavoprotein, alpha subunit [Energy production and conversion] Back     alignment and domain information
>cd02759 MopB_Acetylene-hydratase The MopB_Acetylene-hydratase CD contains acetylene hydratase (Ahy) and other related proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query120
2q27_A 564 Crystal Structure Of Oxalyl-Coa Decarboxylase From 2e-11
2c31_A 568 Crystal Structure Of Oxalyl-Coa Decarboxylase In Co 6e-11
1ybh_A 590 Crystal Structure Of Arabidopsis Thaliana Acetohydr 2e-04
3e9y_A 584 Arabidopsis Thaliana Acetohydroxyacid Synthase In C 2e-04
>pdb|2Q27|A Chain A, Crystal Structure Of Oxalyl-Coa Decarboxylase From Escherichia Coli Length = 564 Back     alignment and structure 
Iteration: 1

 Score = 64.3 bits (155), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 41/116 (35%), Positives = 70/116 (60%), Gaps = 5/116 (4%)
Query: 1   MGKGVVPDAHPNCVSAARTHALQNADLVLLLGARLNWMLHFGRAPRFKSNVKIIQVDLNA 60
           M KG++ D HP   +AAR+ AL NAD+V+L+GARLNW+L  G+   + ++ + IQ+D+  
Sbjct: 247 MAKGILEDTHPLSAAAARSFALANADVVMLVGARLNWLLAHGKKG-WAADTQFIQLDIEP 305
Query: 61  EELHNSVQAAVAIQSDVRLTVQQLKQMLSHTQRNWSFSATSPWWQELKLKCQTNRQ 116
           +E+ ++   AV +  D+  ++Q    ML+  ++N +F+    W   L +  Q N Q
Sbjct: 306 QEIDSNRPIAVPVVGDIASSMQ---GMLAELKQN-TFTTPLVWRDILNIHKQQNAQ 357
>pdb|2C31|A Chain A, Crystal Structure Of Oxalyl-Coa Decarboxylase In Complex With The Cofactor Derivative Thiamin-2-Thiazolone Diphosphate And Adenosine Diphosphate Length = 568 Back     alignment and structure
>pdb|1YBH|A Chain A, Crystal Structure Of Arabidopsis Thaliana Acetohydroxyacid Synthase In Complex With A Sulfonylurea Herbicide Chlorimuron Ethyl Length = 590 Back     alignment and structure
>pdb|3E9Y|A Chain A, Arabidopsis Thaliana Acetohydroxyacid Synthase In Complex With Monosulfuron Length = 584 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query120
2c31_A 568 Oxalyl-COA decarboxylase; oxalate, thiamin diphosp 7e-29
2q28_A 564 Oxalyl-COA decarboxylase; lyase, oxalate degradati 8e-23
4feg_A 603 Pyruvate oxidase; carbanion, structure activity re 3e-16
1ybh_A 590 Acetolactate synthase, chloroplast; acetohydroxyac 4e-16
3eya_A 549 Pyruvate dehydrogenase [cytochrome]; pyruvate oxid 5e-16
1v5e_A 590 Pyruvate oxidase; oxidoreductase, flavoprotein; HE 6e-16
2pan_A 616 Glyoxylate carboligase; thiamin-diphosphate (THDP) 3e-15
2uz1_A 563 Benzaldehyde lyase; thiamine diphosphate, thiamine 4e-15
2iht_A 573 Carboxyethylarginine synthase; thiamin diphosphate 2e-14
2pgn_A 589 Cyclohexane-1,2-dione hydrolase (CDH); three alpha 4e-14
2nxw_A 565 Phenyl-3-pyruvate decarboxylase; thiamine pyrophos 6e-14
1t9b_A 677 Acetolactate synthase, mitochondrial; acetohydroxy 2e-11
1ozh_A 566 ALS, acetolactate synthase, catabolic; acetohydrox 4e-11
1q6z_A 528 BFD, BFDC, benzoylformate decarboxylase; lyase, ca 1e-10
2vbi_A 566 Pyruvate decarboxylase; thiamine pyrophosphate, ly 1e-08
2wvg_A 568 PDC, pyruvate decarboxylase; thiamine diphosphate, 2e-08
2vk8_A 563 Pyruvate decarboxylase isozyme 1; asymmetric activ 3e-08
1ovm_A 552 Indole-3-pyruvate decarboxylase; thiamine diphosph 3e-08
2vbf_A 570 Branched-chain alpha-ketoacid decarboxylase; KDCA, 7e-07
>2c31_A Oxalyl-COA decarboxylase; oxalate, thiamin diphosphate, flavoprotein, lyase, thiamine pyrophosphate; HET: TZD ADP; 1.73A {Oxalobacter formigenes} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 2ji6_A* 2ji7_A* 2ji8_A* 2ji9_A* 2jib_A* Length = 568 Back     alignment and structure
 Score =  107 bits (271), Expect = 7e-29
 Identities = 36/117 (30%), Positives = 61/117 (52%), Gaps = 6/117 (5%)

Query: 1   MGKGVVPDAHPNCVSAARTHALQNADLVLLLGARLNWMLHFGRAPRFKSNV-KIIQVDLN 59
           M KG++PD HP   +A R  AL   D+ +L+GARLNW++  G+   +   + K +Q+D+ 
Sbjct: 249 MAKGLLPDNHPQSAAATRAFALAQCDVCVLIGARLNWLMQHGKGKTWGDELKKYVQIDIQ 308

Query: 60  AEELHNSVQAAVAIQSDVRLTVQQLKQMLSHTQRNWSFSATSPWWQELKLKCQTNRQ 116
           A E+ ++   A  +  D++  V  L++ L    +     A + W   LK K   N+ 
Sbjct: 309 ANEMDSNQPIAAPVVGDIKSAVSLLRKALKGAPK-----ADAEWTGALKAKVDGNKA 360
>2q28_A Oxalyl-COA decarboxylase; lyase, oxalate degradation, thiami diphosphate, lyase; HET: TPP ADP MES; 1.74A {Escherichia coli} PDB: 2q27_A* 2q29_A* Length = 564 Back     alignment and structure
>4feg_A Pyruvate oxidase; carbanion, structure activity relationship, oxidation-reduct umpolung, thiamine diphosphate, reaction intermediate; HET: TDM FAD GOL; 1.09A {Lactobacillus plantarum} PDB: 4fee_A* 1y9d_A* 2ez9_A* 2ez4_A* 2ez8_A* 2ezt_A* 2ezu_A* 1pow_A* 1pox_A* Length = 603 Back     alignment and structure
>3eya_A Pyruvate dehydrogenase [cytochrome]; pyruvate oxidase, membrane-associated flavoprotein dehydrogenase, interactions with lipids cell membrane; HET: TDP FAD; 2.50A {Escherichia coli} PDB: 3ey9_A* Length = 549 Back     alignment and structure
>1v5e_A Pyruvate oxidase; oxidoreductase, flavoprotein; HET: FAD; 1.60A {Aerococcus viridans} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 2dji_A* 1v5f_A* 1v5g_A* Length = 590 Back     alignment and structure
>2pan_A Glyoxylate carboligase; thiamin-diphosphate (THDP), thimain-dependent enzymes, FAD, lyase; HET: FAD TDP 1PE; 2.70A {Escherichia coli} Length = 616 Back     alignment and structure
>2uz1_A Benzaldehyde lyase; thiamine diphosphate, thiamine pyrophosphate, benzoin, flavoprotein; HET: TPP; 1.65A {Pseudomonas fluorescens} PDB: 2ag1_A* 2ag0_A* 2uz1_B* 3iae_A* 3iaf_A* 3d7k_A* Length = 563 Back     alignment and structure
>2iht_A Carboxyethylarginine synthase; thiamin diphosphate complex, transferase; HET: MSE TPP; 2.00A {Streptomyces clavuligerus} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1upb_A* 1upc_A* 1upa_A* 2ihu_A* 2ihv_A* Length = 573 Back     alignment and structure
>2pgn_A Cyclohexane-1,2-dione hydrolase (CDH); three alpha/beta domains; HET: P6G FAD TPP; 1.20A {Azoarcus SP} PDB: 2pgo_A* Length = 589 Back     alignment and structure
>2nxw_A Phenyl-3-pyruvate decarboxylase; thiamine pyrophosphate, asymmetric dimer of dimers, open ACT loops, lyase; HET: TPP; 1.50A {Azospirillum brasilense} PDB: 2q5j_A* 2q5l_A* 2q5o_A* 2q5q_A* Length = 565 Back     alignment and structure
>1t9b_A Acetolactate synthase, mitochondrial; acetohydroxyacid synthase, herbicide, sulfonylurea, thiamin diphosphate, FAD, inhibitor; HET: 1CS P25 FAD NSP P22 YF3; 2.20A {Saccharomyces cerevisiae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1n0h_A* 1t9a_A* 1t9c_A* 1t9d_A* 1jsc_A* Length = 677 Back     alignment and structure
>1ozh_A ALS, acetolactate synthase, catabolic; acetohydroxyacid synthase, thiamin diphosphate, lyase; HET: PGE HE3; 2.00A {Klebsiella pneumoniae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1ozg_A* 1ozf_A* Length = 566 Back     alignment and structure
>1q6z_A BFD, BFDC, benzoylformate decarboxylase; lyase, carbon-carbon, mandelate catabolism, T thiazolone diphosphate, inhibitor, high resolution; HET: TZD; 1.00A {Pseudomonas putida} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1po7_A* 1pi3_A* 3fsj_X* 1mcz_A* 1bfd_A* 2fwn_A* 3fzn_A* 2fn3_A* 2v3w_A* 1yno_A* 3f6b_X* 3f6e_X* Length = 528 Back     alignment and structure
>2vbi_A Pyruvate decarboxylase; thiamine pyrophosphate, lyase, pyruv flavoprotein, THDP-dependent enzyme; HET: TPP; 2.75A {Acetobacter pasteurianus} Length = 566 Back     alignment and structure
>2wvg_A PDC, pyruvate decarboxylase; thiamine diphosphate, lyase, flavoprotein, metal-binding, alcohol fermentation; HET: TPU; 1.75A {Zymomonas mobilis} PDB: 2wva_A* 2wvh_A 3oe1_A* 1zpd_A* Length = 568 Back     alignment and structure
>2vk8_A Pyruvate decarboxylase isozyme 1; asymmetric active sites, phenylalanine catabolism, tryptophan catabolism, thiamine pyrophosphate; HET: TPP; 1.42A {Saccharomyces cerevisiae} PDB: 1qpb_A* 2vk1_A* 2w93_A* 1pyd_A* 1pvd_A* 2vk4_A* 2vjy_A* 2g1i_A* Length = 563 Back     alignment and structure
>1ovm_A Indole-3-pyruvate decarboxylase; thiamine diphosphate, indole-3-acetic acid, TDP dependent enzyme, lyase; HET: TPP; 2.65A {Enterobacter cloacae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 Length = 552 Back     alignment and structure
>2vbf_A Branched-chain alpha-ketoacid decarboxylase; KDCA, flavoprotein, THDP-dependent enzymes, thiamine pyrophosphate, lyase; HET: TPP; 1.60A {Lactococcus lactis} PDB: 2vbg_A* Length = 570 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query120
2q28_A 564 Oxalyl-COA decarboxylase; lyase, oxalate degradati 99.74
2c31_A 568 Oxalyl-COA decarboxylase; oxalate, thiamin diphosp 99.74
4feg_A 603 Pyruvate oxidase; carbanion, structure activity re 99.7
1ybh_A 590 Acetolactate synthase, chloroplast; acetohydroxyac 99.67
1t9b_A 677 Acetolactate synthase, mitochondrial; acetohydroxy 99.66
3eya_A 549 Pyruvate dehydrogenase [cytochrome]; pyruvate oxid 99.64
1v5e_A 590 Pyruvate oxidase; oxidoreductase, flavoprotein; HE 99.63
2pgn_A 589 Cyclohexane-1,2-dione hydrolase (CDH); three alpha 99.63
2uz1_A 563 Benzaldehyde lyase; thiamine diphosphate, thiamine 99.62
2pan_A 616 Glyoxylate carboligase; thiamin-diphosphate (THDP) 99.59
2iht_A 573 Carboxyethylarginine synthase; thiamin diphosphate 99.56
1ozh_A 566 ALS, acetolactate synthase, catabolic; acetohydrox 99.56
1q6z_A 528 BFD, BFDC, benzoylformate decarboxylase; lyase, ca 99.55
3lq1_A 578 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 99.5
3hww_A 556 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 99.46
2vk8_A 563 Pyruvate decarboxylase isozyme 1; asymmetric activ 99.39
2x7j_A 604 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene - 99.35
1ovm_A 552 Indole-3-pyruvate decarboxylase; thiamine diphosph 99.34
2wvg_A 568 PDC, pyruvate decarboxylase; thiamine diphosphate, 99.32
2vbi_A 566 Pyruvate decarboxylase; thiamine pyrophosphate, ly 99.3
2vbf_A 570 Branched-chain alpha-ketoacid decarboxylase; KDCA, 99.27
2nxw_A 565 Phenyl-3-pyruvate decarboxylase; thiamine pyrophos 99.17
3cf4_G170 Acetyl-COA decarboxylase/synthase epsilon subunit; 99.15
1ytl_A174 Acetyl-COA decarboxylase/synthase complex epsilon 98.77
3glr_A285 NAD-dependent deacetylase sirtuin-3, mitochondria; 98.53
1j8f_A323 SIRT2, sirtuin 2, isoform 1, silencing INFO; gene 98.23
2hjh_A354 NAD-dependent histone deacetylase SIR2; protein, s 98.06
4iao_A492 NAD-dependent histone deacetylase SIR2; protein co 98.04
1q1a_A289 HST2 protein; ternary complex, histone deacetylase 97.97
3pki_A355 NAD-dependent deacetylase sirtuin-6; ADP ribose, s 97.95
1q14_A361 HST2 protein; histone deacetylase, hydrolase; 2.50 97.94
1s5p_A235 NAD-dependent deacetylase; protein deacetylase, SI 97.88
3k35_A318 NAD-dependent deacetylase sirtuin-6; rossmann fold 97.86
3riy_A273 NAD-dependent deacetylase sirtuin-5; desuccinylase 97.79
1m2k_A249 Silent information regulator 2; protein-ligand com 97.74
1yc5_A246 NAD-dependent deacetylase; SIR2, sirtuin, SIR2TM, 97.73
1ma3_A253 SIR2-AF2, transcriptional regulatory protein, SIR2 97.7
3u31_A290 SIR2A, transcriptional regulatory protein SIR2 hom 97.3
3c2q_A345 Uncharacterized conserved protein; putative LOR/SD 95.16
1o97_D320 Electron transferring flavoprotein alpha-subunit; 92.6
1efv_A315 Electron transfer flavoprotein; electron transport 90.75
1efp_A307 ETF, protein (electron transfer flavoprotein); ele 89.54
2f62_A161 Nucleoside 2-deoxyribosyltransferase; SGPP, struct 82.46
>2q28_A Oxalyl-COA decarboxylase; lyase, oxalate degradation, thiami diphosphate, lyase; HET: TPP ADP MES; 1.74A {Escherichia coli} PDB: 2q27_A* 2q29_A* Back     alignment and structure
Probab=99.74  E-value=2.6e-17  Score=126.92  Aligned_cols=109  Identities=35%  Similarity=0.646  Sum_probs=88.9

Q ss_pred             CCCCCCCCCCccccChHHHHhhhhcCEEEEeCCCCCcccccCCCCCCCCCCeEEEEcCChhhhhhccccceEEecCHHHH
Q psy14417          1 MGKGVVPDAHPNCVSAARTHALQNADLVLLLGARLNWMLHFGRAPRFKSNVKIIQVDLNAEELHNSVQAAVAIQSDVRLT   80 (120)
Q Consensus         1 ~~kg~~~~~hp~~~G~~~~~~l~~aDlil~iG~~~~~~~~~~~~~~~~~~~~vi~Id~d~~~i~~~~~~~~~i~~d~~~~   80 (120)
                      +|||+||++||+|+|...++++++|||||+||+++.+..+++. ..+.+++++||||.|+.+++++++.++.++||++.+
T Consensus       247 ~~~g~~~~~hp~~~G~~~~~~l~~aDlvl~iG~~~~~~~~~~~-~~~~~~~~~i~id~d~~~~~~~~~~~~~i~~d~~~~  325 (564)
T 2q28_A          247 MAKGILEDTHPLSAAAARSFALANADVVMLVGARLNWLLAHGK-KGWAADTQFIQLDIEPQEIDSNRPIAVPVVGDIASS  325 (564)
T ss_dssp             GGTTSSCTTCTTBCGGGHHHHHHHCSEEEEESCCCSGGGGGGT-TTSCTTCEEEEEESCGGGTTSSSCCSEEEESCHHHH
T ss_pred             CccccCCCCChhhcChHHHhHhhcCCEEEEECCcccccccccc-cccCCCCeEEEEeCCHHHhcCCCCCCeEEEcCHHHH
Confidence            5899999999999999888899999999999999987544443 445567899999999999999999999999999999


Q ss_pred             HHHHHHHhhhcccCCccCCCchHHHHHHHHHhhh
Q psy14417         81 VQQLKQMLSHTQRNWSFSATSPWWQELKLKCQTN  114 (120)
Q Consensus        81 l~~L~~~l~~~~~~~~~~~~~~w~~~~~~~~~~~  114 (120)
                      |++|++.+..+.    .....+|.++++++++.+
T Consensus       326 l~~L~~~l~~~~----~~~~~~w~~~~~~~~~~~  355 (564)
T 2q28_A          326 MQGMLAELKQNT----FTTPLVWRDILNIHKQQN  355 (564)
T ss_dssp             HHHHHHHHHHSC----CCCCHHHHHHHHHHHHHH
T ss_pred             HHHHHHHhhhcC----cCCcHHHHHHHHHHHHhh
Confidence            999998876211    112456887777665543
>2c31_A Oxalyl-COA decarboxylase; oxalate, thiamin diphosphate, flavoprotein, lyase, thiamine pyrophosphate; HET: TZD ADP; 1.73A {Oxalobacter formigenes} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 2ji6_A* 2ji7_A* 2ji8_A* 2ji9_A* 2jib_A* Back     alignment and structure
>4feg_A Pyruvate oxidase; carbanion, structure activity relationship, oxidation-reduct umpolung, thiamine diphosphate, reaction intermediate; HET: TDM FAD GOL; 1.09A {Lactobacillus plantarum} PDB: 4fee_A* 1y9d_A* 2ez9_A* 2ez4_A* 2ez8_A* 2ezt_A* 2ezu_A* 1pow_A* 1pox_A* Back     alignment and structure
>1t9b_A Acetolactate synthase, mitochondrial; acetohydroxyacid synthase, herbicide, sulfonylurea, thiamin diphosphate, FAD, inhibitor; HET: 1CS P25 FAD NSP P22 YF3; 2.20A {Saccharomyces cerevisiae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1n0h_A* 1t9a_A* 1t9c_A* 1t9d_A* 1jsc_A* Back     alignment and structure
>3eya_A Pyruvate dehydrogenase [cytochrome]; pyruvate oxidase, membrane-associated flavoprotein dehydrogenase, interactions with lipids cell membrane; HET: TDP FAD; 2.50A {Escherichia coli} PDB: 3ey9_A* Back     alignment and structure
>1v5e_A Pyruvate oxidase; oxidoreductase, flavoprotein; HET: FAD; 1.60A {Aerococcus viridans} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 2dji_A* 1v5f_A* 1v5g_A* Back     alignment and structure
>2pgn_A Cyclohexane-1,2-dione hydrolase (CDH); three alpha/beta domains; HET: P6G FAD TPP; 1.20A {Azoarcus SP} PDB: 2pgo_A* Back     alignment and structure
>2uz1_A Benzaldehyde lyase; thiamine diphosphate, thiamine pyrophosphate, benzoin, flavoprotein; HET: TPP; 1.65A {Pseudomonas fluorescens} PDB: 2ag1_A* 2ag0_A* 2uz1_B* 3iae_A* 3iaf_A* 3d7k_A* Back     alignment and structure
>2pan_A Glyoxylate carboligase; thiamin-diphosphate (THDP), thimain-dependent enzymes, FAD, lyase; HET: FAD TDP 1PE; 2.70A {Escherichia coli} Back     alignment and structure
>2iht_A Carboxyethylarginine synthase; thiamin diphosphate complex, transferase; HET: MSE TPP; 2.00A {Streptomyces clavuligerus} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1upb_A* 1upc_A* 1upa_A* 2ihu_A* 2ihv_A* Back     alignment and structure
>1ozh_A ALS, acetolactate synthase, catabolic; acetohydroxyacid synthase, thiamin diphosphate, lyase; HET: PGE HE3; 2.00A {Klebsiella pneumoniae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1ozg_A* 1ozf_A* Back     alignment and structure
>1q6z_A BFD, BFDC, benzoylformate decarboxylase; lyase, carbon-carbon, mandelate catabolism, T thiazolone diphosphate, inhibitor, high resolution; HET: TZD; 1.00A {Pseudomonas putida} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1po7_A* 1pi3_A* 3fsj_X* 1mcz_A* 1bfd_A* 2fwn_A* 3fzn_A* 2fn3_A* 2v3w_A* 1yno_A* 3f6b_X* 3f6e_X* Back     alignment and structure
>3lq1_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 1-carboxylate synthase; menaquinone biosynthesis, sephchc synthase, structural genomics; 2.60A {Listeria monocytogenes} Back     alignment and structure
>3hww_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- carboxylate synthase; menaquinone, THDP, Mg, vitamin K2, carboxylase, magnesium; HET: AKG; 1.95A {Escherichia coli k-12} PDB: 3flm_A* 3hwx_A* 2jlc_A* 2jla_A* Back     alignment and structure
>2vk8_A Pyruvate decarboxylase isozyme 1; asymmetric active sites, phenylalanine catabolism, tryptophan catabolism, thiamine pyrophosphate; HET: TPP; 1.42A {Saccharomyces cerevisiae} PDB: 1qpb_A* 2vk1_A* 2w93_A* 1pyd_A* 1pvd_A* 2vk4_A* 2vjy_A* 2g1i_A* Back     alignment and structure
>2x7j_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene -1-carboxylate synthase; transferase, metal-binding; HET: TPP; 2.35A {Bacillus subtilis} Back     alignment and structure
>1ovm_A Indole-3-pyruvate decarboxylase; thiamine diphosphate, indole-3-acetic acid, TDP dependent enzyme, lyase; HET: TPP; 2.65A {Enterobacter cloacae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 Back     alignment and structure
>2wvg_A PDC, pyruvate decarboxylase; thiamine diphosphate, lyase, flavoprotein, metal-binding, alcohol fermentation; HET: TPU; 1.75A {Zymomonas mobilis} PDB: 2wva_A* 2wvh_A 3oe1_A* 1zpd_A* Back     alignment and structure
>2vbi_A Pyruvate decarboxylase; thiamine pyrophosphate, lyase, pyruv flavoprotein, THDP-dependent enzyme; HET: TPP; 2.75A {Acetobacter pasteurianus} Back     alignment and structure
>2vbf_A Branched-chain alpha-ketoacid decarboxylase; KDCA, flavoprotein, THDP-dependent enzymes, thiamine pyrophosphate, lyase; HET: TPP; 1.60A {Lactococcus lactis} PDB: 2vbg_A* Back     alignment and structure
>2nxw_A Phenyl-3-pyruvate decarboxylase; thiamine pyrophosphate, asymmetric dimer of dimers, open ACT loops, lyase; HET: TPP; 1.50A {Azospirillum brasilense} PDB: 2q5j_A* 2q5l_A* 2q5o_A* 2q5q_A* Back     alignment and structure
>3cf4_G Acetyl-COA decarboxylase/synthase epsilon subunit; methanomicrobia, iron-nikel-sulfur, 4Fe-NI-4S, oxidoreductas; 2.00A {Methanosarcina barkeri} Back     alignment and structure
>1ytl_A Acetyl-COA decarboxylase/synthase complex epsilon 2; structural genomics; 1.80A {Archaeoglobus fulgidus} SCOP: c.31.1.6 Back     alignment and structure
>3glr_A NAD-dependent deacetylase sirtuin-3, mitochondria; NAD dependent deacetylase, sirtuin, substrate peptide comple hydrolase, metal-binding; HET: ALY; 1.80A {Homo sapiens} PDB: 3gls_A 3glt_A* 3glu_A 4hd8_A* 4fvt_A* Back     alignment and structure
>1j8f_A SIRT2, sirtuin 2, isoform 1, silencing INFO; gene regulation, transferase; 1.70A {Homo sapiens} SCOP: c.31.1.5 Back     alignment and structure
>2hjh_A NAD-dependent histone deacetylase SIR2; protein, sirtuin, acetyl-ADP-ribose, nicotinamide, hydrolase; HET: XYQ; 1.85A {Saccharomyces cerevisiae} Back     alignment and structure
>4iao_A NAD-dependent histone deacetylase SIR2; protein complex, deacetylase, nucleus, hydrolase-trans complex; HET: APR; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>1q1a_A HST2 protein; ternary complex, histone deacetylase, 2'-O-ADP ribose,, gene regulation; HET: ALY OAD; 1.50A {Saccharomyces cerevisiae} SCOP: c.31.1.5 PDB: 1szd_A* 1szc_A* 2od7_A* 2od9_A* 2qqf_A* 2qqg_A* 1q17_A* 2od2_A* Back     alignment and structure
>3pki_A NAD-dependent deacetylase sirtuin-6; ADP ribose, structural genomics, structural genomics consortium, SGC, hydrolase; HET: AR6; 2.04A {Homo sapiens} PDB: 3pkj_A* Back     alignment and structure
>1q14_A HST2 protein; histone deacetylase, hydrolase; 2.50A {Saccharomyces cerevisiae} SCOP: c.31.1.5 Back     alignment and structure
>1s5p_A NAD-dependent deacetylase; protein deacetylase, SIR2 homologue, hydrolase; HET: ALY; 1.96A {Escherichia coli} SCOP: c.31.1.5 Back     alignment and structure
>3k35_A NAD-dependent deacetylase sirtuin-6; rossmann fold, Zn-binding domain, structural genomics, struc genomics consortium, SGC, ADP-ribosylation; HET: APR; 2.00A {Homo sapiens} Back     alignment and structure
>3riy_A NAD-dependent deacetylase sirtuin-5; desuccinylase, demalonylase, posttranslational modification, binding domain, rossmann fold domain; HET: SLL NAD; 1.55A {Homo sapiens} SCOP: c.31.1.5 PDB: 3rig_A* 4f4u_A* 4f56_A* 4hda_A* 2b4y_A* 2nyr_A* 4g1c_A* Back     alignment and structure
>1m2k_A Silent information regulator 2; protein-ligand complex, gene regulation; HET: APR; 1.47A {Archaeoglobus fulgidus} SCOP: c.31.1.5 PDB: 1m2g_A* 1m2h_A* 1m2j_A* 1m2n_A* 1ici_A* Back     alignment and structure
>1yc5_A NAD-dependent deacetylase; SIR2, sirtuin, SIR2TM, SIRT1, nicotinamide, hydrolase; HET: ALY; 1.40A {Thermotoga maritima} SCOP: c.31.1.5 PDB: 2h2d_A* 2h2f_A 2h2g_A* 2h2h_A* 2h2i_A* 2h4f_A* 2h4j_A* 3d4b_A* 3d81_A* 3pdh_A* 2h4h_A* 3jr3_A* 2h59_A* Back     alignment and structure
>1ma3_A SIR2-AF2, transcriptional regulatory protein, SIR2 family; enzyme-substrate complex, protein binding, transcription; HET: ALY MES; 2.00A {Archaeoglobus fulgidus} SCOP: c.31.1.5 PDB: 1s7g_A* 1yc2_A* Back     alignment and structure
>3u31_A SIR2A, transcriptional regulatory protein SIR2 homologue; Zn-binding domain, rossmann fold domain; HET: MYK NAD; 2.20A {Plasmodium falciparum} PDB: 3u3d_A* 3jwp_A* Back     alignment and structure
>3c2q_A Uncharacterized conserved protein; putative LOR/SDH, structural genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis S2} Back     alignment and structure
>1o97_D Electron transferring flavoprotein alpha-subunit; FAD binding; HET: AMP FAD; 1.6A {Methylophilus methylotrophus} SCOP: c.26.2.3 c.31.1.2 PDB: 1o95_D* 1o96_B* 1o94_D* 3clu_D* 3clt_D* 3clr_D* 3cls_D* Back     alignment and structure
>1efv_A Electron transfer flavoprotein; electron transport, glutaric acidemia type II; HET: FAD AMP; 2.10A {Homo sapiens} SCOP: c.26.2.3 c.31.1.2 PDB: 2a1u_A* 1t9g_R* 2a1t_R* Back     alignment and structure
>1efp_A ETF, protein (electron transfer flavoprotein); electron transport, glutaric acidemia type II; HET: FAD AMP; 2.60A {Paracoccus denitrificans} SCOP: c.26.2.3 c.31.1.2 Back     alignment and structure
>2f62_A Nucleoside 2-deoxyribosyltransferase; SGPP, structural genomics, PSI, S genomics of pathogenic protozoa consortium; HET: 12M; 1.50A {Trypanosoma brucei} SCOP: c.23.14.1 PDB: 2a0k_A* 2f2t_A* 2f64_A* 2f67_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 120
d1q6za1160 c.31.1.3 (A:182-341) Benzoylformate decarboxylase 1e-09
d1pvda1179 c.31.1.3 (A:182-360) Pyruvate decarboxylase {Baker 2e-08
d1ytla1158 c.31.1.6 (A:17-174) Acetyl-CoA decarbonylase/synth 8e-08
d2ji7a1175 c.31.1.3 (A:195-369) Oxalyl-CoA decarboxylase {Oxa 8e-07
d1ozha1179 c.31.1.3 (A:188-366) Catabolic acetolactate syntha 1e-06
d1ybha1179 c.31.1.3 (A:281-459) Acetohydroxyacid synthase cat 7e-06
d1ovma1161 c.31.1.3 (A:181-341) Indole-3-pyruvate decarboxyla 3e-05
d1zpda1175 c.31.1.3 (A:188-362) Pyruvate decarboxylase {Zymom 0.003
>d1q6za1 c.31.1.3 (A:182-341) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]} Length = 160 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: DHS-like NAD/FAD-binding domain
superfamily: DHS-like NAD/FAD-binding domain
family: Pyruvate oxidase and decarboxylase, middle domain
domain: Benzoylformate decarboxylase
species: Pseudomonas putida [TaxId: 303]

 Score = 50.6 bits (120), Expect = 1e-09
 Identities = 17/79 (21%), Positives = 32/79 (40%), Gaps = 1/79 (1%)

Query: 15  SAARTHALQNADLVLLLGARLNWMLHFGRAPRFKSNVKIIQVDLNAEELHNSVQAAVAIQ 74
            AA +  L+  D+VL++GA +     +      K   ++I V  +  E         AI 
Sbjct: 76  IAAISQLLEGHDVVLVIGAPVFRYHQYDPGQYLKPGTRLISVTCDPLEA-ARAPMGDAIV 134

Query: 75  SDVRLTVQQLKQMLSHTQR 93
           +D+      L  ++  + R
Sbjct: 135 ADIGAMASALANLVEESSR 153
>d1pvda1 c.31.1.3 (A:182-360) Pyruvate decarboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 179 Back     information, alignment and structure
>d1ytla1 c.31.1.6 (A:17-174) Acetyl-CoA decarbonylase/synthase complex epsilon subunit 2, ACDE2 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 158 Back     information, alignment and structure
>d2ji7a1 c.31.1.3 (A:195-369) Oxalyl-CoA decarboxylase {Oxalobacter formigenes [TaxId: 847]} Length = 175 Back     information, alignment and structure
>d1ozha1 c.31.1.3 (A:188-366) Catabolic acetolactate synthase {Klebsiella pneumoniae [TaxId: 573]} Length = 179 Back     information, alignment and structure
>d1ybha1 c.31.1.3 (A:281-459) Acetohydroxyacid synthase catalytic subunit {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} Length = 179 Back     information, alignment and structure
>d1ovma1 c.31.1.3 (A:181-341) Indole-3-pyruvate decarboxylase {Enterobacter cloacae [TaxId: 550]} Length = 161 Back     information, alignment and structure
>d1zpda1 c.31.1.3 (A:188-362) Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 542]} Length = 175 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query120
d1ybha1179 Acetohydroxyacid synthase catalytic subunit {Thale 99.91
d2ji7a1175 Oxalyl-CoA decarboxylase {Oxalobacter formigenes [ 99.91
d1t9ba1171 Acetohydroxyacid synthase catalytic subunit {Baker 99.9
d2ez9a1183 Pyruvate oxidase {Lactobacillus plantarum [TaxId: 99.9
d2djia1177 Pyruvate oxidase {Aerococcus viridans [TaxId: 1377 99.89
d2ihta1177 Carboxyethylarginine synthase {Streptomyces clavul 99.88
d1ozha1179 Catabolic acetolactate synthase {Klebsiella pneumo 99.87
d1pvda1179 Pyruvate decarboxylase {Baker's yeast (Saccharomyc 99.77
d1ovma1161 Indole-3-pyruvate decarboxylase {Enterobacter cloa 99.77
d1q6za1160 Benzoylformate decarboxylase {Pseudomonas putida [ 99.76
d1zpda1175 Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 99.74
d1ytla1158 Acetyl-CoA decarbonylase/synthase complex epsilon 99.2
d1j8fa_323 Sirt2 histone deacetylase {Human (Homo sapiens) [T 98.3
d1s5pa_235 NAD-dependent deacetylase CobB {Escherichia coli [ 98.15
d2b4ya1267 NAD-dependent deacetylase sirtuin-5 {Human (Homo s 98.13
d1m2ka_249 AF1676, Sir2 homolog (Sir2-AF1?) {Archaeon Archaeo 98.07
d1yc5a1245 NAD-dependent deacetylase NpdA {Thermotoga maritim 98.0
d1ma3a_252 AF0112, Sir2 homolog (Sir2-AF2) {Archaeon Archaeog 97.99
d1q1aa_289 Hst2 {Baker's yeast (Saccharomyces cerevisiae) [Ta 97.79
d1efva2124 C-terminal domain of the electron transfer flavopr 96.04
d3clsd2123 C-terminal domain of the electron transfer flavopr 94.62
>d1ybha1 c.31.1.3 (A:281-459) Acetohydroxyacid synthase catalytic subunit {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: DHS-like NAD/FAD-binding domain
superfamily: DHS-like NAD/FAD-binding domain
family: Pyruvate oxidase and decarboxylase, middle domain
domain: Acetohydroxyacid synthase catalytic subunit
species: Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]

Probab=99.91  E-value=3.3e-25  Score=147.77  Aligned_cols=115  Identities=23%  Similarity=0.356  Sum_probs=96.8

Q ss_pred             CCCCCCCCCCccccCh-------HHHHhhhhcCEEEEeCCCCCcccccCCCCCCCCCCeEEEEcCChhhhhhccccceEE
Q psy14417          1 MGKGVVPDAHPNCVSA-------ARTHALQNADLVLLLGARLNWMLHFGRAPRFKSNVKIIQVDLNAEELHNSVQAAVAI   73 (120)
Q Consensus         1 ~~kg~~~~~hp~~~G~-------~~~~~l~~aDlil~iG~~~~~~~~~~~~~~~~~~~~vi~Id~d~~~i~~~~~~~~~i   73 (120)
                      +|||+||++||+|+|.       .++.++++|||||++|++++++ +++.+..+.+++++||||.|+.++++++++++.|
T Consensus        53 ~~~g~~~~~h~~~~G~~G~~g~~~~~~~~~~aDlil~lG~~l~~~-~~~~~~~~~~~~kiI~Id~d~~~~~~~~~~~~~i  131 (179)
T d1ybha1          53 MGLGSYPCDDELSLHMLGMHGTVYANYAVEHSDLLLAFGVRFDDR-VTGKLEAFASRAKIVHIDIDSAEIGKNKTPHVSV  131 (179)
T ss_dssp             TTTTSSCTTSTTEEEECSTTSCHHHHHHHHHCSEEEEESCCCCHH-HHSSGGGTTTTSEEEEEESCTTTTTSSSCCSEEE
T ss_pred             cccCCCccccccccccCCCcCCHHHHHHHHhhhhhhhcccccccc-ccccccccCCCCeEEEEeCcccccccccCCCceE
Confidence            6899999999999986       4678999999999999999987 4555566778899999999999999999999999


Q ss_pred             ecCHHHHHHHHHHHhhhcccCCccCCCchHHHHHHHHHhhhhhh
Q psy14417         74 QSDVRLTVQQLKQMLSHTQRNWSFSATSPWWQELKLKCQTNRQF  117 (120)
Q Consensus        74 ~~d~~~~l~~L~~~l~~~~~~~~~~~~~~w~~~~~~~~~~~~~~  117 (120)
                      +||++.+|++|++.+.++.. ........|.+++.+++++|+..
T Consensus       132 ~~D~~~~l~~L~~~l~~~~~-~~~~~~~~W~~~i~~~k~~~p~~  174 (179)
T d1ybha1         132 CGDVKLALQGMNKVLENRAE-ELKLDFGVWRNELNVQKQKFPLS  174 (179)
T ss_dssp             ESCHHHHHHHHHHHHHHTHH-HHCCCCHHHHHHHHHHHHHSCCC
T ss_pred             EeccHHHHHHHHHHHHhhhh-cchhhHHHHHHHHHHHHHhCCCC
Confidence            99999999999998863221 01234568999999999988643
>d2ji7a1 c.31.1.3 (A:195-369) Oxalyl-CoA decarboxylase {Oxalobacter formigenes [TaxId: 847]} Back     information, alignment and structure
>d1t9ba1 c.31.1.3 (A:290-460) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ez9a1 c.31.1.3 (A:183-365) Pyruvate oxidase {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d2djia1 c.31.1.3 (A:187-363) Pyruvate oxidase {Aerococcus viridans [TaxId: 1377]} Back     information, alignment and structure
>d2ihta1 c.31.1.3 (A:198-374) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d1ozha1 c.31.1.3 (A:188-366) Catabolic acetolactate synthase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1pvda1 c.31.1.3 (A:182-360) Pyruvate decarboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ovma1 c.31.1.3 (A:181-341) Indole-3-pyruvate decarboxylase {Enterobacter cloacae [TaxId: 550]} Back     information, alignment and structure
>d1q6za1 c.31.1.3 (A:182-341) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1zpda1 c.31.1.3 (A:188-362) Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1ytla1 c.31.1.6 (A:17-174) Acetyl-CoA decarbonylase/synthase complex epsilon subunit 2, ACDE2 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1j8fa_ c.31.1.5 (A:) Sirt2 histone deacetylase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s5pa_ c.31.1.5 (A:) NAD-dependent deacetylase CobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b4ya1 c.31.1.5 (A:36-302) NAD-dependent deacetylase sirtuin-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m2ka_ c.31.1.5 (A:) AF1676, Sir2 homolog (Sir2-AF1?) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1yc5a1 c.31.1.5 (A:1-245) NAD-dependent deacetylase NpdA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ma3a_ c.31.1.5 (A:) AF0112, Sir2 homolog (Sir2-AF2) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1q1aa_ c.31.1.5 (A:) Hst2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1efva2 c.31.1.2 (A:208-331) C-terminal domain of the electron transfer flavoprotein alpha subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3clsd2 c.31.1.2 (D:196-318) C-terminal domain of the electron transfer flavoprotein alpha subunit {Methylophilus methylotrophus [TaxId: 17]} Back     information, alignment and structure