Psyllid ID: psy14474

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550
MGALCCGGNSSVNVGSVLDRVISQASNEDDCLLYRLANYKNGGELVDAYNIGGQVEVEKLIKEQFGVLMYNDGTGQVIDKTEYLKWRYRDSDQFVIPVEKVLSPLDPLSKWRDHEACWQMQYRGSLGETLLHVLIICDTKLHTRLARTLLKCFPRLSQDVVEGEEYLGASALHLAIAYANNELVADLIEAGANVTQRAIGSFFLPRDQQTPRPSRHTDYEGLAYLGEYPLSWAACCSNESVYNLLIDSGAIPDAKDSFGNMILHMVVVNDKLDMFGYALRHPKTPASNGILNNDGFTPLTLSCQLGRADVFREMLELSCKEFWRYSNITCSAYPLNALDTLLPDGRTNWNSALFIILNGTKEAHLDMLDGGIIQRLLEEKWKTFAQRQFMKRLLILSLHLLFMSLAVYFRPTDRDEPLLGGTDWQSIARYCFEIGTICGVVSYIIFQQGGEIKNQGFSSFMKQLKNEPAKLIFLISNIMILSCIPFRIMGDKKTEEAILIFAVPGSWFLLMFFAGAIRLTGPFVTMVYSMITGDMLTLATNGRDTCFKSK
ccccccccccccccccHHHHHHHHcccccccHHHHHHHcccccHHHHHHHHcccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHcccccccccHHHHcccccHHHHcHHHHHHHHHHHcccccccHHHHHHHcccHHHHHHHHHHHHcccccccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccHHHHHHHHccHHHHHHHHHcccccccccccccHHHHHHHHcccHHHHHHHHHcccccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccccccccccccccccccccccHHHHHHHccHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHcccccccccccccc
cccEEcccccccccccHHHHHHcccccccccEEEEEEEccccccHHHHHHcccHHHHHHHHHHHHHHHHcccccccEccHHHHHHHHHccHHHccHHHHHHHccccHHHHHccccccHHHHHccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccccHcccccHHHHHHHHccHHHHHHHHHccccccHcEccccEccccccccccccccccccEEEEcccccHHHHHcccHHHHHHHHHccccccHccccccEEEEEEEEcccHHHHHHHHHccccccHHcccccccccHHHHHHHHcHHHHHHHHHHHHccEEEEcccEEEEEccHccccccccccccccccEEEEEEEcccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccc
mgalccggnssvnVGSVLDRVIsqasneddcLLYRLANYKNGGELVDAYNIGGQVEVEKLIKEQFGVlmyndgtgqvidkteylkwryrdsdqfvipvekvlspldplskwrdheACWQMqyrgslgeTLLHVLIICDTKLHTRLARTLLKcfprlsqdvveGEEYLGASALHLAIAYANNELVADLIEAGANVTQRAIgsfflprdqqtprpsrhtdyeglaylgeyplswaaccsneSVYNLLIdsgaipdakdsfgnMILHMVVVNDKLDMFgyalrhpktpasngilnndgftpltlscqlgRADVFREMLELSCKEFWRYsnitcsayplnaldtllpdgrtnwNSALFIILNGTKEAHLDMLDGGIIQRLLEEKWKTFAQRQFMKRLLILSLHLLFMSLAVyfrptdrdepllggtdwQSIARYCFEIGTICGVVSYIIFqqggeiknqGFSSFMKQLKNEPAKLIFLISNImilscipfrimgdkkTEEAILIFAVPGSWFLLMFFAGairltgpfVTMVYSMITGDMltlatngrdtcfksk
mgalccggnssvnVGSVLDRVISQASNEDDCLLYRLANYKNGGELVDAYNIGGQVEVEKLIKEQFGvlmyndgtgqvIDKTEYLKWRYRDSDQFVIPVEKVLSPLDPLSKWRDHEACWQMQYRGSLGETLLHVLIICDTKLHTRLARTLLKCFPRLSQDVVEGEEYLGASALHLAIAYANNELVADLIEAGANVTQRAIGSfflprdqqtprpsRHTDYEGLAYLGEYPLSWAACCSNESVYNLLIDSGAIPDAKDSFGNMILHMVVVNDKLDMFGYALRHPKTPASNGILNNDGFTPLTLSCQLGRADVFREMLELSCKEFWRYSNITCSAYPLNALDTLLPDGRTNWNSALFIILNGTKEAHLDMLDGGIIQRLLEEKWKTFAQRQFMKRLLILSLHLLFMSLAVYFRPTDRDEPLLGGTDWQSIARYCFEIGTICGVVSYIIFQQGGEIKNQGFSSFMKQLKNEPAKLIFLISNIMILSCIPFRIMGDKKTEEAILIFAVPGSWFLLMFFAGAIRLTGPFVTMVYSMITGDMltlatngrdtcfksk
MGALCCGGNSSVNVGSVLDRVISQASNEDDCLLYRLANYKNGGELVDAYNIGGQVEVEKLIKEQFGVLMYNDGTGQVIDKTEYLKWRYRDSDQFVIPVEKVLSPLDPLSKWRDHEACWQMQYRGSLGETLLHVLIICDTKLHTRLARTLLKCFPRLSQDVVEGEEYLGASALHLAIAYANNELVADLIEAGANVTQRAIGSFFLPRDQQTPRPSRHTDYEGLAYLGEYPLSWAACCSNESVYNLLIDSGAIPDAKDSFGNMILHMVVVNDKLDMFGYALRHPKTPASNGILNNDGFTPLTLSCQLGRADVFREMLELSCKEFWRYSNITCSAYPLNALDTLLPDGRTNWNSALFIILNGTKEAHLDMLDGGIIQRLLEEKWKTFAQRQFMKRllilslhllfmslAVYFRPTDRDEPLLGGTDWQSIARYCFEIGTICGVVSYIIFQQGGEIKNQGFSSFMKQLKNEPAKLIFLISNIMILSCIPFRIMGDKKTEEAILIFAVPGSWFLLMFFAGAIRLTGPFVTMVYSMITGDMLTLATNGRDTCFKSK
***LCCGGNSSVNVGSVLDRVISQASNEDDCLLYRLANYKNGGELVDAYNIGGQVEVEKLIKEQFGVLMYNDGTGQVIDKTEYLKWRYRDSDQFVIPVEKVLSPLDPLSKWRDHEACWQMQYRGSLGETLLHVLIICDTKLHTRLARTLLKCFPRLSQDVVEGEEYLGASALHLAIAYANNELVADLIEAGANVTQRAIGSFFLP***********TDYEGLAYLGEYPLSWAACCSNESVYNLLIDSGAIPDAKDSFGNMILHMVVVNDKLDMFGYALRHPKTPASNGILNNDGFTPLTLSCQLGRADVFREMLELSCKEFWRYSNITCSAYPLNALDTLLPDGRTNWNSALFIILNGTKEAHLDMLDGGIIQRLLEEKWKTFAQRQFMKRLLILSLHLLFMSLAVYFRPTDRDEPLLGGTDWQSIARYCFEIGTICGVVSYIIFQQGGEIKNQGFSSFMKQLKNEPAKLIFLISNIMILSCIPFRIMGDKKTEEAILIFAVPGSWFLLMFFAGAIRLTGPFVTMVYSMITGDMLTLATNGR*******
********************************LYRLANYKNGGELVDAYNIGGQVEVEKLIKEQFGVLMYNDGTGQVIDKTEYLKWRYRDSDQFVIPVEKVLSPLDPLSKWRDHEACWQMQYRGSLGETLLHVLIICDTKLHTRLARTLLKCFPRLSQDVVEGEEYLGASALHLAIAYANNELVADLIEAGANVTQRAIGSFFLPRDQQTPRPSRHTDYEGLAYLGEYPLSWAACCSNESVYNLLIDSGAIPDAKDSFGNMILHMVVVNDKLDMFGYALRHPKTPASNGILNNDGFTPLTLSCQLGRADVFREMLELSCKEFWRYSNITCSAYPLNALDTLLPDGRTNWNSALFIILNGTKEAHLDMLDGGIIQRLLEEKWKTFAQRQFMKRLLILSLHLLFMSLAVYFRPTDRDEPLLGGTDWQSIARYCFEIGTICGVVSYIIFQQGGEIKNQGFSSFMKQLKNEPAKLIFLISNIMILSCIPFRIMGDKKTEEAILIFAVPGSWFLLMFFAGAIRLTGPFVTMVYSMITGDMLTLATNGRDTCF***
MGALCCGGNSSVNVGSVLDRVISQASNEDDCLLYRLANYKNGGELVDAYNIGGQVEVEKLIKEQFGVLMYNDGTGQVIDKTEYLKWRYRDSDQFVIPVEKVLSPLDPLSKWRDHEACWQMQYRGSLGETLLHVLIICDTKLHTRLARTLLKCFPRLSQDVVEGEEYLGASALHLAIAYANNELVADLIEAGANVTQRAIGSFFLPR*********HTDYEGLAYLGEYPLSWAACCSNESVYNLLIDSGAIPDAKDSFGNMILHMVVVNDKLDMFGYALRHPKTPASNGILNNDGFTPLTLSCQLGRADVFREMLELSCKEFWRYSNITCSAYPLNALDTLLPDGRTNWNSALFIILNGTKEAHLDMLDGGIIQRLLEEKWKTFAQRQFMKRLLILSLHLLFMSLAVYFRPTDRDEPLLGGTDWQSIARYCFEIGTICGVVSYIIFQQGGEIKNQGFSSFMKQLKNEPAKLIFLISNIMILSCIPFRIMGDKKTEEAILIFAVPGSWFLLMFFAGAIRLTGPFVTMVYSMITGDMLTLATNGRDTCFKSK
**************************NEDDCLLYRLANYKNGGELVDAYNIGGQVEVEKLIKEQFGVLMYNDGTGQVIDKTEYLKWRYRDSDQFVIPVEKVLSPLDPLSKWRDHEACWQMQYRGSLGETLLHVLIICDTKLHTRLARTLLKCFPRLSQDVVEGEEYLGASALHLAIAYANNELVADLIEAGANVTQRAIGSFFLPRDQQTPRPSRHTDYEGLAYLGEYPLSWAACCSNESVYNLLIDSGAIPDAKDSFGNMILHMVVVNDKLDMFGYALRHPKTPASNGILNNDGFTPLTLSCQLGRADVFREMLELSCKEFWRYSNITCSAYPLNALDTLLPDGRTNWNSALFIILNGTKEAHLDMLDGGIIQRLLEEKWKTFAQRQFMKRLLILSLHLLFMSLAVYFRPTDRDEPLLGGTDWQSIARYCFEIGTICGVVSYIIFQQGGEIKNQGFSSFMKQLKNEPAKLIFLISNIMILSCIPFRIMGDKKTEEAILIFAVPGSWFLLMFFAGAIRLTGPFVTMVYSMITGDMLTLATNGR**CF***
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHoooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGALCCGGNSSVNVGSVLDRVISQASNEDDCLLYRLANYKNGGELVDAYNIGGQVEVEKLIKEQFGVLMYNDGTGQVIDKTEYLKWRYRDSDQFVIPVEKVLSPLDPLSKWRDHEACWQMQYRGSLGETLLHVLIICDTKLHTRLARTLLKCFPRLSQDVVEGEEYLGASALHLAIAYANNELVADLIEAGANVTQRAIGSFFLPRDQQTPRPSRHTDYEGLAYLGEYPLSWAACCSNESVYNLLIDSGAIPDAKDSFGNMILHMVVVNDKLDMFGYALRHPKTPASNGILNNDGFTPLTLSCQLGRADVFREMLELSCKEFWRYSNITCSAYPLNALDTLLPDGRTNWNSALFIILNGTKEAHLDMLDGGIIQRLLEEKWKTFAQRQFMKRLLILSLHLLFMSLAVYFRPTDRDEPLLGGTDWQSIARYCFEIGTICGVVSYIIFQQGGEIKNQGFSSFMKQLKNEPAKLIFLISNIMILSCIPFRIMGDKKTEEAILIFAVPGSWFLLMFFAGAIRLTGPFVTMVYSMITGDMLTLATNGRDTCFKSK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query550 2.2.26 [Sep-21-2011]
Q91WD2 727 Transient receptor potent yes N/A 0.738 0.558 0.275 3e-36
Q9R186 727 Transient receptor potent yes N/A 0.738 0.558 0.271 3e-35
Q9H1D0 725 Transient receptor potent yes N/A 0.738 0.56 0.264 2e-34
Q9XSM3 730 Transient receptor potent no N/A 0.707 0.532 0.264 6e-32
Q9NQA5 729 Transient receptor potent no N/A 0.74 0.558 0.256 2e-30
P69744 723 Transient receptor potent no N/A 0.785 0.597 0.257 6e-30
Q9JIP0 723 Transient receptor potent no N/A 0.732 0.557 0.270 1e-29
Q697L1 840 Transient receptor potent no N/A 0.632 0.414 0.271 2e-27
Q6R5A3 839 Transient receptor potent no N/A 0.634 0.415 0.272 5e-27
O35433 838 Transient receptor potent no N/A 0.634 0.416 0.267 1e-26
>sp|Q91WD2|TRPV6_MOUSE Transient receptor potential cation channel subfamily V member 6 OS=Mus musculus GN=Trpv6 PE=1 SV=1 Back     alignment and function desciption
 Score =  153 bits (387), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 125/453 (27%), Positives = 207/453 (45%), Gaps = 47/453 (10%)

Query: 108 LSKWRDHEACWQMQYRGSLGETLLHVLIICDTKLHTRLARTLLKCFPRLSQDVVEGEEYL 167
           LSK    E C ++  RG++GET LH+  + D   +   A  L++  P L  + +  E Y 
Sbjct: 61  LSKLLKFEGC-EVHQRGAMGETALHIAALYD---NLEAAMVLMEAAPELVFEPMTSELYE 116

Query: 168 GASALHLAIAYANNELVADLIEAGANVTQRAIGSFFLPRDQQTPRPSRHTDYEGLAYLGE 227
           G +ALH+A+   N  LV  L+  GA+V+ RA GS F            H     L Y GE
Sbjct: 117 GQTALHIAVINQNVNLVRALLARGASVSARATGSVF------------HYRPHNLIYYGE 164

Query: 228 YPLSWAACCSNESVYNLLIDSGAIPDAKDSFGNMILHMVVVNDK----LDMFGYALRH-- 281
           +PLS+AAC  +E +  LLI+ GA   A+DS GN +LH++++         M+   L +  
Sbjct: 165 HPLSFAACVGSEEIVRLLIEHGADIRAQDSLGNTVLHILILQPNKTFACQMYNLLLSYDG 224

Query: 282 -PKTPASNGILNNDGFTPLTLSCQLGRADVFREMLELSCKEFWRYSNITCSAYPLNALDT 340
                +   + NN G TP  L+   G   +F+ +++      W Y  +T + Y L  +D+
Sbjct: 225 GDHLKSLELVPNNQGLTPFKLAGVEGNIVMFQHLMQKRKHIQWTYGPLTSTLYDLTEIDS 284

Query: 341 LLPDGRTNWNSALFIILNGTKEAHLDMLDGGIIQRLLEEKWKTFAQRQFMKRLLILSLHL 400
              D      S L +I+   K     +LD   ++ L+  KWK + +  F     I  L++
Sbjct: 285 SGDD-----QSLLELIVTTKKREARQILDQTPVKELVSLKWKRYGRPYFCVLGAIYVLYI 339

Query: 401 LFMSLAVYFRP-----TDRDEPLLGGTDWQSIARYCF-----------EIGTICGVVSYI 444
           +  ++   +RP     T+R  P       Q + +  +           E+ +I G V  I
Sbjct: 340 ICFTMCCVYRPLKPRITNRTNPRDNTLMQQKLLQEAYVTPKDDLRLVGELVSIVGAV-II 398

Query: 445 IFQQGGEIKNQGFSSFMKQ-LKNEPAKLIFLISNIMILSCIPFRIMGDKKTEEAILIFAV 503
           +  +  +I   G + F  Q +   P  +I +    M+L  +  R+  +   E   + FA+
Sbjct: 399 LLVEIPDIFRLGVTRFFGQTILGGPFHVIIITYAFMVLVTMVMRLT-NVDGEVVPMSFAL 457

Query: 504 PGSWFLLMFFAGAIRLTGPFVTMVYSMITGDML 536
              W  +M+FA   ++ GPF  M+  MI GD++
Sbjct: 458 VLGWCNVMYFARGFQMLGPFTIMIQKMIFGDLM 490
Calcium selective cation channel probably involved in Ca(2+) uptake in various tissues, including Ca(2+) reabsorption in intestine. The channel is activated by low internal calcium level, probably including intracellular calcium store depletion, and the current exhibits an inward rectification. Inactivation includes both, a rapid Ca(2+)-dependent and a slower Ca(2+)-calmodulin-dependent mechanism, the latter may be regulated by phosphorylation. In vitro, is slowly inhibited by Mg(2+) in a voltage-independent manner. Heteromeric assembly with TRPV5 seems to modify channel properties. TRPV5-TRPV6 heteromultimeric concatemers exhibit voltage-dependent gating.
Mus musculus (taxid: 10090)
>sp|Q9R186|TRPV6_RAT Transient receptor potential cation channel subfamily V member 6 OS=Rattus norvegicus GN=Trpv6 PE=1 SV=1 Back     alignment and function description
>sp|Q9H1D0|TRPV6_HUMAN Transient receptor potential cation channel subfamily V member 6 OS=Homo sapiens GN=TRPV6 PE=1 SV=2 Back     alignment and function description
>sp|Q9XSM3|TRPV5_RABIT Transient receptor potential cation channel subfamily V member 5 OS=Oryctolagus cuniculus GN=Trpv5 PE=1 SV=1 Back     alignment and function description
>sp|Q9NQA5|TRPV5_HUMAN Transient receptor potential cation channel subfamily V member 5 OS=Homo sapiens GN=TRPV5 PE=1 SV=2 Back     alignment and function description
>sp|P69744|TRPV5_MOUSE Transient receptor potential cation channel subfamily V member 5 OS=Mus musculus GN=Trpv5 PE=1 SV=2 Back     alignment and function description
>sp|Q9JIP0|TRPV5_RAT Transient receptor potential cation channel subfamily V member 5 OS=Rattus norvegicus GN=Trpv5 PE=2 SV=1 Back     alignment and function description
>sp|Q697L1|TRPV1_CANFA Transient receptor potential cation channel subfamily V member 1 OS=Canis familiaris GN=TRPV1 PE=2 SV=1 Back     alignment and function description
>sp|Q6R5A3|TRPV1_CAVPO Transient receptor potential cation channel subfamily V member 1 OS=Cavia porcellus GN=Trpv1 PE=2 SV=1 Back     alignment and function description
>sp|O35433|TRPV1_RAT Transient receptor potential cation channel subfamily V member 1 OS=Rattus norvegicus GN=Trpv1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query550
242023927 1055 conserved hypothetical protein [Pediculu 0.98 0.510 0.777 0.0
270014288 1086 hypothetical protein TcasGA2_TC012368 [T 0.978 0.495 0.762 0.0
307206920 1112 Transient receptor potential cation chan 0.978 0.483 0.761 0.0
110748981 1101 PREDICTED: hypothetical protein LOC72611 0.978 0.488 0.759 0.0
332020367 1109 Transient receptor potential cation chan 0.978 0.485 0.756 0.0
380013353 1105 PREDICTED: uncharacterized protein LOC10 0.978 0.486 0.757 0.0
350399983 1104 PREDICTED: hypothetical protein LOC10074 0.972 0.484 0.751 0.0
350399986 1105 PREDICTED: hypothetical protein LOC10074 0.972 0.484 0.751 0.0
340715377 1024 PREDICTED: transient receptor potential 0.974 0.523 0.750 0.0
307168692 1109 Transient receptor potential cation chan 0.978 0.485 0.750 0.0
>gi|242023927|ref|XP_002432382.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212517805|gb|EEB19644.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  905 bits (2339), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/540 (77%), Positives = 476/540 (88%), Gaps = 1/540 (0%)

Query: 1   MGALCCG-GNSSVNVGSVLDRVISQASNEDDCLLYRLANYKNGGELVDAYNIGGQVEVEK 59
           MGA  CG      N GSVLDRVISQASN+DDCLLY+LANYKN GEL++AYNIGGQ EVEK
Sbjct: 1   MGAGLCGTSQDPQNQGSVLDRVISQASNKDDCLLYKLANYKNSGELIEAYNIGGQAEVEK 60

Query: 60  LIKEQFGVLMYNDGTGQVIDKTEYLKWRYRDSDQFVIPVEKVLSPLDPLSKWRDHEACWQ 119
           LIKEQFGVLMY DG G+VI + EYL+W++RD  Q V+P+E  LS  DPL+KW DHEACWQ
Sbjct: 61  LIKEQFGVLMYADGKGEVIKRAEYLRWKFRDQAQVVLPIEASLSIYDPLAKWEDHEACWQ 120

Query: 120 MQYRGSLGETLLHVLIICDTKLHTRLARTLLKCFPRLSQDVVEGEEYLGASALHLAIAYA 179
           MQYRGSLGETLLHVLIICD+K+HT+LARTLLKCFP+L+ D+VEGEEYLGASALHLAIAY 
Sbjct: 121 MQYRGSLGETLLHVLIICDSKIHTKLARTLLKCFPKLALDIVEGEEYLGASALHLAIAYN 180

Query: 180 NNELVADLIEAGANVTQRAIGSFFLPRDQQTPRPSRHTDYEGLAYLGEYPLSWAACCSNE 239
           NNELV DL++AGAN+ QRA+GSFFLP+DQQ  +P + TDYEGLAYLGEYPLSWAACCSNE
Sbjct: 181 NNELVEDLVDAGANINQRAVGSFFLPKDQQRAKPLKTTDYEGLAYLGEYPLSWAACCSNE 240

Query: 240 SVYNLLIDSGAIPDAKDSFGNMILHMVVVNDKLDMFGYALRHPKTPASNGILNNDGFTPL 299
           SVYNLL+D GA PD++DSFGNMILHMVVV DKLDMFGYALRHPK PASNGI+NN+G TPL
Sbjct: 241 SVYNLLLDVGADPDSQDSFGNMILHMVVVCDKLDMFGYALRHPKVPASNGIINNEGLTPL 300

Query: 300 TLSCQLGRADVFREMLELSCKEFWRYSNITCSAYPLNALDTLLPDGRTNWNSALFIILNG 359
           TL+C+LGRADVF+EMLELS KEFWRYSNITCSAYPLNALDTLLPDGRTNWNSA+FIILNG
Sbjct: 301 TLACKLGRADVFKEMLELSAKEFWRYSNITCSAYPLNALDTLLPDGRTNWNSAIFIILNG 360

Query: 360 TKEAHLDMLDGGIIQRLLEEKWKTFAQRQFMKRLLILSLHLLFMSLAVYFRPTDRDEPLL 419
           TKE HLDMLDGGIIQRLLEEKWKTFA+ QF+KRL+I  LH+  +S +VY RP DR++PLL
Sbjct: 361 TKEEHLDMLDGGIIQRLLEEKWKTFARNQFLKRLVIFFLHIFCLSGSVYLRPDDRNKPLL 420

Query: 420 GGTDWQSIARYCFEIGTICGVVSYIIFQQGGEIKNQGFSSFMKQLKNEPAKLIFLISNIM 479
           GGT  Q + RYCFEIGTI GV+ Y+ FQQG EI+NQG  SF+KQL ++PAK IFLISN++
Sbjct: 421 GGTSVQDVVRYCFEIGTILGVLCYLCFQQGDEIRNQGLISFLKQLPHDPAKFIFLISNLL 480

Query: 480 ILSCIPFRIMGDKKTEEAILIFAVPGSWFLLMFFAGAIRLTGPFVTMVYSMITGDMLTLA 539
           IL+CIP+R+ GD  TEEAIL+FAVP SWFLLMFFAGAIRLTGPFVTM+YSMITGDMLT  
Sbjct: 481 ILACIPYRVAGDTDTEEAILVFAVPSSWFLLMFFAGAIRLTGPFVTMIYSMITGDMLTFG 540

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|270014288|gb|EFA10736.1| hypothetical protein TcasGA2_TC012368 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|307206920|gb|EFN84766.1| Transient receptor potential cation channel subfamily V member 6 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|110748981|ref|XP_001121881.1| PREDICTED: hypothetical protein LOC726119 [Apis mellifera] Back     alignment and taxonomy information
>gi|332020367|gb|EGI60788.1| Transient receptor potential cation channel subfamily V member 6 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|380013353|ref|XP_003690727.1| PREDICTED: uncharacterized protein LOC100868270 [Apis florea] Back     alignment and taxonomy information
>gi|350399983|ref|XP_003485699.1| PREDICTED: hypothetical protein LOC100747394 isoform 1 [Bombus impatiens] Back     alignment and taxonomy information
>gi|350399986|ref|XP_003485700.1| PREDICTED: hypothetical protein LOC100747394 isoform 2 [Bombus impatiens] Back     alignment and taxonomy information
>gi|340715377|ref|XP_003396191.1| PREDICTED: transient receptor potential cation channel subfamily V member 6-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|307168692|gb|EFN61724.1| Transient receptor potential cation channel subfamily V member 6 [Camponotus floridanus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query550
FB|FBgn0086693 1123 iav "inactive" [Drosophila mel 0.730 0.357 0.732 1.1e-211
WB|WBGene00003889 937 osm-9 [Caenorhabditis elegans 0.912 0.535 0.433 2.4e-115
FB|FBgn0036414 833 nan "nanchung" [Drosophila mel 0.534 0.352 0.365 1.9e-67
WB|WBGene00003838 841 ocr-1 [Caenorhabditis elegans 0.503 0.329 0.350 2.1e-59
WB|WBGene00003839 900 ocr-2 [Caenorhabditis elegans 0.501 0.306 0.365 1.1e-58
WB|WBGene00003841 756 ocr-4 [Caenorhabditis elegans 0.925 0.673 0.290 7.8e-55
WB|WBGene00003840 818 ocr-3 [Caenorhabditis elegans 0.5 0.336 0.385 2.2e-52
UNIPROTKB|F1PHF9 724 TRPV6 "Uncharacterized protein 0.474 0.360 0.303 2.2e-30
UNIPROTKB|Q9NQA5 729 TRPV5 "Transient receptor pote 0.550 0.415 0.275 4.5e-25
UNIPROTKB|F1SRT9381 TRPV5 "Uncharacterized protein 0.449 0.648 0.305 4.6e-25
FB|FBgn0086693 iav "inactive" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 1593 (565.8 bits), Expect = 1.1e-211, Sum P(2) = 1.1e-211
 Identities = 295/403 (73%), Positives = 340/403 (84%)

Query:    15 GSVLDRVISQAS-NEDDCLLYRLANYKNGGELVDAYNIGGQVEVEKLIKEQFGVLMYNDG 73
             G++LD VISQ+S     CLLY+LA+YK GG+L+DA N GG + VE+LI+EQFGV MYNDG
Sbjct:    19 GAILDAVISQSSATACKCLLYKLADYKRGGDLIDAINSGGLIAVEQLIREQFGVFMYNDG 78

Query:    74 TGQVIDKTEYLKWRYRDSDQFVIPVEKVLSPLDPLSKWRDHEACWQMQYRGSLGETLLHV 133
              GQVI++ E+L+W+YRD  +  IP+E  LS  DPL KW DH+ACWQMQYRG+LGE+LLHV
Sbjct:    79 KGQVINRAEFLRWKYRDHTEVTIPIEASLSIHDPLGKWEDHKACWQMQYRGALGESLLHV 138

Query:   134 LIICDTKLHTRLARTLLKCFPRLSQDVVEGEEYLGASALHLAIAYANNELVADLIEAGAN 193
             LIICD+K+HT+LAR LL+ FP L+ DV+EGEEYLGASALHL+IAY+NNELVADLIEAGA+
Sbjct:   139 LIICDSKVHTKLARVLLRVFPNLALDVMEGEEYLGASALHLSIAYSNNELVADLIEAGAD 198

Query:   194 VTQRAIGSFFLPRDQQTPRPSRHTDYEGLAYLGEYPLSWAACCSNESVYNLLIDSGAIPD 253
             + QRAIGSFFLPRDQQ   P++ TDYEGLAY+GEYPL+WAACC+NESVYNLL+D G+ PD
Sbjct:   199 IHQRAIGSFFLPRDQQRANPAKSTDYEGLAYMGEYPLAWAACCANESVYNLLVDCGSDPD 258

Query:   254 AKDSFGNMILHMVVVNDKLDMFGYALRHPKTPASNGILNNDGFTPLTLSCQLGRADVFRE 313
             A+DSFGNMILHMVVV DKLDMFGYALRHPKTPA NGI+N  G TPLTL+C+LGRA+VFRE
Sbjct:   259 AQDSFGNMILHMVVVCDKLDMFGYALRHPKTPAKNGIVNQTGLTPLTLACKLGRAEVFRE 318

Query:   314 MLELSCKEFWRYSNITCSAYPLNALDTLLPDGRTNWNSALFIILNGTKEAHLDMLDGGII 373
             MLELS +EFWRYSNITCS YPLNALDTLLPDGRTNWNSALFIILNGTK  HLDMLDGGII
Sbjct:   319 MLELSAREFWRYSNITCSGYPLNALDTLLPDGRTNWNSALFIILNGTKPEHLDMLDGGII 378

Query:   374 QRLLEEKWKTFAQRQFMKRXXXXXXXXXXXXXAVYFRPTDRDE 416
             QRLLEEKWKTFAQ QF+KR             +VY RP    E
Sbjct:   379 QRLLEEKWKTFAQNQFLKRLLILSTHLLCLSVSVYLRPAHDGE 421
GO:0007629 "flight behavior" evidence=IMP
GO:0005262 "calcium channel activity" evidence=ISS
GO:0006816 "calcium ion transport" evidence=ISS
GO:0007608 "sensory perception of smell" evidence=ISS
GO:0009408 "response to heat" evidence=IMP
GO:0048148 "behavioral response to cocaine" evidence=NAS
GO:0016021 "integral to membrane" evidence=IEA
GO:0006811 "ion transport" evidence=IEA
GO:0055085 "transmembrane transport" evidence=IEA
GO:0007605 "sensory perception of sound" evidence=IMP
GO:0048060 "negative gravitaxis" evidence=IMP
GO:0043052 "thermotaxis" evidence=IMP
GO:0040040 "thermosensory behavior" evidence=IMP
WB|WBGene00003889 osm-9 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
FB|FBgn0036414 nan "nanchung" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
WB|WBGene00003838 ocr-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
WB|WBGene00003839 ocr-2 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
WB|WBGene00003841 ocr-4 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
WB|WBGene00003840 ocr-3 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|F1PHF9 TRPV6 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q9NQA5 TRPV5 "Transient receptor potential cation channel subfamily V member 5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SRT9 TRPV5 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query550
TIGR00870 743 TIGR00870, trp, transient-receptor-potential calci 1e-60
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 3e-17
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 6e-11
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 3e-06
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 4e-06
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 6e-06
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-05
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 1e-05
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 6e-05
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 7e-05
pfam0002333 pfam00023, Ank, Ankyrin repeat 3e-04
>gnl|CDD|233161 TIGR00870, trp, transient-receptor-potential calcium channel protein Back     alignment and domain information 
 Score =  213 bits (543), Expect = 1e-60
 Identities = 119/445 (26%), Positives = 181/445 (40%), Gaps = 44/445 (9%)

Query: 123 RGSLGETLLHVLI-----ICDTKLHTRLARTLLKCFPRLSQDVVEGEEYLGASALHLAIA 177
           RG++G+TLLH +        +  L   LA         L+ D    E   G +ALHLA  
Sbjct: 78  RGAVGDTLLHAISLEYVDAVEAILLHLLAAFRKSGPLELANDQYTSEFTPGITALHLAAH 137

Query: 178 YANNELVADLIEAGANVTQRAIGSFFLPRDQQTPRPSRHTDYEGLAYLGEYPLSWAACCS 237
             N E+V  L+E GA+V  RA G FF+            +      Y GE PL+ AAC  
Sbjct: 138 RQNYEIVKLLLERGASVPARACGDFFV-----------KSQGVDSFYHGESPLNAAACLG 186

Query: 238 NESVYNLLIDSGAIPDAKDSFGNMILHMVVV-------NDKL--DMFGYALRHPKTPASN 288
           + S+  LL +  A     DS GN +LH++V+        ++L   M+ +AL        +
Sbjct: 187 SPSIVALLSEDPADILTADSLGNTLLHLLVMENEFKAEYEELSCQMYNFALSLLDKLRDS 246

Query: 289 G----ILNNDGFTPLTLSCQLGRADVFREML--ELSCKEF--WRYSNITCSAYPLNALDT 340
                ILN+ G TPL L+ + GR  +FR  L  +   K+F  W       S Y L  LD 
Sbjct: 247 KELEVILNHQGLTPLKLAAKEGRIVLFRLKLAIKYKQKKFVAWPNGQQLLSLYWLEELDG 306

Query: 341 LLPDGRTNWNSALFIILNGTKEAHLDMLDGGIIQRLLEEKWKTFAQRQFMKRLLILSLHL 400
                 +     +  ++        DM     + RL + KWK F +  F     +  L+L
Sbjct: 307 WRRKQ-SVLELIVVFVIGLKFPELSDMYLIAPLSRLGQFKWKPFIKFIFHSASYLYFLYL 365

Query: 401 LFMSLAVYFRPTDRDEPLLGG---------TDWQSIARYCFEIGTICGVVSYIIFQQGGE 451
           +  +   Y+RPT  D  + G            W    R   E     G +   I Q    
Sbjct: 366 IIFTSVAYYRPTRTDLRVTGLQQTPLEMLIVTWVDGLRLGEEKLIWLGGIFEYIHQLWNI 425

Query: 452 IKNQGFSSFMKQLKNEPAKLIFLISNIMILSCIPFRIMGDKKTEEAILIFAVPGSWFLLM 511
           +     S ++    + P  ++F+    ++L    +        EEA+  FA+  SW  L+
Sbjct: 426 LDFGMNSFYLATFLDRPFAILFVTQAFLVL-REHWLRFDPTLIEEALFAFALVLSWLNLL 484

Query: 512 FFAGAIRLTGPFVTMVYSMITGDML 536
           +     +  GP   M+  MI GD+L
Sbjct: 485 YIFRGNQHLGPLQIMIGRMILGDIL 509

The Transient Receptor Potential Ca2+ Channel (TRP-CC) Family (TC. 1.A.4)The TRP-CC family has also been called the store-operated calcium channel (SOC) family. The prototypical members include the Drosophila retinal proteinsTRP and TRPL (Montell and Rubin, 1989; Hardie and Minke, 1993). SOC members of the family mediate the entry of extracellular Ca2+ into cells in responseto depletion of intracellular Ca2+ stores (Clapham, 1996) and agonist stimulated production of inositol-1,4,5 trisphosphate (IP3). One member of the TRP-CCfamily, mammalian Htrp3, has been shown to form a tight complex with the IP3 receptor (TC #1.A.3.2.1). This interaction is apparently required for IP3 tostimulate Ca2+ release via Htrp3. The vanilloid receptor subtype 1 (VR1), which is the receptor for capsaicin (the ?hot? ingredient in chili peppers) and servesas a heat-activated ion channel in the pain pathway (Caterina et al., 1997), is also a member of this family. The stretch-inhibitable non-selective cation channel(SIC) is identical to the vanilloid receptor throughout all of its first 700 residues, but it exhibits a different sequence in its last 100 residues. VR1 and SICtransport monovalent cations as well as Ca2+. VR1 is about 10x more permeable to Ca2+ than to monovalent ions. Ca2+ overload probably causes cell deathafter chronic exposure to capsaicin. (McCleskey and Gold, 1999) [Transport and binding proteins, Cations and iron carrying compounds]. Length = 743
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 550
KOG3676|consensus 782 100.0
KOG0510|consensus 929 100.0
TIGR00870 743 trp transient-receptor-potential calcium channel p 100.0
KOG4412|consensus226 100.0
PHA02946446 ankyin-like protein; Provisional 100.0
PHA02876682 ankyrin repeat protein; Provisional 100.0
PHA02876682 ankyrin repeat protein; Provisional 100.0
PHA03100480 ankyrin repeat protein; Provisional 100.0
KOG0509|consensus 600 100.0
KOG4412|consensus226 100.0
PHA02946446 ankyin-like protein; Provisional 100.0
PHA02716764 CPXV016; CPX019; EVM010; Provisional 100.0
PHA03095471 ankyrin-like protein; Provisional 100.0
PHA02874434 ankyrin repeat protein; Provisional 100.0
KOG0510|consensus 929 100.0
PHA02875413 ankyrin repeat protein; Provisional 100.0
PHA03095471 ankyrin-like protein; Provisional 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
PHA02716764 CPXV016; CPX019; EVM010; Provisional 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
PHA03100480 ankyrin repeat protein; Provisional 100.0
PHA02874434 ankyrin repeat protein; Provisional 100.0
PHA02878477 ankyrin repeat protein; Provisional 100.0
PHA02989494 ankyrin repeat protein; Provisional 100.0
PHA02875413 ankyrin repeat protein; Provisional 100.0
PHA02878477 ankyrin repeat protein; Provisional 99.97
PHA02730672 ankyrin-like protein; Provisional 99.97
PHA02798489 ankyrin-like protein; Provisional 99.97
PHA02730672 ankyrin-like protein; Provisional 99.97
PHA02917661 ankyrin-like protein; Provisional 99.97
PHA02798489 ankyrin-like protein; Provisional 99.97
PHA02989494 ankyrin repeat protein; Provisional 99.97
PHA02859209 ankyrin repeat protein; Provisional 99.97
KOG0508|consensus 615 99.97
KOG4177|consensus 1143 99.97
PHA02917661 ankyrin-like protein; Provisional 99.96
PHA02795437 ankyrin-like protein; Provisional 99.96
PHA02859209 ankyrin repeat protein; Provisional 99.96
KOG3609|consensus 822 99.96
KOG0509|consensus600 99.96
KOG4177|consensus 1143 99.95
KOG0508|consensus 615 99.95
PHA02792631 ankyrin-like protein; Provisional 99.95
PHA02795437 ankyrin-like protein; Provisional 99.94
PHA02792631 ankyrin-like protein; Provisional 99.93
KOG0502|consensus296 99.92
PLN03192823 Voltage-dependent potassium channel; Provisional 99.92
KOG0514|consensus452 99.92
PLN03192823 Voltage-dependent potassium channel; Provisional 99.91
KOG0502|consensus296 99.91
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.9
PHA02743166 Viral ankyrin protein; Provisional 99.9
PHA02884300 ankyrin repeat protein; Provisional 99.9
PHA02741169 hypothetical protein; Provisional 99.89
PHA02743166 Viral ankyrin protein; Provisional 99.89
KOG0507|consensus 854 99.88
PHA02741169 hypothetical protein; Provisional 99.88
KOG0505|consensus527 99.88
PHA02884300 ankyrin repeat protein; Provisional 99.87
KOG0507|consensus 854 99.87
PHA02736154 Viral ankyrin protein; Provisional 99.87
PHA02736154 Viral ankyrin protein; Provisional 99.86
KOG0514|consensus452 99.84
KOG0505|consensus527 99.83
KOG0512|consensus228 99.82
KOG4369|consensus 2131 99.82
KOG4369|consensus 2131 99.82
KOG0195|consensus448 99.81
KOG0512|consensus228 99.8
KOG0195|consensus448 99.75
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.75
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.75
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.73
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.72
KOG4214|consensus117 99.65
KOG3676|consensus 782 99.61
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.6
KOG4214|consensus117 99.59
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.55
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.49
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.47
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.46
KOG1710|consensus396 99.46
KOG1710|consensus396 99.43
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.43
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.42
KOG0515|consensus752 99.42
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.39
KOG0515|consensus752 99.35
KOG3614|consensus 1381 98.98
KOG0818|consensus 669 98.94
PF1360630 Ank_3: Ankyrin repeat 98.85
KOG0506|consensus622 98.84
KOG0783|consensus 1267 98.82
KOG0818|consensus 669 98.81
PF1360630 Ank_3: Ankyrin repeat 98.81
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.74
KOG0783|consensus 1267 98.72
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.71
KOG0506|consensus622 98.69
KOG0782|consensus1004 98.58
KOG0782|consensus1004 98.55
KOG3609|consensus 822 98.53
KOG0522|consensus 560 98.52
PLN03223 1634 Polycystin cation channel protein; Provisional 98.52
KOG0705|consensus749 98.5
KOG0705|consensus749 98.49
KOG0522|consensus 560 98.45
KOG2384|consensus223 98.36
KOG2384|consensus223 98.35
KOG0521|consensus785 98.3
KOG0521|consensus785 98.23
KOG0511|consensus 516 97.99
KOG0511|consensus 516 97.99
KOG0520|consensus975 97.9
PF08016425 PKD_channel: Polycystin cation channel; InterPro: 97.87
KOG0520|consensus975 97.55
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.98
KOG2505|consensus591 96.92
KOG2505|consensus591 96.92
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.8
PF00520200 Ion_trans: Ion transport protein calcium channel s 96.68
KOG3599|consensus 798 96.2
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 93.92
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 93.86
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 93.69
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 90.85
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 88.04
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 87.29
>KOG3676|consensus Back     alignment and domain information 
Probab=100.00  E-value=1.9e-61  Score=491.86  Aligned_cols=421  Identities=39%  Similarity=0.642  Sum_probs=380.1

Q ss_pred             ccccccccccCCCCCChHHHHHHHcCCcchHHHHHHHHHhCCCCCCccccCCCCCCCcHHHHHHHhCCHHHHHHHHHcCC
Q psy14474        113 DHEACWQMQYRGSLGETLLHVLIICDTKLHTRLARTLLKCFPRLSQDVVEGEEYLGASALHLAIAYANNELVADLIEAGA  192 (550)
Q Consensus       113 ~~~~~~~~~~~d~~g~t~Lh~A~~~~~~g~~~~v~~Ll~~~~~~~~~i~~~~~~~g~tpLh~A~~~g~~~~v~~Ll~~ga  192 (550)
                      .+..+++++.|...|+|.||.|..+.+.+|-++++.|++..|++-.|+-..+.+.|.||||+|+.+.+.++|++|++.||
T Consensus       129 ~r~~~w~~~~RGa~GET~Lh~~lL~~~~~~n~la~~LL~~~p~lind~~~~eeY~GqSaLHiAIv~~~~~~V~lLl~~gA  208 (782)
T KOG3676|consen  129 YRLTDWKLNERGATGETLLHKALLNLSDGHNELARVLLEIFPKLINDIYTSEEYYGQSALHIAIVNRDAELVRLLLAAGA  208 (782)
T ss_pred             hhhhhhccccccchhhhHHHHHHhcCchhHHHHHHHHHHHhHHHhhhhhhhHhhcCcchHHHHHHhccHHHHHHHHHcCC
Confidence            35557889999999999999999998899999999999999988777878888999999999999999999999999999


Q ss_pred             CCCccccccccccccCCCCCCCCCCCccCCCCCCchHHHHHHhcCCHHHHHHHHHCCCCCCCcCCCCChHHHHHHHCCCH
Q psy14474        193 NVTQRAIGSFFLPRDQQTPRPSRHTDYEGLAYLGEYPLSWAACCSNESVYNLLIDSGAIPDAKDSFGNMILHMVVVNDKL  272 (550)
Q Consensus       193 ~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~g~tpLh~A~~~g~~~~v~~Ll~~ga~i~~~d~~g~tpLh~A~~~g~~  272 (550)
                      |++++..|.++...+++...  +..++...-+.|..||.+||+.++.|++++|+++|||++++|..|+|.||..+..-..
T Consensus       209 DV~aRa~G~FF~~~dqk~~r--k~T~Y~G~~YfGEyPLSfAAC~nq~eivrlLl~~gAd~~aqDS~GNTVLH~lVi~~~~  286 (782)
T KOG3676|consen  209 DVHARACGAFFCPDDQKASR--KSTNYTGYFYFGEYPLSFAACTNQPEIVRLLLAHGADPNAQDSNGNTVLHMLVIHFVT  286 (782)
T ss_pred             chhhHhhccccCcccccccc--cccCCcceeeeccCchHHHHHcCCHHHHHHHHhcCCCCCccccCCChHHHHHHHHHHH
Confidence            99999999998887765443  4455555668899999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHhCCCCCCC--CCCCCCCCCCHHHHHHHcCCHHHHHHHHhcccccccccCcccccCCCCCcccccCcCCCCchh
Q psy14474        273 DMFGYALRHPKTPAS--NGILNNDGFTPLTLSCQLGRADVFREMLELSCKEFWRYSNITCSAYPLNALDTLLPDGRTNWN  350 (550)
Q Consensus       273 ~~v~~Ll~~g~~~~~--~~~~~~~g~tpL~~A~~~g~~~~~~~Ll~~g~~~~~~~~~~~~~~~~l~~~~~~~~~g~~~~~  350 (550)
                      ++.++++++|   ++  ...+|++|.|||.+|++.|+.++.+.++++.....|++++++|+.||++.+|++.     ..+
T Consensus       287 ~My~~~L~~g---a~~l~~v~N~qgLTPLtLAaklGk~emf~~ile~~k~~~W~YGpvtsslYpL~~iDT~~-----n~~  358 (782)
T KOG3676|consen  287 EMYDLALELG---ANALEHVRNNQGLTPLTLAAKLGKKEMFQHILERRKFTDWAYGPVTSSLYPLNSIDTIG-----NEN  358 (782)
T ss_pred             HHHHHHHhcC---CCccccccccCCCChHHHHHHhhhHHHHHHHHHhhcccceeecccccccccchhccccc-----chh
Confidence            9999999999   66  8899999999999999999999999999998889999999999999999999986     458


Q ss_pred             hHHHHHHhCCchhhhhhcchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhheeeecCCCCCCCCCc--cccchhh
Q psy14474        351 SALFIILNGTKEAHLDMLDGGIIQRLLEEKWKTFAQRQFMKRLLILSLHLLFMSLAVYFRPTDRDEPLLGG--TDWQSIA  428 (550)
Q Consensus       351 ~~~~~~~~g~~~~~~~~~~~~~v~~ll~~k~~~~~~~~~~~~~l~~~l~l~~lt~~~~~~~~~~~~~~~~~--~~~~~~~  428 (550)
                      ++++++.+|.++.|+.++.+ +++.|++.||+.|++..|+.+++.|++|++++|++++++|.....+....  ....++.
T Consensus       359 SvLeivvyg~~~eHl~Ll~~-~i~~LL~~KW~~f~k~~f~~~~~~~~~y~i~ft~~~y~RP~~~~~~~~~~~~~~~~~~~  437 (782)
T KOG3676|consen  359 SVLEIVVYGIKNEHLELLDG-PIEELLEDKWKAFGKKQFFMSLLIYLLYMICFTLAFYYRPALEQAKLLDEAYINDYDEL  437 (782)
T ss_pred             hhhhhhhcCCcHHHHHHHhH-HHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHhhccccccccchhhccccCchhh
Confidence            89999999999999999998 89999999999999999999999999999999999999995444333333  2333459


Q ss_pred             HHHHHHHHHHhHHHHHHHhhhhhHHhhchHhHHhhhhcC-chHHHHHHHHHHHHHhhhhhccCCcchhHHHHHHHHHHHH
Q psy14474        429 RYCFEIGTICGVVSYIIFQQGGEIKNQGFSSFMKQLKNE-PAKLIFLISNIMILSCIPFRIMGDKKTEEAILIFAVPGSW  507 (550)
Q Consensus       429 ~~~~~~~~~~~~~~~~~~e~~~~~~~~~~~~y~~~~~~~-~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~a~ai~lsw  507 (550)
                      |+++|.+.++|.++++..++.. ++.++...|+.+.... ++.++.++..+++++..+.++... +|+..++++|..++|
T Consensus       438 r~~~e~~~l~~~~~~~~~~~~~-if~~~~~~~~~~~~~~~~~~v~~~~~~~l~l~~~~~~i~~~-~~~~~~lvfAl~lgW  515 (782)
T KOG3676|consen  438 RLAGETLTLLGGILFLFCELPD-IFLQGLPAYNGQLIDGPLFHVLGFLQAVLVLVSPVLRLGAI-KWELALLVFALVLGW  515 (782)
T ss_pred             hhhhhHHHhhhhHhhhhhhhHh-HHhcccHHHHHHhhccchHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHH
Confidence            9999999999999999888777 7788888888887666 888888888888888777777765 899999999999999


Q ss_pred             HHHHHHhhccCCCCchhHHHHHHHHhhhhhheeeeeccc
Q psy14474        508 FLLMFFAGAIRLTGPFVTMVYSMITGDMLTLATNGRDTC  546 (550)
Q Consensus       508 ~~ll~~~r~~~~~G~~vim~~~~i~~d~~kF~~if~~~~  546 (550)
                      .++|||.|+|+.+|||++|++|||.+|++||++||....
T Consensus       516 ~~~Lyf~Rgfq~~Gpf~~MIykmI~~DL~RF~~IY~Vfl  554 (782)
T KOG3676|consen  516 KNLLYFTRGFQLTGPFVIMIYKMIFGDLFRFLLIYLVFL  554 (782)
T ss_pred             HHHHHHHhcccccccHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            999999999999999999999999999999999997654

>KOG0510|consensus Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG4412|consensus Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0509|consensus Back     alignment and domain information
>KOG4412|consensus Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0510|consensus Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0508|consensus Back     alignment and domain information
>KOG4177|consensus Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG3609|consensus Back     alignment and domain information
>KOG0509|consensus Back     alignment and domain information
>KOG4177|consensus Back     alignment and domain information
>KOG0508|consensus Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0502|consensus Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG0514|consensus Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG0502|consensus Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0507|consensus Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>KOG0505|consensus Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0507|consensus Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0514|consensus Back     alignment and domain information
>KOG0505|consensus Back     alignment and domain information
>KOG0512|consensus Back     alignment and domain information
>KOG4369|consensus Back     alignment and domain information
>KOG4369|consensus Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>KOG0512|consensus Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG4214|consensus Back     alignment and domain information
>KOG3676|consensus Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG4214|consensus Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG1710|consensus Back     alignment and domain information
>KOG1710|consensus Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>KOG3614|consensus Back     alignment and domain information
>KOG0818|consensus Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0506|consensus Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>KOG0818|consensus Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0506|consensus Back     alignment and domain information
>KOG0782|consensus Back     alignment and domain information
>KOG0782|consensus Back     alignment and domain information
>KOG3609|consensus Back     alignment and domain information
>KOG0522|consensus Back     alignment and domain information
>PLN03223 Polycystin cation channel protein; Provisional Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>KOG0522|consensus Back     alignment and domain information
>KOG2384|consensus Back     alignment and domain information
>KOG2384|consensus Back     alignment and domain information
>KOG0521|consensus Back     alignment and domain information
>KOG0521|consensus Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>KOG0520|consensus Back     alignment and domain information
>PF08016 PKD_channel: Polycystin cation channel; InterPro: IPR013122 Polycystic kidney diseases (PKD) are disorders characterised by large numbers of cysts distributed throughout grossly-enlarged kidneys Back     alignment and domain information
>KOG0520|consensus Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG2505|consensus Back     alignment and domain information
>KOG2505|consensus Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>PF00520 Ion_trans: Ion transport protein calcium channel signature potassium channel signature sodium channel signature; InterPro: IPR005821 This group of proteins is found in sodium, potassium, and calcium ion channels proteins Back     alignment and domain information
>KOG3599|consensus Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query550
2rfa_A232 Crystal Structure Of The Mouse Trpv6 Ankyrin Repeat 3e-22
3jxi_A260 Crystal Structure Of The Chicken Trpv4 Ankyrin Repe 3e-14
4dx1_A259 Crystal Structure Of The Human Trpv4 Ankyrin Repeat 1e-13
2eta_A256 Crystal Structure Of The Ankyrin Repeat Domain Of T 2e-13
2etc_A274 Crystal Structure Of The Ankyrin Repeat Domain Of T 3e-13
2nyj_A273 Crystal Structure Of The Ankyrin Repeat Domain Of T 3e-12
2f37_A251 Crystal Structure Of The Ankyrin Repeat Domain Of H 4e-11
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 1e-05
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 1e-05
3aji_A231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 1e-05
1uoh_A226 Human Gankyrin Length = 226 1e-05
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 1e-05
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 3e-05
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 2e-04
2he0_A253 Crystal Structure Of A Human Notch1 Ankyrin Domain 5e-04
>pdb|2RFA|A Chain A, Crystal Structure Of The Mouse Trpv6 Ankyrin Repeat Domain Length = 232 Back     alignment and structure 
Iteration: 1

 Score =  103 bits (256), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 70/219 (31%), Positives = 108/219 (49%), Gaps = 23/219 (10%)
Query: 105 LDPLSKWRDHEACWQMQYRGSLGETLLHVLIICDTKLHTRLARTLLKCFPRLSQDVVEGE 164
           +  LSK    E C ++  RG++GET LH+  + D       A  L++  P L  + +  E
Sbjct: 16  VQALSKLLKFEGC-EVHQRGAMGETALHIAALYDN---LEAAMVLMEAAPELVFEPMTSE 71
Query: 165 EYLGASALHLAIAYANNELVADLIEAGANVTQRAIGSFFLPRDQQTPRPSRHTDYEGLAY 224
            Y G +ALH+A+   N  LV  L+  GA+V+ RA GS F            H     L Y
Sbjct: 72  LYEGQTALHIAVINQNVNLVRALLARGASVSARATGSVF------------HYRPHNLIY 119
Query: 225 LGEYPLSWAACCSNESVYNLLIDSGAIPDAKDSFGNMILHMVVVNDK----LDMFGYALR 280
            GE+PLS+AAC  +E +  LLI+ GA   A+DS GN +LH++++         M+   L 
Sbjct: 120 YGEHPLSFAACVGSEEIVRLLIEHGADIRAQDSLGNTVLHILILQPNKTFACQMYNLLLS 179
Query: 281 H---PKTPASNGILNNDGFTPLTLSCQLGRADVFREMLE 316
           +       +   + NN G TP  L+   G   +F+ +++
Sbjct: 180 YDGGDHLKSLELVPNNQGLTPFKLAGVEGNIVMFQHLMQ 218
>pdb|3JXI|A Chain A, Crystal Structure Of The Chicken Trpv4 Ankyrin Repeat Domain Length = 260 Back     alignment and structure
>pdb|4DX1|A Chain A, Crystal Structure Of The Human Trpv4 Ankyrin Repeat Domain Length = 259 Back     alignment and structure
>pdb|2ETA|A Chain A, Crystal Structure Of The Ankyrin Repeat Domain Of The Trpv2 Length = 256 Back     alignment and structure
>pdb|2ETC|A Chain A, Crystal Structure Of The Ankyrin Repeat Domain Of Trpv2 Length = 274 Back     alignment and structure
>pdb|2NYJ|A Chain A, Crystal Structure Of The Ankyrin Repeat Domain Of Trpv1 Length = 273 Back     alignment and structure
>pdb|2F37|A Chain A, Crystal Structure Of The Ankyrin Repeat Domain Of Human Trpv2 Length = 251 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|2HE0|A Chain A, Crystal Structure Of A Human Notch1 Ankyrin Domain Mutant Length = 253 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query550
2pnn_A273 Transient receptor potential cation channel subfa 9e-41
2etb_A256 Transient receptor potential cation channel subfam 1e-39
3jxi_A260 Vanilloid receptor-related osmotically activated p 4e-39
3jxi_A260 Vanilloid receptor-related osmotically activated p 8e-06
2rfa_A232 Transient receptor potential cation channel subfa 9e-23
2rfa_A232 Transient receptor potential cation channel subfa 3e-07
2rfa_A232 Transient receptor potential cation channel subfa 4e-06
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-12
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 7e-12
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-11
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 8e-11
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-10
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 4e-10
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 5e-09
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 4e-08
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-05
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 3e-12
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-06
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 6e-05
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-11
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-07
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-07
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-07
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 5e-11
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-10
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 4e-07
3v31_A167 Ankyrin repeat family A protein 2; structural geno 5e-11
3v31_A167 Ankyrin repeat family A protein 2; structural geno 8e-11
3v31_A167 Ankyrin repeat family A protein 2; structural geno 6e-04
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 5e-11
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 4e-06
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 3e-05
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 7e-11
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 6e-10
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 1e-05
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 7e-11
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 5e-09
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-08
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-07
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 4e-05
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 8e-11
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-10
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 5e-09
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-07
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-10
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-10
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 6e-08
3v30_A172 DNA-binding protein rfxank; structural genomics co 1e-10
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-09
3v30_A172 DNA-binding protein rfxank; structural genomics co 4e-07
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 2e-10
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-10
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-08
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 1e-04
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-10
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 3e-08
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 4e-08
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-07
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 3e-10
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-07
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-07
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 5e-07
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 4e-06
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 4e-06
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 3e-10
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 5e-08
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-07
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-04
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 4e-10
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 6e-10
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 9e-09
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 7e-08
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-07
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 7e-04
1awc_B153 Protein (GA binding protein beta 1); complex (tran 5e-10
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-09
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 6e-10
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 3e-08
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 7e-10
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-09
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-09
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-08
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-07
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-06
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-06
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 7e-10
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 8e-08
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 7e-10
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 8e-10
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 3e-09
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 3e-08
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 9e-10
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-09
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-08
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-04
3deo_A183 Signal recognition particle 43 kDa protein; chloro 1e-09
3deo_A183 Signal recognition particle 43 kDa protein; chloro 5e-08
3deo_A183 Signal recognition particle 43 kDa protein; chloro 3e-07
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-09
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 9e-08
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-07
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-04
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-09
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 7e-08
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 3e-04
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 3e-09
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-07
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-07
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 3e-07
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 4e-06
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 3e-09
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 4e-09
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 4e-08
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 5e-08
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-07
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-05
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 3e-09
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-08
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 7e-06
3hra_A201 Ankyrin repeat family protein; structural protein; 3e-09
3hra_A201 Ankyrin repeat family protein; structural protein; 9e-05
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 4e-09
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 8e-07
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 1e-04
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 6e-04
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 4e-09
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 7e-09
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 1e-07
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 5e-06
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 8e-09
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-07
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-06
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 9e-09
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-08
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-05
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 1e-08
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 1e-08
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-08
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-08
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 5e-08
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-07
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-06
1sw6_A327 Regulatory protein SWI6; transcription regulation, 1e-07
1sw6_A327 Regulatory protein SWI6; transcription regulation, 2e-04
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-07
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-06
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 2e-07
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 3e-06
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 9e-06
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-07
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 5e-07
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 3e-06
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 6e-07
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 5e-06
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 4e-06
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 5e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 4e-05
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 3e-04
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 4e-04
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
 Score =  147 bits (373), Expect = 9e-41
 Identities = 60/241 (24%), Positives = 89/241 (36%), Gaps = 34/241 (14%)

Query: 98  VEKVLSPLDPLSKWRDHEACWQMQYRGSLGETLLHVLIICDTKLHTRLARTLLK------ 151
            +++ S L  L + +      + +     G+T L   ++            LL       
Sbjct: 26  CQELESLLPFLQRSKKRLTDSEFK-DPETGKTCLLKAMLNLHNGQNDTIALLLDVARKTD 84

Query: 152 CFPRLSQDVVEGEEYLGASALHLAIAYANNELVADLIEAGANVTQRAIGSFFLPRDQQTP 211
              +          Y G +ALH+AI   N  LV  L+E GA+V   A G FF        
Sbjct: 85  SLKQFVNASYTDSYYKGQTALHIAIERRNMTLVTLLVENGADVQAAANGDFF-------- 136

Query: 212 RPSRHTDYEGLAYLGEYPLSWAACCSNESVYNLLIDSG---AIPDAKDSFGNMILHMVVV 268
              + T      Y GE PLS AAC +  ++   L+ +    A   A+DS GN +LH +V 
Sbjct: 137 ---KKTKGRPGFYFGELPLSLAACTNQLAIVKFLLQNSWQPADISARDSVGNTVLHALVE 193

Query: 269 NDKLD---------MFGYALRHPK----TPASNGILNNDGFTPLTLSCQLGRADVFREML 315
                         M+   L        T     I N  G TPL L+   G+  V   +L
Sbjct: 194 VADNTVDNTKFVTSMYNEILILGAKLHPTLKLEEITNRKGLTPLALAASSGKIGVLAYIL 253

Query: 316 E 316
           +
Sbjct: 254 Q 254
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query550
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
2rfa_A232 Transient receptor potential cation channel subfa 100.0
4gpm_A169 Engineered protein OR264; de novo protein, structu 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
2etb_A256 Transient receptor potential cation channel subfam 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
2pnn_A273 Transient receptor potential cation channel subfa 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
3hra_A201 Ankyrin repeat family protein; structural protein; 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
2rfa_A232 Transient receptor potential cation channel subfa 100.0
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 100.0
3jxi_A260 Vanilloid receptor-related osmotically activated p 100.0
2etb_A256 Transient receptor potential cation channel subfam 99.98
2pnn_A273 Transient receptor potential cation channel subfa 99.98
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.97
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.97
3hra_A201 Ankyrin repeat family protein; structural protein; 99.97
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.97
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.97
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.97
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.97
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.97
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.97
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.97
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.97
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.97
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.97
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.96
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.96
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.96
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.96
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.95
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.95
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.95
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.95
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.95
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.95
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.95
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.95
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.95
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.94
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.94
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.94
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.94
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.94
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.94
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.94
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.94
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.94
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.93
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.93
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.93
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.92
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.92
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.92
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.92
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.92
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.91
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.91
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.9
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.9
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.9
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.89
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.89
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.89
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.89
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.88
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.88
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.88
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.87
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.87
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.87
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.86
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.86
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.86
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.85
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.83
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.78
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.76
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
Probab=100.00  E-value=6.1e-41  Score=348.83  Aligned_cols=275  Identities=21%  Similarity=0.184  Sum_probs=169.2

Q ss_pred             CccchhhhhhcCCCCccccccccccccccccCCCCCChHHHHHHHcCCcchHHHHHHHHHhCCCCCCccccCCCCCCCcH
Q psy14474         92 DQFVIPVEKVLSPLDPLSKWRDHEACWQMQYRGSLGETLLHVLIICDTKLHTRLARTLLKCFPRLSQDVVEGEEYLGASA  171 (550)
Q Consensus        92 ~~~~~~~~~~~~~~d~~~~l~~~~~~~~~~~~d~~g~t~Lh~A~~~~~~g~~~~v~~Ll~~~~~~~~~i~~~~~~~g~tp  171 (550)
                      +.+++++|+..|+.++++.|++.+..  ++.+|..|.||||+|+..   |+.+++++|+++    +++++..+ ..|.||
T Consensus        80 g~t~L~~A~~~g~~~~v~~Ll~~ga~--~~~~~~~g~t~L~~A~~~---g~~~~v~~Ll~~----~~~~~~~~-~~g~t~  149 (437)
T 1n11_A           80 DQTPLHCAARIGHTNMVKLLLENNAN--PNLATTAGHTPLHIAARE---GHVETVLALLEK----EASQACMT-KKGFTP  149 (437)
T ss_dssp             SCCHHHHHHHHTCHHHHHHHHHHTCC--TTCCCTTCCCHHHHHHHH---TCHHHHHHHHHT----TCCSCCCC-TTSCCH
T ss_pred             CCCHHHHHHHCCCHHHHHHHHhCCCC--CCCCCCCCCcHHHHHHHc---CCHHHHHHHHhC----CCCCcCCC-CCCCCH
Confidence            34556666666777776666665543  566666677777777743   444777777766    44444333 356677


Q ss_pred             HHHHHHhCCHHHHHHHHHcCCCCCcccc-ccccccccCCCCCC-------CCCCCccCCCCCCchHHHHHHhcCCHHHHH
Q psy14474        172 LHLAIAYANNELVADLIEAGANVTQRAI-GSFFLPRDQQTPRP-------SRHTDYEGLAYLGEYPLSWAACCSNESVYN  243 (550)
Q Consensus       172 Lh~A~~~g~~~~v~~Ll~~ga~~~~~~~-g~~~~~~~~~~~~~-------~~~~~~~~~~~~g~tpLh~A~~~g~~~~v~  243 (550)
                      ||+|+..|+.+++++|+++|++++..+. |.++++.++..+..       .++.+++.++..|.||||+|+..|+.++++
T Consensus       150 L~~A~~~g~~~~v~~Ll~~g~~~~~~~~~g~t~L~~A~~~~~~~~v~~Ll~~g~~~~~~~~~g~t~L~~A~~~~~~~~~~  229 (437)
T 1n11_A          150 LHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVAR  229 (437)
T ss_dssp             HHHHHHTTCHHHHHHHHHTTCCTTCCCSSCCCHHHHHHHTTCHHHHHHHGGGTCCSCCCCTTCCCHHHHHHHTTCHHHHH
T ss_pred             HHHHHHcCCHHHHHHHHhCCCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHhCCCCCCCcCCCCCCHHHHHHHcCCHHHHH
Confidence            7777777777777777777777666664 66666665544432       355666666666677777777777777777


Q ss_pred             HHHHCCCCCCCcCCCCChHHHHHHHCCCHHHHHHHHhCCCCCCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHhccccccc
Q psy14474        244 LLIDSGAIPDAKDSFGNMILHMVVVNDKLDMFGYALRHPKTPASNGILNNDGFTPLTLSCQLGRADVFREMLELSCKEFW  323 (550)
Q Consensus       244 ~Ll~~ga~i~~~d~~g~tpLh~A~~~g~~~~v~~Ll~~g~~~~~~~~~~~~g~tpL~~A~~~g~~~~~~~Ll~~g~~~~~  323 (550)
                      +|+++|++++.++..|.||||+|+..|+.+++++|+++|   ++++.+|..|.||||+|+..|+.+++++|+++|++   
T Consensus       230 ~Ll~~g~~~~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~~---~~~~~~~~~g~t~L~~A~~~~~~~~~~~Ll~~g~~---  303 (437)
T 1n11_A          230 SLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQ---ANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVM---  303 (437)
T ss_dssp             HHHHTTCCTTCCCTTCCCHHHHHHHTTCHHHHHHHHTTT---CCTTCCCTTCCCHHHHHHHHTCHHHHHHHHHHTCC---
T ss_pred             HHHHcCCCCCCCCCCCCCHHHHHHHCCCHHHHHHHHhcC---CCCCCCCCCCCCHHHHHHHcCCHHHHHHHHhCCcc---
Confidence            777777777766666777777777777777777777666   66666666777777777777777777777776666   


Q ss_pred             ccCcccccCCCCCcccccCcCCCCchhhHHHH---------H----------HhCCchhhhhhcch--HHHHHHHHHHHH
Q psy14474        324 RYSNITCSAYPLNALDTLLPDGRTNWNSALFI---------I----------LNGTKEAHLDMLDG--GIIQRLLEEKWK  382 (550)
Q Consensus       324 ~~~~~~~~~~~l~~~~~~~~~g~~~~~~~~~~---------~----------~~g~~~~~~~~~~~--~~v~~ll~~k~~  382 (550)
                                    ++..+..|.||++.+...         +          ..|.+|+|.++..+  ++++.|+++|++
T Consensus       304 --------------~~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~gad~n~~~~~g~t~L~~A~~~g~~~iv~~Ll~~ga~  369 (437)
T 1n11_A          304 --------------VDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGAS  369 (437)
T ss_dssp             --------------TTCCCSSCCCHHHHHHHSSCSHHHHHHHHTTCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCC
T ss_pred             --------------CCCCCCCCCCHHHHHHHcCcHHHHHHHHhcCCCCCCCCCCCCCHHHHHHHCChHHHHHHHHHCcCC
Confidence                          444445555555554210         0          12334444444433  456666666655


Q ss_pred             HHHHHHHHHHHHHH
Q psy14474        383 TFAQRQFMKRLLIL  396 (550)
Q Consensus       383 ~~~~~~~~~~~l~~  396 (550)
                      +..++..+.+++.+
T Consensus       370 ~~~~~~~g~t~l~~  383 (437)
T 1n11_A          370 PNEVSSDGTTPLAI  383 (437)
T ss_dssp             SCCCCSSSCCHHHH
T ss_pred             CCCCCCCCCCHHHH
Confidence            54444444444443
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 550
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-12
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 4e-10
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 3e-09
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-07
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 5e-07
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 2e-12
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 2e-05
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-04
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 3e-07
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 0.001
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 0.001
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 2e-06
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-05
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-05
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 1e-05
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 2e-05
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 2e-05
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 5e-05
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 3e-04
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 8e-05
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 1e-04
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 2e-04
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 0.002
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-04
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 0.003
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 4e-04
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 6e-04
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 0.002
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 67.3 bits (163), Expect = 1e-12
 Identities = 44/209 (21%), Positives = 72/209 (34%), Gaps = 19/209 (9%)

Query: 123 RGSLGETLLHVLIICDTKLHTRLARTLLKCFPRLSQDVVEGEEYLGASALHLAIAYANNE 182
                ET LH+        HT +A+ LL+   +     V  +     + LH A    +  
Sbjct: 29  SNVKVETPLHMAARAG---HTEVAKYLLQNKAK-----VNAKAKDDQTPLHCAARIGHTN 80

Query: 183 LVADLIEAGANVTQRAIGSFFLPRD--------QQTPRPSRHTDYEGLAYLGEYPLSWAA 234
           +V  L+E  AN                             +      +   G  PL  AA
Sbjct: 81  MVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAA 140

Query: 235 CCSNESVYNLLIDSGAIPDAKDSFGNMILHMVVVNDKLDMFGYALRHPKTPASNGILNND 294
                 V  LL++  A P+A    G   LH+ V ++ LD+    L       S      +
Sbjct: 141 KYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPR---GGSPHSPAWN 197

Query: 295 GFTPLTLSCQLGRADVFREMLELSCKEFW 323
           G+TPL ++ +  + +V R +L+       
Sbjct: 198 GYTPLHIAAKQNQVEVARSLLQYGGSANA 226
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query550
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.98
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.98
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.97
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.97
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.97
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.97
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.96
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.96
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.95
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.95
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.95
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.95
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.95
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.95
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.95
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.94
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.94
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.94
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.93
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.93
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.93
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.92
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.92
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.92
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.91
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.91
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.91
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.91
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.9
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.89
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.89
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.89
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.89
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.88
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Transcription factor inhibitor I-kappa-B-beta, IKBB
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=100.00  E-value=1.1e-35  Score=283.63  Aligned_cols=222  Identities=19%  Similarity=0.185  Sum_probs=182.7

Q ss_pred             ccCCcchHHHHHhcChHHHHHHHHHhhccccccCCCCCccchHHHhhhhccCCCccchhhhhhcCCCCcccccccccccc
Q psy14474         39 YKNGGELVDAYNIGGQVEVEKLIKEQFGVLMYNDGTGQVIDKTEYLKWRYRDSDQFVIPVEKVLSPLDPLSKWRDHEACW  118 (550)
Q Consensus        39 ~~~~~~ll~~a~~~g~~~~~k~L~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~d~~~~l~~~~~~~  118 (550)
                      +++|.||||.||.+|+.+++++|++.+.+       ..                                          
T Consensus         6 ~~~G~t~Lh~A~~~~~~~~v~~Ll~~~a~-------~~------------------------------------------   36 (255)
T d1oy3d_           6 TEDGDTALHLAVIHQHEPFLDFLLGFSAG-------HE------------------------------------------   36 (255)
T ss_dssp             CTTCCCHHHHHHHTTCHHHHHHHHHHHTT-------SG------------------------------------------
T ss_pred             CcCCCCHHHHHHHcCCHHHHHHHHHcCCC-------cc------------------------------------------
Confidence            46799999999999999999999975311       00                                          


Q ss_pred             ccccCCCCCChHHHHHHHcCCcchHHHHHHHHHhCCCCCCccccCCCCCCCcHHHHHHHhCCHHHHHHHHHcCCCCCccc
Q psy14474        119 QMQYRGSLGETLLHVLIICDTKLHTRLARTLLKCFPRLSQDVVEGEEYLGASALHLAIAYANNELVADLIEAGANVTQRA  198 (550)
Q Consensus       119 ~~~~~d~~g~t~Lh~A~~~~~~g~~~~v~~Ll~~~~~~~~~i~~~~~~~g~tpLh~A~~~g~~~~v~~Ll~~ga~~~~~~  198 (550)
                      .++.+|..|+||||+|+..+   +.+++++|+++    |++++..+ .+|.||||+|+..|+.++++.|++.+.......
T Consensus        37 ~i~~~~~~g~TpL~~A~~~g---~~~iv~~Ll~~----ga~i~~~d-~~g~tpL~~A~~~~~~~~~~~Ll~~~~~~~~~~  108 (255)
T d1oy3d_          37 YLDLQNDLGQTALHLAAILG---EASTVEKLYAA----GAGVLVAE-RGGHTALHLACRVRAHTCACVLLQPRPSHPRDA  108 (255)
T ss_dssp             GGGCCCTTSCCHHHHHHHHT---CHHHHHHHHHT----TCCSSCCC-TTSCCHHHHHTTTTCHHHHHHHSSSCCSSCCCC
T ss_pred             cccCcCCCCCCccchHHhhc---ccccccccccc----cccccccc-cccchhhhhhhccCchHHHHHHHhhccchhccc
Confidence            15888999999999999654   56999999999    78887765 489999999999999999999998765433211


Q ss_pred             ccc--------------cccccc--------CCCCCCCCCCCccCCCCCCchHHHHHHhcCCHHHHHHHHHCCCCCCC-c
Q psy14474        199 IGS--------------FFLPRD--------QQTPRPSRHTDYEGLAYLGEYPLSWAACCSNESVYNLLIDSGAIPDA-K  255 (550)
Q Consensus       199 ~g~--------------~~~~~~--------~~~~~~~~~~~~~~~~~~g~tpLh~A~~~g~~~~v~~Ll~~ga~i~~-~  255 (550)
                      ...              ......        ........+.+++.+|..|.||||+|+..|+.+++++|+++|++.+. +
T Consensus       109 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~in~~d~~g~TpLh~A~~~~~~~~v~~Ll~~~~~~~~~~  188 (255)
T d1oy3d_         109 SDTYLTQSQDCTPDTSHAPAAVDSQPNPENEEEPRDEDWRLQLEAENYDGHTPLHVAVIHKDAEMVRLLRDAGADLNKPE  188 (255)
T ss_dssp             -----------------------------------CCCGGGGTTCCCTTSCCHHHHHHHTTCHHHHHHHHHHTCCTTCCC
T ss_pred             chhhhhHHhhhcccchHHHHHHHhhcchhHHHHHHhhhcCcccccccccCcccccccccccccccccchhcccccccccc
Confidence            100              000000        00111134667889999999999999999999999999999999886 4


Q ss_pred             CCCCChHHHHHHHCCCHHHHHHHHhCCCCCCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHhcccc
Q psy14474        256 DSFGNMILHMVVVNDKLDMFGYALRHPKTPASNGILNNDGFTPLTLSCQLGRADVFREMLELSCK  320 (550)
Q Consensus       256 d~~g~tpLh~A~~~g~~~~v~~Ll~~g~~~~~~~~~~~~g~tpL~~A~~~g~~~~~~~Ll~~g~~  320 (550)
                      +..|.||||+|++.|+.+++++|+++|   ++++.+|..|+||||+|+..|+.+++++|+++||+
T Consensus       189 ~~~g~TpL~~A~~~~~~~~v~~Ll~~g---adin~~d~~g~t~L~~A~~~~~~~i~~~Ll~~Ga~  250 (255)
T d1oy3d_         189 PTCGRTPLHLAVEAQAASVLELLLKAG---ADPTARMYGGRTPLGSALLRPNPILARLLRAHGAP  250 (255)
T ss_dssp             TTTCCCHHHHHHHTTCHHHHHHHHHTT---CCTTCCCTTSCCHHHHHHTSSCHHHHHHHHHTTCC
T ss_pred             cccccccccccccccHHHHHHHHHHCC---CCCCCCCCCCCCHHHHHHHCCCHHHHHHHHHcCCC
Confidence            678999999999999999999999999   99999999999999999999999999999999997
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure