Psyllid ID: psy14496

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-
MNYISSLNHSLINKYGPRESIEYDVIIVGGGPSGLSAAIRLKQLAIKKNKEIKICVLEKGSELGAHILSGAIIDPRSIFELFPKEKLNKLFNTPVIEERFLFLSSKKSYKIPSWILPICFKNHGNYIISLSDLVRWMGKKAENMGIDIFSGFSASEILYDSKNNVCGIATNNFGINKEGIIKKNFQLGMELYAKYTLFAEGSRGHLSKQIIKKFNLDNKKDPQTYSLGIKELWTINPKLHKKGLVIHTIGWPLDYKTYGGGFLYHMENNQISIGYIISLDYKNPYLSPFEEFQRYKTHPKICKILKGGKRISYGARTITTGGLQSLPEFIFDGGAFIGCNAGFMNVSRIKGIHTSIKSGILVADSIFKKICSNNKFNKLITYKTSFQASWLYKELYKARNFKPAMKKGLYIGMLIIGIDQILFSGKFPFTLHNINSDYTYLEPASKHIPIKYPNPDNKLTFDKLSSIYVSNINHDEDQPIHLILKNKKIPIHINFSIYAGPEARYCPAGVYEFIIEKNKIQHLQINAQNCIHCKTCDIKDPTQNIEWITPEGGSGTNYPNM
ccccccccccccccccccccEEEcEEEEcccHHHHHHHHHHHHHHHHcccccEEEEEccccccccEEccEEEEccccHHHHcccccccccccccEEEEEEEEEcccccEEcccccccccccccccEEEEHHHHHHHHHHHHHHcccEEEcccccEEEEEcccccEEEEEEcccccccccccccccccccEEEEcEEEEEccccHHHHHHHHHHcccccccccccEEEEEEEEEEEcccccccccEEEEEEcccccccccEEEEEEccccEEEEEEEEEcccccccccHHHHHHHHHccHHHHHHHcccEEEEEcEEEEcccccccccccccccEEEEEccccccccccccccHHHHHHHHHHHHHHHHHHHcccccccHHcHHHHHHHcHHHHHHHHHHHcHHHHHHccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccEEccccccccccccccccccEEEEEEccccEEEEEEcccccccccccccccccccEEEccccccccccccc
ccccccccHHHHHHccccHHccEEEEEEcccHHHHHHHHHHHHHHHHccccEEEEEEEcccHHcHHHHccccEcHHHHHHHcccHcccccccccccccEEEEEccccccccccccccccccccccEEEEHHHHHHHHHHHHHHcccEEcccccHHHHHEcccccEEEEEEcccccccccccccccccccEEEEEEEEEEcccccHHHHHHHHHHccccccccccEEEEEHEHHcccHHHccccEEEEEccccccccccccEEEEEccccEEEEEEEEEccccccccccHHHHHHHcccHHHHHHHccccHHHHHHHHHHHccccccccccccccEEEEcccccccHcHccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHccccHHHHcccHHHHHHHHHHHHHccccccEEcccccccHHHcccHHHcccccccccccEEEEccccEEEEEccccccccccEEEEccccccccccHHHccccccccccccEEEEEEccccccEEEEEccccEEEcccccccccccEEEEccccccccccccc
mnyisslnhslinkygpresieydviivgggpsGLSAAIRLKQLAIKKNKEIKICVLEKGselgahilsgaiidprsifelfpkeklnklfntpVIEERFLFLsskksykipswilpicfknhgnyiISLSDLVRWMGKKAEnmgidifsgfsaseilydsknnvcgiatnnfginkeGIIKKNFQLGMELYAKYTlfaegsrghlSKQIIKKFnldnkkdpqtyslGIKELWtinpklhkkglvihtigwpldyktygggfLYHMENNQISIGYIISldyknpylspfeefqrykthpkickilkggkrisygartittgglqslpefifdggafigcnagfmnvsriKGIHTSIKSGILVADSIFKKICSNNKFNKLITYKTSFQASWLYKELYKArnfkpamkkGLYIGMLIIGIdqilfsgkfpftlhninsdytylepaskhipikypnpdnkltfdKLSSIYVsninhdedqpihlilknkkipihinfsiyagpearycpagvYEFIIEKNKIQHLQINaqncihcktcdikdptqniewitpeggsgtnypnm
MNYISSLNHSLINKYGPRESIEYDVIIVGGGPSGLSAAIRLKQLAIKKNKEIKICVLEKGSELGAHILSGAIIDPRSIFELFPKEKLNKLFNTPVIEERFLFLSSKKSYKIPSWILPICFKNHGNYIISLSDLVRWMGKKAENMGIDIFSGFSASEILYDSKNNVCGIATNNFGINKEGIIKKNFQLGMELYAKYTLFAEGSRGHLSKQIIKKfnldnkkdpqtYSLGIKELWTINPKLHKKGLVIHTIGWPLDYKTYGGGFLYHMENNQISIGYIISLDYKNPYLSPFEEFQRYKTHPKICKILKGGKRISYGARTITTGGLQSLPEFIFDGGAFIGCNAGFMNVSRIKGIHTSIKSGILVADSIFKKICSNNKFNKLITYKTSFQASWLYKELYKARNFKPAMKKGLYIGMLIIGIDQILFSGKFPFTLHNINSDYTYLEPASKHIPIKYPNPDNKLTFDKLSSIYVSNINHDEDQPIHLILKNKKIPIHINFSIYAGPEARYCPAGVYEFIIEKNKIQHLQINAQNCIHCKTCDIKDPTQNiewitpeggsgtnypnm
MNYISSLNHSLINKYGPRESIEYDVIIVGGGPSGLSAAIRLKQLAIKKNKEIKICVLEKGSELGAHILSGAIIDPRSIFELFPKEKLNKLFNTPVIEERFLFLSSKKSYKIPSWILPICFKNHGNYIISLSDLVRWMGKKAENMGIDIFSGFSASEILYDSKNNVCGIATNNFGINKEGIIKKNFQLGMELYAKYTLFAEGSRGHLSKQIIKKFNLDNKKDPQTYSLGIKELWTINPKLHKKGLVIHTIGWPLDYKTYGGGFLYHMENNQISIGYIISLDYKNPYLSPFEEFQRYKTHPKICKILKGGKRISYGARTITTGGLQSLPEFIFDGGAFIGCNAGFMNVSRIKGIHTSIKSGILVADSIFKKICSNNKFNKLITYKTSFQASWLYKELYKARNFKPAMKKGLYIGMLIIGIDQILFSGKFPFTLHNINSDYTYLEPASKHIPIKYPNPDNKLTFDKLSSIYVSNINHDEDQPIHLILKNKKIPIHINFSIYAGPEARYCPAGVYEFIIEKNKIQHLQINAQNCIHCKTCDIKDPTQNIEWITPEGGSGTNYPNM
********HSLINKYGPRESIEYDVIIVGGGPSGLSAAIRLKQLAIKKNKEIKICVLEKGSELGAHILSGAIIDPRSIFELFPKEKLNKLFNTPVIEERFLFLSSKKSYKIPSWILPICFKNHGNYIISLSDLVRWMGKKAENMGIDIFSGFSASEILYDSKNNVCGIATNNFGINKEGIIKKNFQLGMELYAKYTLFAEGSRGHLSKQIIKKFNLDNKKDPQTYSLGIKELWTINPKLHKKGLVIHTIGWPLDYKTYGGGFLYHMENNQISIGYIISLDYKNPYLSPFEEFQRYKTHPKICKILKGGKRISYGARTITTGGLQSLPEFIFDGGAFIGCNAGFMNVSRIKGIHTSIKSGILVADSIFKKICSNNKFNKLITYKTSFQASWLYKELYKARNFKPAMKKGLYIGMLIIGIDQILFSGKFPFTLHNINSDYTYLEPASKHIPIKYPNPDNKLTFDKLSSIYVSNINHDEDQPIHLILKNKKIPIHINFSIYAGPEARYCPAGVYEFIIEKNKIQHLQINAQNCIHCKTCDIKDPTQNIEWIT************
*******************SIEYDVIIVGGGPSGLSAAIRLKQLAIKKNKEIKICVLEKGSELGAHILSGAIIDPRSIFELFPKEKLNKLFNTPVIEERFLFLSSKKSYKIPSWILPICFKNHGNYIISLSDLVRWMGKKAENMGIDIFSGFSASEILYDSKNNVCGIATNNFGINK*GI****FQLGMELYAKYTLFAEGSRGHLSKQIIK*****NKKDPQTYSLGIKELWTINPKLHKKGLVIHTIGWPLDYKTYGGGFLYHMENNQISIGYIISLDYKNPYLSPFEEFQRYKTHPKICKILKGGKRISYGARTITTGGLQSLPEFIFDGGAFIGCNAGFMNVSRIKGIHTSIKSGILVADSIFKKICSNNKFNKLITYKTSFQASWLYKELYKARNFKPAMKKGLYIGMLIIGIDQILFSGKFPFTLHNINSDYTYLEPASKHIPIKYPNPDNKLTFDKLSSIYVSNINHDEDQPIHLILKNKKIPIHINFSIYAGPEARYCPAGVYEFIIEKNKIQHLQINAQNCIHCKTCDIKDPTQNIEWITPEGGSG******
MNYISSLNHSLINKYGPRESIEYDVIIVGGGPSGLSAAIRLKQLAIKKNKEIKICVLEKGSELGAHILSGAIIDPRSIFELFPKEKLNKLFNTPVIEERFLFLSSKKSYKIPSWILPICFKNHGNYIISLSDLVRWMGKKAENMGIDIFSGFSASEILYDSKNNVCGIATNNFGINKEGIIKKNFQLGMELYAKYTLFAEGSRGHLSKQIIKKFNLDNKKDPQTYSLGIKELWTINPKLHKKGLVIHTIGWPLDYKTYGGGFLYHMENNQISIGYIISLDYKNPYLSPFEEFQRYKTHPKICKILKGGKRISYGARTITTGGLQSLPEFIFDGGAFIGCNAGFMNVSRIKGIHTSIKSGILVADSIFKKICSNNKFNKLITYKTSFQASWLYKELYKARNFKPAMKKGLYIGMLIIGIDQILFSGKFPFTLHNINSDYTYLEPASKHIPIKYPNPDNKLTFDKLSSIYVSNINHDEDQPIHLILKNKKIPIHINFSIYAGPEARYCPAGVYEFIIEKNKIQHLQINAQNCIHCKTCDIKDPTQNIEWITPEGGSGTNYPNM
*****************RESIEYDVIIVGGGPSGLSAAIRLKQLAIKKNKEIKICVLEKGSELGAHILSGAIIDPRSIFELFPKEKLNKLFNTPVIEERFLFLSSKKSYKIPSWILPICFKNHGNYIISLSDLVRWMGKKAENMGIDIFSGFSASEILYDSKNNVCGIATNNFGINKEGIIKKNFQLGMELYAKYTLFAEGSRGHLSKQIIKKFNLDNKKDPQTYSLGIKELWTINPKLHKKGLVIHTIGWPLDYKTYGGGFLYHMENNQISIGYIISLDYKNPYLSPFEEFQRYKTHPKICKILKGGKRISYGARTITTGGLQSLPEFIFDGGAFIGCNAGFMNVSRIKGIHTSIKSGILVADSIFKKICSNNKFNKLITYKTSFQASWLYKELYKARNFKPAMKKGLYIGMLIIGIDQILFSGKFPFTLHNINSDYTYLEPASKHIPIKYPNPDNKLTFDKLSSIYVSNINHDEDQPIHLILKNKKIPIHINFSIYAGPEARYCPAGVYEFIIEKNKIQHLQINAQNCIHCKTCDIKDPTQNIEWITPEGGSG******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNYISSLNHSLINKYGPRESIEYDVIIVGGGPSGLSAAIRLKQLAIKKNKEIKICVLEKGSELGAHILSGAIIDPRSIFELFPKEKLNKLFNTPVIEERFLFLSSKKSYKIPSWILPICFKNHGNYIISLSDLVRWMGKKAENMGIDIFSGFSASEILYDSKNNVCGIATNNFGINKEGIIKKNFQLGMELYAKYTLFAEGSRGHLSKQIIKKFNLDNKKDPQTYSLGIKELWTINPKLHKKGLVIHTIGWPLDYKTYGGGFLYHMENNQISIGYIISLDYKNPYLSPFEEFQRYKTHPKICKILKGGKRISYGARTITTGGLQSLPEFIFDGGAFIGCNAGFMNVSRIKGIHTSIKSGILVADSIFKKICSNNKFNKLITYKTSFQASWLYKELYKARNFKPAMKKGLYIGMLIIGIDQILFSGKFPFTLHNINSDYTYLEPASKHIPIKYPNPDNKLTFDKLSSIYVSNINHDEDQPIHLILKNKKIPIHINFSIYAGPEARYCPAGVYEFIIEKNKIQHLQINAQNCIHCKTCDIKDPTQNIEWITPEGGSGTNYPNM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query561 2.2.26 [Sep-21-2011]
Q9HZP5551 Electron transfer flavopr yes N/A 0.969 0.987 0.537 1e-174
Q2KIG0617 Electron transfer flavopr yes N/A 0.964 0.876 0.524 1e-172
P94132570 Probable electron transfe yes N/A 0.966 0.950 0.523 1e-172
Q921G7616 Electron transfer flavopr yes N/A 0.964 0.878 0.526 1e-171
Q16134617 Electron transfer flavopr yes N/A 0.964 0.876 0.524 1e-171
P55931617 Electron transfer flavopr yes N/A 0.964 0.876 0.524 1e-171
Q6UPE1616 Electron transfer flavopr yes N/A 0.964 0.878 0.524 1e-171
Q5RDD3617 Electron transfer flavopr yes N/A 0.953 0.867 0.524 1e-170
Q11190597 Electron transfer flavopr yes N/A 0.962 0.904 0.498 1e-159
Q54XM6606 Electron transfer flavopr yes N/A 0.964 0.892 0.466 1e-157
>sp|Q9HZP5|ETFD_PSEAE Electron transfer flavoprotein-ubiquinone oxidoreductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA2953 PE=1 SV=1 Back     alignment and function desciption
 Score =  610 bits (1573), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 295/549 (53%), Positives = 394/549 (71%), Gaps = 5/549 (0%)

Query: 18  RESIEYDVIIVGGGPSGLSAAIRLKQLAIKKNKEIKICVLEKGSELGAHILSGAIIDPRS 77
           RE +E+DV+IVG GP+GLSAA RLKQ A +  +EI +CV+EKGSE+GAHILSGA+ +PR+
Sbjct: 3   REYMEFDVVIVGAGPAGLSAACRLKQKAAEAGQEISVCVVEKGSEVGAHILSGAVFEPRA 62

Query: 78  IFELFPKEK-LNKLFNTPVI-EERFLFLSSKKSYKIPSWILPICFKNHGNYIISLSDLVR 135
           + ELFP  K L    NTPV  ++ ++  S++ + K+P++ +P    N GNYIISL +L R
Sbjct: 63  LNELFPDWKELGAPLNTPVTGDDIYVLKSAESATKVPNFFVPKTMHNEGNYIISLGNLCR 122

Query: 136 WMGKKAENMGIDIFSGFSASEILYDSKNNVCGIATNNFGINKEGIIKKNFQL-GMELYAK 194
           W+ ++AE +G++I+ GF+A E L D    V GI T + G+++EG  K+ +   GMEL AK
Sbjct: 123 WLAQQAEGLGVEIYPGFAAQEALIDENGVVRGIVTGDLGVDREGNPKEGYYTPGMELRAK 182

Query: 195 YTLFAEGSRGHLSKQIIKKFNLDNKKDPQTYSLGIKELWTINPKLHKKGLVIHTIGWPLD 254
           YTLFAEG RGH+ KQ+IKK+NLD++ D Q Y +GIKE+W I+P  HK GLV+HT GWPL+
Sbjct: 183 YTLFAEGCRGHIGKQLIKKYNLDSEADAQHYGIGIKEIWDIDPSKHKPGLVVHTAGWPLN 242

Query: 255 YKTYGGGFLYHMENNQISIGYIISLDYKNPYLSPFEEFQRYKTHPKICKILKGGKRISYG 314
            +  GG FLYH+ENNQ+ +G II L Y NP+LSPF+EFQRYK HP + + L+GGKR++YG
Sbjct: 243 DENTGGSFLYHLENNQVFVGLIIDLSYSNPHLSPFDEFQRYKHHPVVKQYLEGGKRVAYG 302

Query: 315 ARTITTGGLQSLPEFIFDGGAFIGCNAGFMNVSRIKGIHTSIKSGILVADSIFKKICSNN 374
           AR I  GGL SLP+ +F GGA IGC+ G +N ++IKG HT++KSG+L AD+I + + +  
Sbjct: 303 ARAICKGGLNSLPKMVFPGGALIGCDLGTLNFAKIKGSHTAMKSGMLAADAIAEALAAGR 362

Query: 375 K-FNKLITYKTSFQASWLYKELYKARNFKPAMKK-GLYIGMLIIGIDQILFSGKFPFTLH 432
           +  ++L +Y  +F+ASWLY EL+++RNF  A+ K G   G     IDQ +F GK P TLH
Sbjct: 363 EGGDELSSYVDAFKASWLYDELFRSRNFGAAIHKFGAIGGGAFNFIDQNIFGGKIPVTLH 422

Query: 433 NINSDYTYLEPASKHIPIKYPNPDNKLTFDKLSSIYVSNINHDEDQPIHLILKNKKIPIH 492
           +   DY  L+ AS+   I YP PD KL+FDKLSS+++SN NH+EDQPIHL L +  IPI 
Sbjct: 423 DDKPDYACLKKASEAPKIDYPKPDGKLSFDKLSSVFLSNTNHEEDQPIHLKLADASIPIE 482

Query: 493 INFSIYAGPEARYCPAGVYEFIIEKNKIQHLQINAQNCIHCKTCDIKDPTQNIEWITPEG 552
            N  +Y  P  RYCPAGVYE +   +  +  QINAQNC+HCKTCDIKDP QNI W+ PEG
Sbjct: 483 KNLPLYDEPAQRYCPAGVYEVVANDDGSKRFQINAQNCVHCKTCDIKDPAQNITWVAPEG 542

Query: 553 GSGTNYPNM 561
             G NYPNM
Sbjct: 543 TGGPNYPNM 551
Accepts electrons from ETF and reduces ubiquinone.
Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) (taxid: 208964)
EC: 1EC: .EC: 5EC: .EC: 5EC: .EC: 1
>sp|Q2KIG0|ETFD_BOVIN Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Bos taurus GN=ETFDH PE=2 SV=1 Back     alignment and function description
>sp|P94132|ETFD_ACIAD Probable electron transfer flavoprotein-ubiquinone oxidoreductase OS=Acinetobacter sp. (strain ADP1) GN=etfD PE=4 SV=1 Back     alignment and function description
>sp|Q921G7|ETFD_MOUSE Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Mus musculus GN=Etfdh PE=1 SV=1 Back     alignment and function description
>sp|Q16134|ETFD_HUMAN Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Homo sapiens GN=ETFDH PE=1 SV=2 Back     alignment and function description
>sp|P55931|ETFD_PIG Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Sus scrofa GN=ETFDH PE=1 SV=2 Back     alignment and function description
>sp|Q6UPE1|ETFD_RAT Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Rattus norvegicus GN=Etfdh PE=2 SV=1 Back     alignment and function description
>sp|Q5RDD3|ETFD_PONAB Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Pongo abelii GN=ETFDH PE=2 SV=1 Back     alignment and function description
>sp|Q11190|ETFD_CAEEL Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Caenorhabditis elegans GN=let-721 PE=1 SV=2 Back     alignment and function description
>sp|Q54XM6|ETFD_DICDI Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Dictyostelium discoideum GN=etfdh PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query561
300311111558 electron transfer flavoprotein-ubiquinon 0.987 0.992 0.625 0.0
399020473558 flavin-dependent dehydrogenase [Herbaspi 0.987 0.992 0.619 0.0
409405606542 electron transfer flavoprotein-ubiquinon 0.964 0.998 0.621 0.0
340786797563 electron transfer flavoprotein-ubiquinon 0.987 0.984 0.616 0.0
393776768556 electron transfer flavoprotein-ubiquinon 0.987 0.996 0.605 0.0
329907898560 Electron transfer flavoprotein-ubiquinon 0.966 0.967 0.604 0.0
445497649558 electron transfer flavoprotein-ubiquinon 0.983 0.989 0.598 0.0
152979873562 electron-transferring-flavoprotein dehyd 0.998 0.996 0.611 0.0
254180020581 electron transfer flavoprotein-ubiquinon 0.982 0.948 0.610 0.0
167894578557 electron transfer flavoprotein-ubiquinon 0.982 0.989 0.608 0.0
>gi|300311111|ref|YP_003775203.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Herbaspirillum seropedicae SmR1] gi|194373343|emb|CAM32535.2| electron transfer flavoprotein-ubiquinone oxidoreductase protein [Herbaspirillum seropedicae] gi|300073896|gb|ADJ63295.1| electron transfer flavoprotein-ubiquinone oxidoreductase protein [Herbaspirillum seropedicae SmR1] Back     alignment and taxonomy information
 Score =  780 bits (2013), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/555 (62%), Positives = 447/555 (80%), Gaps = 1/555 (0%)

Query: 8   NHSLINKYGPRESIEYDVIIVGGGPSGLSAAIRLKQLAIKKNKEIKICVLEKGSELGAHI 67
           +  LI +YGPRES+EYDV++VGGGP+GLSAAIRLKQLA ++N+E+ +CVLEKGSE+GAHI
Sbjct: 4   SQDLIAQYGPRESMEYDVVVVGGGPAGLSAAIRLKQLAAQQNREVSVCVLEKGSEVGAHI 63

Query: 68  LSGAIIDPRSIFELFPKEKLNKL-FNTPVIEERFLFLSSKKSYKIPSWILPICFKNHGNY 126
           LSGA++DPR++ EL P  K      NTPV E+RFLFLS+ K+YK P+W+LP CF+NHGNY
Sbjct: 64  LSGAVMDPRALSELIPDWKEQGAPLNTPVTEDRFLFLSASKAYKTPNWLLPTCFQNHGNY 123

Query: 127 IISLSDLVRWMGKKAENMGIDIFSGFSASEILYDSKNNVCGIATNNFGINKEGIIKKNFQ 186
           +ISLS++ RW+G++AE +G++IF GF A+E+LY    +V G+AT N GINKEG     FQ
Sbjct: 124 VISLSNVTRWLGQQAEALGVEIFPGFPAAEVLYHEDGSVKGVATGNMGINKEGEPGPEFQ 183

Query: 187 LGMELYAKYTLFAEGSRGHLSKQIIKKFNLDNKKDPQTYSLGIKELWTINPKLHKKGLVI 246
           LGMEL+AKYT FAEG+RGHL KQ+I K+ LD  +DPQTY++GIKELW + P++H+ GLV+
Sbjct: 184 LGMELHAKYTFFAEGARGHLGKQLISKYQLDAGRDPQTYAIGIKELWEVKPEVHQPGLVV 243

Query: 247 HTIGWPLDYKTYGGGFLYHMENNQISIGYIISLDYKNPYLSPFEEFQRYKTHPKICKILK 306
           HT GWPLD  TYGG FLYH+ENNQ+++GY++ L Y+NPYLSPFEEFQRYKTHP+I K  +
Sbjct: 244 HTAGWPLDNDTYGGSFLYHLENNQVAVGYVVGLAYENPYLSPFEEFQRYKTHPEIRKFFE 303

Query: 307 GGKRISYGARTITTGGLQSLPEFIFDGGAFIGCNAGFMNVSRIKGIHTSIKSGILVADSI 366
           GGKR+SYGAR IT GG+QSLP+ +F GGA +GC+AGF+N SRIKG H +IKSG+L AD+ 
Sbjct: 304 GGKRLSYGARAITAGGVQSLPKLVFPGGALLGCDAGFLNASRIKGSHAAIKSGMLAADAA 363

Query: 367 FKKICSNNKFNKLITYKTSFQASWLYKELYKARNFKPAMKKGLYIGMLIIGIDQILFSGK 426
           F  +  N + ++L  Y  +F+ASWL +EL+KARNFKP+M KGL  G L++GIDQ+LF GK
Sbjct: 364 FHALGENRQSDELSAYPAAFEASWLKEELHKARNFKPSMSKGLVTGTLLVGIDQVLFGGK 423

Query: 427 FPFTLHNINSDYTYLEPASKHIPIKYPNPDNKLTFDKLSSIYVSNINHDEDQPIHLILKN 486
            P+TL + ++D+  L+PAS + PI YP PD KLTFD+LSS+++SN NH EDQP HL LK+
Sbjct: 424 APWTLRHSHADHECLKPASNYAPIAYPKPDGKLTFDRLSSVFISNTNHGEDQPAHLTLKD 483

Query: 487 KKIPIHINFSIYAGPEARYCPAGVYEFIIEKNKIQHLQINAQNCIHCKTCDIKDPTQNIE 546
           K +P+ +N + YAGPE+RYCPAGVYEF+  ++    LQINAQNC+HCKTCDIKDPTQNI 
Sbjct: 484 KNVPVQVNLAKYAGPESRYCPAGVYEFVKNEDNTDRLQINAQNCVHCKTCDIKDPTQNIV 543

Query: 547 WITPEGGSGTNYPNM 561
           W+TPEGG G NY  M
Sbjct: 544 WVTPEGGGGPNYSGM 558

Source: Herbaspirillum seropedicae SmR1

Species: Herbaspirillum seropedicae

Genus: Herbaspirillum

Family: Oxalobacteraceae

Order: Burkholderiales

Class: Betaproteobacteria

Phylum: Proteobacteria

Superkingdom: Bacteria
>gi|399020473|ref|ZP_10722603.1| flavin-dependent dehydrogenase [Herbaspirillum sp. CF444] gi|398094888|gb|EJL85242.1| flavin-dependent dehydrogenase [Herbaspirillum sp. CF444] Back     alignment and taxonomy information
>gi|409405606|ref|ZP_11254068.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Herbaspirillum sp. GW103] gi|386434155|gb|EIJ46980.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Herbaspirillum sp. GW103] Back     alignment and taxonomy information
>gi|340786797|ref|YP_004752262.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Collimonas fungivorans Ter331] gi|340552064|gb|AEK61439.1| Electron transfer flavoprotein-ubiquinone oxidoreductase [Collimonas fungivorans Ter331] Back     alignment and taxonomy information
>gi|393776768|ref|ZP_10365062.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Ralstonia sp. PBA] gi|392716125|gb|EIZ03705.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Ralstonia sp. PBA] Back     alignment and taxonomy information
>gi|329907898|ref|ZP_08274724.1| Electron transfer flavoprotein-ubiquinone oxidoreductase [Oxalobacteraceae bacterium IMCC9480] gi|327546880|gb|EGF31798.1| Electron transfer flavoprotein-ubiquinone oxidoreductase [Oxalobacteraceae bacterium IMCC9480] Back     alignment and taxonomy information
>gi|445497649|ref|ZP_21464504.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Janthinobacterium sp. HH01] gi|444787644|gb|ELX09192.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Janthinobacterium sp. HH01] Back     alignment and taxonomy information
>gi|152979873|ref|YP_001353168.1| electron-transferring-flavoprotein dehydrogenase [Janthinobacterium sp. Marseille] gi|151279950|gb|ABR88360.1| electron-transferring-flavoprotein dehydrogenase [Janthinobacterium sp. Marseille] Back     alignment and taxonomy information
>gi|254180020|ref|ZP_04886619.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Burkholderia pseudomallei 1655] gi|184210560|gb|EDU07603.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Burkholderia pseudomallei 1655] Back     alignment and taxonomy information
>gi|167894578|ref|ZP_02481980.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Burkholderia pseudomallei 7894] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query561
UNIPROTKB|Q48K88551 PSPPH_1963 "Electron transfer 0.969 0.987 0.533 2.7e-162
UNIPROTKB|Q4KFP5554 PFL_1818 "Electron-transferrin 0.969 0.981 0.532 5.1e-161
TIGR_CMR|SO_4453549 SO_4453 "electron transfer fla 0.967 0.989 0.538 1.1e-160
UNIPROTKB|F6V7P2617 ETFDH "Uncharacterized protein 0.957 0.870 0.533 9.6e-160
UNIPROTKB|E2QTI8618 ETFDH "Uncharacterized protein 0.957 0.868 0.532 1.6e-159
UNIPROTKB|Q2KIG0617 ETFDH "Electron transfer flavo 0.957 0.870 0.526 1.8e-158
UNIPROTKB|F1RW89616 ETFDH "Electron transfer flavo 0.957 0.871 0.528 1.8e-158
UNIPROTKB|J3KND9570 ETFDH "Electron transfer flavo 0.957 0.942 0.526 7.7e-158
UNIPROTKB|Q16134617 ETFDH "Electron transfer flavo 0.957 0.870 0.526 7.7e-158
UNIPROTKB|P55931617 ETFDH "Electron transfer flavo 0.957 0.870 0.526 9.9e-158
UNIPROTKB|Q48K88 PSPPH_1963 "Electron transfer flavoprotein-ubiquinone oxidoreductase, putative" [Pseudomonas syringae pv. phaseolicola 1448A (taxid:264730)] Back     alignment and assigned GO terms
 Score = 1580 (561.2 bits), Expect = 2.7e-162, P = 2.7e-162
 Identities = 293/549 (53%), Positives = 395/549 (71%)

Query:    18 RESIEYDVIIVGGGPSGLSAAIRLKQLAIKKNKEIKICVLEKGSELGAHILSGAIIDPRS 77
             RE +E+DV+IVG GPSGLSAA RLKQ A +  +EI +CV+EKGSE+GAHILSGA+ +PR+
Sbjct:     3 REYMEFDVVIVGAGPSGLSAACRLKQKAAEAGQEISVCVVEKGSEVGAHILSGAVFEPRA 62

Query:    78 IFELFPK-EKLNKLFNTPVI-EERFLFLSSKKSYKIPSWILPICFKNHGNYIISLSDLVR 135
             + ELFP  ++L    NTPV  ++ ++   ++K+ KIP + +P    N GNYIISL +L R
Sbjct:    63 LNELFPNWQELGAPLNTPVKRDDIYVLRDAEKAQKIPDFFVPKTMHNQGNYIISLGNLCR 122

Query:   136 WMGKKAENMGIDIFSGFSASEILYDSKNNVCGIATNNFGINKEGIIKKN-FQLGMELYAK 194
             W+ ++AEN+G++I+ GF+A E L+D    V GI T + G+++EG  K+  +  GMEL AK
Sbjct:   123 WLAQQAENLGVEIYPGFAAQEALFDENGVVRGIVTGDLGVDREGNPKEGLYTPGMELRAK 182

Query:   195 YTLFAEGSRGHLSKQIIKKFNLDNKKDPQTYSLGIKELWTINPKLHKKGLVIHTIGWPLD 254
             YTLFAEG RGH+ KQ++K+FNLD++ D Q Y++G+KE+W ++P  H++GLV+HT GWPLD
Sbjct:   183 YTLFAEGCRGHIGKQLLKRFNLDDEADVQHYAIGLKEIWEVDPAKHEQGLVVHTAGWPLD 242

Query:   255 YKTYGGGFLYHMENNQISIGYIISLDYKNPYLSPFEEFQRYKTHPKICKILKGGKRISYG 314
                 GG FLYH+ENNQ+ +G I+ L Y NPYLSPF+EFQRYK HP I + L+GGKRISYG
Sbjct:   243 DANPGGSFLYHLENNQVVVGLIVDLSYSNPYLSPFDEFQRYKHHPVIKQYLEGGKRISYG 302

Query:   315 ARTITTGGLQSLPEFIFDGGAFIGCNAGFMNVSRIKGIHTSIKSGILVADSIFKKICSNN 374
             AR I  GGL SLP+ +F GGA IGC+ G +N ++IKG HT++KSG+L ADS+   + +  
Sbjct:   303 ARAIAKGGLNSLPKMVFPGGALIGCDLGTLNFAKIKGSHTAMKSGMLAADSVADALFAGK 362

Query:   375 KFNKLIT-YKTSFQASWLYKELYKARNFKPAMKK-GLYIGMLIIGIDQILFSGKFPFTLH 432
             +   ++T Y  +F+ASWL+ EL+ +RNF  A+ K G   G     IDQ +F GK PFTLH
Sbjct:   363 EGGDVLTSYVDAFKASWLHAELFASRNFGVAIHKYGAIKGGAFNFIDQNIFGGKLPFTLH 422

Query:   433 NINSDYTYLEPASKHIPIKYPNPDNKLTFDKLSSIYVSNINHDEDQPIHLILKNKKIPIH 492
             +   DY  L+ A+    I YP PD KL+FDKLSS+++S+ NH+E+QP HL L +  IPI 
Sbjct:   423 DTTPDYACLKLAADSKKIDYPKPDGKLSFDKLSSVFLSSTNHEEEQPCHLKLTDPSIPIS 482

Query:   493 INFSIYAGPEARYCPAGVYEFIIEKNKIQHLQINAQNCIHCKTCDIKDPTQNIEWITPEG 552
              N  +Y  P  RYCPAGVYE I +++  +  QINAQNC+HCKTCDIKDP+QNI W+ PEG
Sbjct:   483 KNLPLYDEPAQRYCPAGVYEVITKEDGEKRFQINAQNCVHCKTCDIKDPSQNITWVAPEG 542

Query:   553 GSGTNYPNM 561
               G  YPNM
Sbjct:   543 AGGPTYPNM 551
GO:0004174 "electron-transferring-flavoprotein dehydrogenase activity" evidence=ISS
GO:0055114 "oxidation-reduction process" evidence=ISS
UNIPROTKB|Q4KFP5 PFL_1818 "Electron-transferring-flavoprotein dehydrogenase" [Pseudomonas protegens Pf-5 (taxid:220664)] Back     alignment and assigned GO terms
TIGR_CMR|SO_4453 SO_4453 "electron transfer flavoprotein-ubiquinone oxidoreductase, putative" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
UNIPROTKB|F6V7P2 ETFDH "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E2QTI8 ETFDH "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q2KIG0 ETFDH "Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1RW89 ETFDH "Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|J3KND9 ETFDH "Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q16134 ETFDH "Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P55931 ETFDH "Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q16134ETFD_HUMAN1, ., 5, ., 5, ., 10.52420.96430.8768yesN/A
P94132ETFD_ACIAD1, ., 5, ., 5, ., 10.52380.96610.9508yesN/A
Q6UPE1ETFD_RAT1, ., 5, ., 5, ., 10.52420.96430.8782yesN/A
Q08822ETFD_YEAST1, ., 5, ., 5, ., 10.43870.98030.8716yesN/A
Q11190ETFD_CAEEL1, ., 5, ., 5, ., 10.49820.96250.9045yesN/A
Q9HZP5ETFD_PSEAE1, ., 5, ., 5, ., 10.53730.96960.9872yesN/A
Q54XM6ETFD_DICDI1, ., 5, ., 5, ., 10.46600.96430.8927yesN/A
Q2KIG0ETFD_BOVIN1, ., 5, ., 5, ., 10.52420.96430.8768yesN/A
Q5RDD3ETFD_PONAB1, ., 5, ., 5, ., 10.52450.95360.8670yesN/A
P87111ETFD_SCHPO1, ., 5, ., 5, ., 10.45430.95720.8496yesN/A
Q921G7ETFD_MOUSE1, ., 5, ., 5, ., 10.52600.96430.8782yesN/A
P55931ETFD_PIG1, ., 5, ., 5, ., 10.52420.96430.8768yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.5.50.963
4th Layer1.5.5.10.946

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query561
COG0644396 COG0644, FixC, Dehydrogenases (flavoproteins) [Ene 4e-84
pfam05187110 pfam05187, ETF_QO, Electron transfer flavoprotein- 2e-53
PRK10015429 PRK10015, PRK10015, oxidoreductase; Provisional 5e-20
PRK10157428 PRK10157, PRK10157, putative oxidoreductase FixC; 1e-17
COG2072443 COG2072, TrkA, Predicted flavoprotein involved in 4e-08
TIGR02032295 TIGR02032, GG-red-SF, geranylgeranyl reductase fam 7e-08
COG244099 COG2440, FixX, Ferredoxin-like protein [Energy pro 1e-07
COG0654387 COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydrox 2e-07
COG1635262 COG1635, THI4, Ribulose 1,5-bisphosphate synthetas 2e-07
TIGR00292254 TIGR00292, TIGR00292, thiazole biosynthesis enzyme 9e-07
COG1232444 COG1232, HemY, Protoporphyrinogen oxidase [Coenzym 1e-06
PRK04176257 PRK04176, PRK04176, ribulose-1,5-biphosphate synth 6e-06
COG1249454 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenas 1e-05
pfam01494349 pfam01494, FAD_binding_3, FAD binding domain 1e-05
COG1053562 COG1053, SdhA, Succinate dehydrogenase/fumarate re 1e-05
pfam00890401 pfam00890, FAD_binding_2, FAD binding domain 3e-05
pfam1345066 pfam13450, NAD_binding_8, NAD(P)-binding Rossmann- 3e-05
COG1233487 COG1233, COG1233, Phytoene dehydrogenase and relat 4e-05
COG0492305 COG0492, TrxB, Thioredoxin reductase [Posttranslat 6e-05
pfam1283848 pfam12838, Fer4_7, 4Fe-4S dicluster domain 8e-05
pfam01946229 pfam01946, Thi4, Thi4 family 1e-04
TIGR01988387 TIGR01988, Ubi-OHases, Ubiquinone biosynthesis hyd 1e-04
COG2081408 COG2081, COG2081, Predicted flavoproteins [General 1e-04
PRK06292460 PRK06292, PRK06292, dihydrolipoamide dehydrogenase 1e-04
PRK11728393 PRK11728, PRK11728, hydroxyglutarate oxidase; Prov 2e-04
PRK08275554 PRK08275, PRK08275, putative oxidoreductase; Provi 2e-04
COG0665387 COG0665, DadA, Glycine/D-amino acid oxidases (deam 2e-04
PRK06467471 PRK06467, PRK06467, dihydrolipoamide dehydrogenase 3e-04
pfam03486405 pfam03486, HI0933_like, HI0933-like protein 3e-04
PRK08244493 PRK08244, PRK08244, hypothetical protein; Provisio 3e-04
PRK05976472 PRK05976, PRK05976, dihydrolipoamide dehydrogenase 3e-04
PRK06115466 PRK06115, PRK06115, dihydrolipoamide dehydrogenase 5e-04
PRK09126392 PRK09126, PRK09126, hypothetical protein; Provisio 6e-04
TIGR00275400 TIGR00275, TIGR00275, flavoprotein, HI0933 family 7e-04
PRK06416462 PRK06416, PRK06416, dihydrolipoamide dehydrogenase 8e-04
PRK05329422 PRK05329, PRK05329, anaerobic glycerol-3-phosphate 8e-04
pfam01266234 pfam01266, DAO, FAD dependent oxidoreductase 9e-04
PRK11883451 PRK11883, PRK11883, protoporphyrinogen oxidase; Re 0.001
pfam13454153 pfam13454, NAD_binding_9, FAD-NAD(P)-binding 0.001
pfam07992283 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulp 0.001
TIGR01350460 TIGR01350, lipoamide_DH, dihydrolipoamide dehydrog 0.002
PRK06069577 PRK06069, sdhA, succinate dehydrogenase flavoprote 0.003
COG2303542 COG2303, BetA, Choline dehydrogenase and related f 0.003
TIGR01984382 TIGR01984, UbiH, 2-polyprenyl-6-methoxyphenol 4-hy 0.003
PRK05249461 PRK05249, PRK05249, soluble pyridine nucleotide tr 0.004
PRK07608388 PRK07608, PRK07608, ubiquinone biosynthesis hydrox 0.004
pfam05834374 pfam05834, Lycopene_cycl, Lycopene cyclase protein 0.004
>gnl|CDD|223717 COG0644, FixC, Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information 
 Score =  267 bits (683), Expect = 4e-84
 Identities = 120/456 (26%), Positives = 193/456 (42%), Gaps = 61/456 (13%)

Query: 20  SIEYDVIIVGGGPSGLSAAIRLKQLAIKKNKEIKICVLEKGSELGAHILSGAIIDPRSIF 79
            +EYDV+IVG GP+G SAA RL +        + + VLEKGSE GA    G  + PR++ 
Sbjct: 1   MMEYDVVIVGAGPAGSSAARRLAKAG------LDVLVLEKGSEPGAKPCCGGGLSPRALE 54

Query: 80  ELFPKEKLNKLFNTPVIEERFLFLSSKKSYKIPSWILPICFKNHGNYIISLSDLVRWMGK 139
           EL P     +     V   R  F   K + ++P             YI+  +   +W+ +
Sbjct: 55  ELIPDFD--EEIERKVTGARIYFPGEKVAIEVP---------VGEGYIVDRAKFDKWLAE 103

Query: 140 KAENMGIDIFSGFSASEILYDSKNNVCGIATNNFGINKEGIIKKNFQLGMELYAKYTLFA 199
           +AE  G +++ G   + ++ +    V G+                     E+ AK  + A
Sbjct: 104 RAEEAGAELYPGTRVTGVIREDDGVVVGVRAG----------------DDEVRAKVVIDA 147

Query: 200 EGSRGHLSKQIIKKFNLDNKKDPQTYSLGIKELWTINPKLHKKGLVIHTIGWPLDYKTYG 259
           +G    L++++  K      + P+ Y++G+KE+      +   G V   +  PLD    G
Sbjct: 148 DGVNSALARKLGLK-----DRKPEDYAIGVKEVIE----VPDDGDVEEFLYGPLDVGPGG 198

Query: 260 GGFLYHMENNQISIGYIISLDYKNPYLSPFEEFQRYKTHPKICKILKGGKRISYGARTIT 319
            G+++ + +   ++G  + LD  +      E  +R+K HP I K+L GGK + Y A  I 
Sbjct: 199 YGWIFPLGDGHANVGIGVLLDDPSLSPFL-ELLERFKEHPAIRKLLLGGKILEYAAGGIP 257

Query: 320 TGGLQSLPEFIFDGGAFIGCNAGFMNVSRIKGIHTSIKSGILVADSIFKKICSNNKFNKL 379
            GG  S P  + DG   +G  AGF+N    +GI  +IKSG L A++I + +        L
Sbjct: 258 EGGPASRP-LVGDGVLLVGDAAGFVNPLTGEGIRYAIKSGKLAAEAIAEALEGGE--EAL 314

Query: 380 ITYKTSFQASWLYKELYKARNFKPAMKKGLYIGMLIIGIDQILFSGKFPFTLHNINSDYT 439
             Y+   + S   ++L   R  K  ++  L    L   I  +             + D  
Sbjct: 315 AEYERLLRKSLAREDLKSLRLLKLLLR--LLDRTLPALIKLLA------------DKDLL 360

Query: 440 YLEPASKHIPIKYPNPDNKLT-FDKLSSIYVSNINH 474
            L        I YP     L  FD L S+  S    
Sbjct: 361 GLIKKYLRKLILYPLLKGVLARFDLLKSVKRSLTAL 396

Length = 396
>gnl|CDD|218485 pfam05187, ETF_QO, Electron transfer flavoprotein-ubiquinone oxidoreductase Back     alignment and domain information
>gnl|CDD|182194 PRK10015, PRK10015, oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|182273 PRK10157, PRK10157, putative oxidoreductase FixC; Provisional Back     alignment and domain information
>gnl|CDD|224983 COG2072, TrkA, Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|233693 TIGR02032, GG-red-SF, geranylgeranyl reductase family Back     alignment and domain information
>gnl|CDD|225289 COG2440, FixX, Ferredoxin-like protein [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|223727 COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>gnl|CDD|224550 COG1635, THI4, Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|232908 TIGR00292, TIGR00292, thiazole biosynthesis enzyme Back     alignment and domain information
>gnl|CDD|224153 COG1232, HemY, Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|235241 PRK04176, PRK04176, ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|224169 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|216530 pfam01494, FAD_binding_3, FAD binding domain Back     alignment and domain information
>gnl|CDD|223981 COG1053, SdhA, Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|216176 pfam00890, FAD_binding_2, FAD binding domain Back     alignment and domain information
>gnl|CDD|205628 pfam13450, NAD_binding_8, NAD(P)-binding Rossmann-like domain Back     alignment and domain information
>gnl|CDD|224154 COG1233, COG1233, Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|223566 COG0492, TrxB, Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|221801 pfam12838, Fer4_7, 4Fe-4S dicluster domain Back     alignment and domain information
>gnl|CDD|145231 pfam01946, Thi4, Thi4 family Back     alignment and domain information
>gnl|CDD|233671 TIGR01988, Ubi-OHases, Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>gnl|CDD|224992 COG2081, COG2081, Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>gnl|CDD|235774 PRK06292, PRK06292, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|183292 PRK11728, PRK11728, hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>gnl|CDD|181346 PRK08275, PRK08275, putative oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|223737 COG0665, DadA, Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|180579 PRK06467, PRK06467, dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|217590 pfam03486, HI0933_like, HI0933-like protein Back     alignment and domain information
>gnl|CDD|236199 PRK08244, PRK08244, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|235660 PRK05976, PRK05976, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|180409 PRK06115, PRK06115, dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|236385 PRK09126, PRK09126, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|232901 TIGR00275, TIGR00275, flavoprotein, HI0933 family Back     alignment and domain information
>gnl|CDD|235798 PRK06416, PRK06416, dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|235412 PRK05329, PRK05329, anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>gnl|CDD|216400 pfam01266, DAO, FAD dependent oxidoreductase Back     alignment and domain information
>gnl|CDD|237009 PRK11883, PRK11883, protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>gnl|CDD|222141 pfam13454, NAD_binding_9, FAD-NAD(P)-binding Back     alignment and domain information
>gnl|CDD|219686 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulphide oxidoreductase Back     alignment and domain information
>gnl|CDD|233368 TIGR01350, lipoamide_DH, dihydrolipoamide dehydrogenase Back     alignment and domain information
>gnl|CDD|235689 PRK06069, sdhA, succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>gnl|CDD|225186 COG2303, BetA, Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|233669 TIGR01984, UbiH, 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>gnl|CDD|235373 PRK05249, PRK05249, soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181057 PRK07608, PRK07608, ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>gnl|CDD|218770 pfam05834, Lycopene_cycl, Lycopene cyclase protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 561
KOG2415|consensus621 100.0
PRK10015429 oxidoreductase; Provisional 100.0
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy produc 100.0
PRK10157428 putative oxidoreductase FixC; Provisional 100.0
PLN00093450 geranylgeranyl diphosphate reductase; Provisional 100.0
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 99.98
PRK07045388 putative monooxygenase; Reviewed 99.98
PRK08013400 oxidoreductase; Provisional 99.97
TIGR02023388 BchP-ChlP geranylgeranyl reductase. This model rep 99.97
TIGR02028398 ChlP geranylgeranyl reductase. This model represen 99.97
PRK08244493 hypothetical protein; Provisional 99.97
PRK06183538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 99.97
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 99.97
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 99.97
PRK06185407 hypothetical protein; Provisional 99.97
PF01494356 FAD_binding_3: FAD binding domain; InterPro: IPR00 99.97
PF05187110 ETF_QO: Electron transfer flavoprotein-ubiquinone 99.97
PRK07538413 hypothetical protein; Provisional 99.97
PRK07364415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 99.97
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 99.97
PRK08163396 salicylate hydroxylase; Provisional 99.97
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 99.97
PRK05868372 hypothetical protein; Validated 99.97
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 99.97
TIGR01988385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 99.97
PRK06753373 hypothetical protein; Provisional 99.97
PRK08294634 phenol 2-monooxygenase; Provisional 99.97
PRK08132547 FAD-dependent oxidoreductase; Provisional 99.97
PRK09126392 hypothetical protein; Provisional 99.97
PRK06184502 hypothetical protein; Provisional 99.97
TIGR01984382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 99.97
TIGR01989437 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T 99.97
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 99.96
PRK07588391 hypothetical protein; Provisional 99.96
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 99.96
PRK07190487 hypothetical protein; Provisional 99.96
PRK06475400 salicylate hydroxylase; Provisional 99.96
PRK06834488 hypothetical protein; Provisional 99.96
PRK06996398 hypothetical protein; Provisional 99.96
PRK06126545 hypothetical protein; Provisional 99.96
PRK07608388 ubiquinone biosynthesis hydroxylase family protein 99.96
TIGR02360390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 99.96
PRK07494388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 99.96
PTZ00367567 squalene epoxidase; Provisional 99.96
PRK06847375 hypothetical protein; Provisional 99.96
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Member 99.96
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 99.96
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 99.96
PLN02985514 squalene monooxygenase 99.95
PRK07236386 hypothetical protein; Provisional 99.95
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 99.95
PLN02927668 antheraxanthin epoxidase/zeaxanthin epoxidase 99.95
PRK11445351 putative oxidoreductase; Provisional 99.93
KOG2614|consensus420 99.92
PLN02697529 lycopene epsilon cyclase 99.91
TIGR01790388 carotene-cycl lycopene cyclase family protein. Thi 99.91
COG244099 FixX Ferredoxin-like protein [Energy production an 99.91
PRK08255 765 salicylyl-CoA 5-hydroxylase; Reviewed 99.91
PLN02463447 lycopene beta cyclase 99.9
PF04820454 Trp_halogenase: Tryptophan halogenase; InterPro: I 99.89
KOG1298|consensus509 99.84
PRK1544995 ferredoxin-like protein FixX; Provisional 99.83
TIGR01789370 lycopene_cycl lycopene cyclase. This model represe 99.81
PF05834374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 99.79
KOG3855|consensus481 99.76
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 99.73
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 99.71
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 99.69
PF01946230 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. 99.69
PRK12771564 putative glutamate synthase (NADPH) small subunit; 99.68
PRK098531019 putative selenate reductase subunit YgfK; Provisio 99.67
TIGR033151012 Se_ygfK putative selenate reductase, YgfK subunit. 99.63
COG2081408 Predicted flavoproteins [General function predicti 99.56
PRK00711416 D-amino acid dehydrogenase small subunit; Validate 99.49
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 99.49
TIGR01373407 soxB sarcosine oxidase, beta subunit family, heter 99.46
COG1148622 HdrA Heterodisulfide reductase, subunit A and rela 99.42
PRK12409410 D-amino acid dehydrogenase small subunit; Provisio 99.41
PF03486409 HI0933_like: HI0933-like protein; InterPro: IPR004 99.4
TIGR03329460 Phn_aa_oxid putative aminophosphonate oxidoreducta 99.4
TIGR01377380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 99.39
PRK01747662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 99.39
PRK11259376 solA N-methyltryptophan oxidase; Provisional 99.38
PLN02661357 Putative thiazole synthesis 99.34
PRK12814652 putative NADPH-dependent glutamate synthase small 99.33
PRK11101546 glpA sn-glycerol-3-phosphate dehydrogenase subunit 99.32
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [ 99.31
COG0579429 Predicted dehydrogenase [General function predicti 99.31
PRK11728393 hydroxyglutarate oxidase; Provisional 99.3
PF12831428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 99.25
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR033 99.24
PRK05192 618 tRNA uridine 5-carboxymethylaminomethyl modificati 99.24
PRK12266508 glpD glycerol-3-phosphate dehydrogenase; Reviewed 99.23
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 99.22
PLN02464627 glycerol-3-phosphate dehydrogenase 99.2
PRK13369502 glycerol-3-phosphate dehydrogenase; Provisional 99.2
PRK07804541 L-aspartate oxidase; Provisional 99.19
COG0578532 GlpA Glycerol-3-phosphate dehydrogenase [Energy pr 99.19
PRK07121492 hypothetical protein; Validated 99.18
PTZ00383497 malate:quinone oxidoreductase; Provisional 99.18
TIGR01813439 flavo_cyto_c flavocytochrome c. This model describ 99.18
PF01134392 GIDA: Glucose inhibited division protein A; InterP 99.17
PF08491276 SE: Squalene epoxidase; InterPro: IPR013698 This d 99.17
PRK06481506 fumarate reductase flavoprotein subunit; Validated 99.16
TIGR01320483 mal_quin_oxido malate:quinone-oxidoreductase. This 99.15
PRK07573640 sdhA succinate dehydrogenase flavoprotein subunit; 99.15
PRK06452566 sdhA succinate dehydrogenase flavoprotein subunit; 99.14
PRK08274466 tricarballylate dehydrogenase; Validated 99.14
PLN00128635 Succinate dehydrogenase [ubiquinone] flavoprotein 99.13
PTZ00139617 Succinate dehydrogenase [ubiquinone] flavoprotein 99.13
PRK08275554 putative oxidoreductase; Provisional 99.12
PRK08958588 sdhA succinate dehydrogenase flavoprotein subunit; 99.12
PRK07057591 sdhA succinate dehydrogenase flavoprotein subunit; 99.11
PLN02172461 flavin-containing monooxygenase FMO GS-OX 99.1
PF1469759 Fer4_21: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE 99.1
PRK09078598 sdhA succinate dehydrogenase flavoprotein subunit; 99.09
PRK05257494 malate:quinone oxidoreductase; Validated 99.09
PF00890417 FAD_binding_2: FAD binding domain of the Pfam fami 99.08
PRK06263543 sdhA succinate dehydrogenase flavoprotein subunit; 99.07
TIGR02730493 carot_isom carotene isomerase. Members of this fam 99.07
PRK06069577 sdhA succinate dehydrogenase flavoprotein subunit; 99.07
PRK09231582 fumarate reductase flavoprotein subunit; Validated 99.06
PRK12839572 hypothetical protein; Provisional 99.06
KOG2820|consensus399 99.06
TIGR01176580 fum_red_Fp fumarate reductase, flavoprotein subuni 99.05
PRK06854608 adenylylsulfate reductase subunit alpha; Validated 99.05
PRK05945575 sdhA succinate dehydrogenase flavoprotein subunit; 99.05
PRK12845564 3-ketosteroid-delta-1-dehydrogenase; Reviewed 99.05
PRK13339497 malate:quinone oxidoreductase; Reviewed 99.04
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 99.04
KOG1399|consensus448 99.04
COG2509486 Uncharacterized FAD-dependent dehydrogenases [Gene 99.04
COG114491 Pyruvate:ferredoxin oxidoreductase and related 2-o 99.04
PRK07803626 sdhA succinate dehydrogenase flavoprotein subunit; 99.03
PRK08641589 sdhA succinate dehydrogenase flavoprotein subunit; 99.03
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 99.03
PRK06175433 L-aspartate oxidase; Provisional 99.03
TIGR00136 617 gidA glucose-inhibited division protein A. GidA, t 99.03
PRK08401466 L-aspartate oxidase; Provisional 99.02
PF00743531 FMO-like: Flavin-binding monooxygenase-like; Inter 99.02
TIGR01812566 sdhA_frdA_Gneg succinate dehydrogenase or fumarate 99.02
PRK12834549 putative FAD-binding dehydrogenase; Reviewed 99.02
PRK12835584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 99.01
TIGR00275400 flavoprotein, HI0933 family. The model when search 99.01
PLN02815594 L-aspartate oxidase 99.0
TIGR00551488 nadB L-aspartate oxidase. L-aspartate oxidase is t 99.0
TIGR02734502 crtI_fam phytoene desaturase. Phytoene is converte 99.0
COG2072443 TrkA Predicted flavoprotein involved in K+ transpo 98.99
PRK12837513 3-ketosteroid-delta-1-dehydrogenase; Provisional 98.99
PRK06134581 putative FAD-binding dehydrogenase; Reviewed 98.98
PLN02612567 phytoene desaturase 98.97
PRK12842574 putative succinate dehydrogenase; Reviewed 98.97
PRK07233434 hypothetical protein; Provisional 98.96
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 98.96
PRK12843578 putative FAD-binding dehydrogenase; Reviewed 98.95
PRK08626657 fumarate reductase flavoprotein subunit; Provision 98.94
PRK08205583 sdhA succinate dehydrogenase flavoprotein subunit; 98.94
COG1143172 NuoI Formate hydrogenlyase subunit 6/NADH:ubiquino 98.93
PRK13977576 myosin-cross-reactive antigen; Provisional 98.92
PRK12844557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 98.91
COG1142165 HycB Fe-S-cluster-containing hydrogenase component 98.91
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 98.9
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 98.9
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 98.9
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductas 98.89
PF06039488 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro 98.89
KOG2844|consensus 856 98.88
PRK07395553 L-aspartate oxidase; Provisional 98.87
PRK12779 944 putative bifunctional glutamate synthase subunit b 98.87
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 98.86
TIGR01811603 sdhA_Bsu succinate dehydrogenase or fumarate reduc 98.86
TIGR02731453 phytoene_desat phytoene desaturase. Plants and cya 98.85
PRK09077536 L-aspartate oxidase; Provisional 98.84
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 98.84
PTZ00306 1167 NADH-dependent fumarate reductase; Provisional 98.84
TIGR02061614 aprA adenosine phosphosulphate reductase, alpha su 98.84
TIGR00562462 proto_IX_ox protoporphyrinogen oxidase. This prote 98.83
PRK12416463 protoporphyrinogen oxidase; Provisional 98.83
PRK08071510 L-aspartate oxidase; Provisional 98.83
KOG2853|consensus509 98.83
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 98.83
COG114668 Ferredoxin [Energy production and conversion] 98.83
PRK14727479 putative mercuric reductase; Provisional 98.82
PRK07843557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 98.82
PRK05976472 dihydrolipoamide dehydrogenase; Validated 98.81
TIGR02732474 zeta_caro_desat carotene 7,8-desaturase. Carotene 98.78
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [Genera 98.78
PF1324798 Fer4_11: 4Fe-4S dicluster domain; PDB: 2VPY_F 2VPX 98.77
PRK06370463 mercuric reductase; Validated 98.77
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 98.77
KOG2852|consensus380 98.76
TIGR02485432 CobZ_N-term precorrin 3B synthase CobZ. CobZ is es 98.76
PTZ00058561 glutathione reductase; Provisional 98.76
PRK06116450 glutathione reductase; Validated 98.76
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 98.74
PRK07512513 L-aspartate oxidase; Provisional 98.74
PRK14694468 putative mercuric reductase; Provisional 98.74
PRK05335436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 98.74
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 98.73
PRK12831464 putative oxidoreductase; Provisional 98.73
PRK10262321 thioredoxin reductase; Provisional 98.72
PRK06327475 dihydrolipoamide dehydrogenase; Validated 98.71
PF13454156 NAD_binding_9: FAD-NAD(P)-binding 98.71
PRK09897534 hypothetical protein; Provisional 98.7
PLN02507499 glutathione reductase 98.7
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 98.68
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 98.63
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 98.63
PRK13800 897 putative oxidoreductase/HEAT repeat-containing pro 98.63
COG1232444 HemY Protoporphyrinogen oxidase [Coenzyme metaboli 98.63
COG1053562 SdhA Succinate dehydrogenase/fumarate reductase, f 98.62
PRK127751006 putative trifunctional 2-polyprenylphenol hydroxyl 98.61
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 98.6
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 98.6
PRK13748561 putative mercuric reductase; Provisional 98.6
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 98.59
KOG2404|consensus477 98.58
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 98.58
PLN02546558 glutathione reductase 98.58
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 98.57
PRK06292460 dihydrolipoamide dehydrogenase; Validated 98.57
TIGR02053463 MerA mercuric reductase. This model represents the 98.57
KOG3923|consensus342 98.56
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 98.56
PLN02852491 ferredoxin-NADP+ reductase 98.56
CHL0006581 psaC photosystem I subunit VII 98.56
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 98.56
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 98.54
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 98.53
KOG3256|consensus212 98.53
TIGR0293691 fdxN_nitrog ferredoxin III, nif-specific. Members 98.53
PRK08348120 NADH-plastoquinone oxidoreductase subunit; Provisi 98.52
KOG2960|consensus328 98.52
TIGR00137433 gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo 98.52
PTZ00052499 thioredoxin reductase; Provisional 98.48
PF1318755 Fer4_9: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_ 98.48
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 98.47
COG0493457 GltD NADPH-dependent glutamate synthase beta chain 98.47
PRK09624105 porD pyuvate ferredoxin oxidoreductase subunit del 98.46
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 98.46
COG0437203 HybA Fe-S-cluster-containing hydrogenase component 98.46
KOG2665|consensus453 98.44
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 98.44
TIGR02060132 aprB adenosine phosphosulphate reductase, beta sub 98.44
PLN0007181 photosystem I subunit VII; Provisional 98.43
PRK09564444 coenzyme A disulfide reductase; Reviewed 98.43
TIGR03378419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase 98.43
TIGR0217978 PorD_KorD 2-oxoacid:acceptor oxidoreductase, delta 98.42
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 98.42
PRK09625133 porD pyruvate flavodoxin oxidoreductase subunit de 98.42
PTZ00363443 rab-GDP dissociation inhibitor; Provisional 98.42
COG0445 621 GidA Flavin-dependent tRNA uridine 5-carboxymethyl 98.41
PRK09626103 oorD 2-oxoglutarate-acceptor oxidoreductase subuni 98.41
KOG0029|consensus501 98.4
PF1283852 Fer4_7: 4Fe-4S dicluster domain; InterPro: IPR0014 98.38
TIGR01317485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 98.38
KOG1335|consensus506 98.38
TIGR0304880 PS_I_psaC photosystem I iron-sulfur protein PsaC. 98.38
TIGR01660 492 narH nitrate reductase, beta subunit. The Nitrate 98.38
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 98.37
PRK09623105 vorD 2-ketoisovalerate ferredoxin oxidoreductase s 98.37
KOG0042|consensus680 98.37
PF1323752 Fer4_10: 4Fe-4S dicluster domain; PDB: 2FGO_A. 98.37
PRK07845466 flavoprotein disulfide reductase; Reviewed 98.37
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 98.37
COG1233487 Phytoene dehydrogenase and related proteins [Secon 98.36
PRK08222181 hydrogenase 4 subunit H; Validated 98.35
TIGR01944165 rnfB electron transport complex, RnfABCDGE type, B 98.34
TIGR02462544 pyranose_ox pyranose oxidase. Pyranose oxidase (al 98.34
TIGR03478 321 DMSO_red_II_bet DMSO reductase family type II enzy 98.34
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 98.33
COG1231450 Monoamine oxidase [Amino acid transport and metabo 98.33
TIGR03197381 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouri 98.32
COG0029518 NadB Aspartate oxidase [Coenzyme metabolism] 98.32
TIGR01582 283 FDH-beta formate dehydrogenase, beta subunit, Fe-S 98.32
PRK0265181 photosystem I subunit VII; Provisional 98.31
PRK12387180 formate hydrogenlyase complex iron-sulfur subunit; 98.31
COG1245 591 Predicted ATPase, RNase L inhibitor (RLI) homolog 98.31
PRK12770352 putative glutamate synthase subunit beta; Provisio 98.3
PRK13512438 coenzyme A disulfide reductase; Provisional 98.3
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 98.3
TIGR02352337 thiamin_ThiO glycine oxidase ThiO. This family con 98.29
PRK06273165 ferredoxin; Provisional 98.28
PRK07208479 hypothetical protein; Provisional 98.28
PF0003724 Fer4: 4Fe-4S binding domain; InterPro: IPR001450 T 98.28
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 98.27
PTZ00318424 NADH dehydrogenase-like protein; Provisional 98.26
PRK05888164 NADH dehydrogenase subunit I; Provisional 98.26
COG1149 284 MinD superfamily P-loop ATPase containing an inser 98.25
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit 98.25
PRK13984604 putative oxidoreductase; Provisional 98.25
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 98.24
TIGR00403183 ndhI NADH-plastoquinone oxidoreductase subunit I p 98.24
PTZ00153659 lipoamide dehydrogenase; Provisional 98.23
PTZ00188506 adrenodoxin reductase; Provisional 98.23
COG3573552 Predicted oxidoreductase [General function predict 98.23
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 98.23
COG4529474 Uncharacterized protein conserved in bacteria [Fun 98.21
PRK06991 270 ferredoxin; Provisional 98.21
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 98.21
PRK05113191 electron transport complex protein RnfB; Provision 98.2
PRK10194163 ferredoxin-type protein; Provisional 98.19
PRK11883451 protoporphyrinogen oxidase; Reviewed 98.19
COG3349485 Uncharacterized conserved protein [Function unknow 98.18
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 98.17
COG114599 NapF Ferredoxin [Energy production and conversion] 98.17
PRK07846451 mycothione reductase; Reviewed 98.16
PLN02268435 probable polyamine oxidase 98.16
KOG0404|consensus322 98.16
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 98.15
TIGR03149225 cyt_nit_nrfC cytochrome c nitrite reductase, Fe-S 98.14
TIGR01971122 NuoI NADH-quinone oxidoreductase, chain I. This mo 98.13
PF1283724 Fer4_6: 4Fe-4S binding domain; InterPro: IPR001450 98.12
TIGR02066341 dsrB sulfite reductase, dissimilatory-type beta su 98.11
TIGR02494 295 PFLE_PFLC glycyl-radical enzyme activating protein 98.11
PLN02568539 polyamine oxidase 98.1
PRK05976472 dihydrolipoamide dehydrogenase; Validated 98.09
PRK14993244 tetrathionate reductase subunit B; Provisional 98.09
PRK14989 847 nitrite reductase subunit NirD; Provisional 98.08
PRK08764135 ferredoxin; Provisional 98.07
PRK14989 847 nitrite reductase subunit NirD; Provisional 98.07
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 98.07
TIGR00031377 UDP-GALP_mutase UDP-galactopyranose mutase. The ge 98.07
TIGR02733492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 98.06
PTZ00318424 NADH dehydrogenase-like protein; Provisional 98.06
TIGR00402101 napF ferredoxin-type protein NapF. The gene codes 98.04
TIGR02163255 napH_ ferredoxin-type protein, NapH/MauN family. M 98.04
PRK06370463 mercuric reductase; Validated 98.02
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 98.02
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 98.01
PRK13409 590 putative ATPase RIL; Provisional 98.01
PF1279722 Fer4_2: 4Fe-4S binding domain; InterPro: IPR001450 98.01
TIGR02053463 MerA mercuric reductase. This model represents the 98.01
PRK09564444 coenzyme A disulfide reductase; Reviewed 98.0
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 98.0
PLN02576496 protoporphyrinogen oxidase 97.99
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 97.99
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 97.99
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 97.99
PRK06116450 glutathione reductase; Validated 97.98
PRK09898208 hypothetical protein; Provisional 97.97
PRK09476254 napG quinol dehydrogenase periplasmic component; P 97.96
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of 97.96
CHL00014167 ndhI NADH dehydrogenase subunit I 97.96
COG2768354 Uncharacterized Fe-S center protein [General funct 97.96
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 97.95
PRK09477271 napH quinol dehydrogenase membrane component; Prov 97.95
PRK10882 328 hydrogenase 2 protein HybA; Provisional 97.94
TIGR03224 411 benzo_boxA benzoyl-CoA oxygenase/reductase, BoxA p 97.93
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 97.92
TIGR03377516 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase 97.92
PRK10330181 formate dehydrogenase-H ferredoxin subunit; Provis 97.91
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 97.91
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 97.91
TIGR02951161 DMSO_dmsB DMSO reductase, iron-sulfur subunit. Thi 97.9
PRK07118280 ferredoxin; Validated 97.89
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 97.89
TIGR02700234 flavo_MJ0208 archaeoflavoprotein, MJ0208 family. T 97.88
TIGR00397213 mauM_napG MauM/NapG family ferredoxin-type protein 97.88
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 97.87
PRK14028312 pyruvate ferredoxin oxidoreductase subunit gamma/d 97.87
KOG0399|consensus2142 97.85
PLN02785587 Protein HOTHEAD 97.85
PRK07845466 flavoprotein disulfide reductase; Reviewed 97.85
COG0562374 Glf UDP-galactopyranose mutase [Cell envelope biog 97.84
KOG1276|consensus491 97.84
KOG2311|consensus 679 97.83
PLN02507499 glutathione reductase 97.83
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 97.82
COG3075421 GlpB Anaerobic glycerol-3-phosphate dehydrogenase 97.82
TIGR03287391 methan_mark_16 putative methanogenesis marker 16 m 97.81
COG3486436 IucD Lysine/ornithine N-monooxygenase [Secondary m 97.81
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 97.8
PTZ00058561 glutathione reductase; Provisional 97.8
PRK13512438 coenzyme A disulfide reductase; Provisional 97.79
PLN02676487 polyamine oxidase 97.79
PRK06327475 dihydrolipoamide dehydrogenase; Validated 97.79
PTZ00153659 lipoamide dehydrogenase; Provisional 97.78
PLN02529738 lysine-specific histone demethylase 1 97.78
KOG4254|consensus561 97.77
TIGR02912314 sulfite_red_C sulfite reductase, subunit C. Member 97.77
KOG1336|consensus478 97.77
PRK08318420 dihydropyrimidine dehydrogenase subunit B; Validat 97.76
PLN02328808 lysine-specific histone demethylase 1 homolog 97.75
TIGR02512 374 Fe_only_hydrog hydrogenases, Fe-only. This model d 97.75
COG2907447 Predicted NAD/FAD-binding protein [General functio 97.74
PRK06567 1028 putative bifunctional glutamate synthase subunit b 97.74
PRK14694468 putative mercuric reductase; Provisional 97.72
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 97.71
PLN02487569 zeta-carotene desaturase 97.7
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 97.7
PRK05329422 anaerobic glycerol-3-phosphate dehydrogenase subun 97.69
COG2221317 DsrA Dissimilatory sulfite reductase (desulfovirid 97.69
PRK07846451 mycothione reductase; Reviewed 97.69
TIGR02176 1165 pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxid 97.68
PRK00783263 DNA-directed RNA polymerase subunit D; Provisional 97.67
PRK06292460 dihydrolipoamide dehydrogenase; Validated 97.67
PRK12831464 putative oxidoreductase; Provisional 97.67
PF00732296 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001 97.67
PTZ00052499 thioredoxin reductase; Provisional 97.66
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 97.65
PRK127751006 putative trifunctional 2-polyprenylphenol hydroxyl 97.65
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 97.64
PRK12769 654 putative oxidoreductase Fe-S binding subunit; Revi 97.63
cd07030259 RNAP_D D subunit of Archaeal RNA polymerase. The D 97.63
COG1206439 Gid NAD(FAD)-utilizing enzyme possibly involved in 97.62
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 97.62
PRK14727479 putative mercuric reductase; Provisional 97.6
TIGR03294228 FrhG coenzyme F420 hydrogenase, subunit gamma. Thi 97.59
PRK09898208 hypothetical protein; Provisional 97.59
PRK13795636 hypothetical protein; Provisional 97.59
PRK10262321 thioredoxin reductase; Provisional 97.58
PLN02546558 glutathione reductase 97.56
PRK10194163 ferredoxin-type protein; Provisional 97.54
TIGR03149225 cyt_nit_nrfC cytochrome c nitrite reductase, Fe-S 97.54
KOG0685|consensus498 97.52
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 97.51
PRK02106560 choline dehydrogenase; Validated 97.51
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 97.5
PRK07569234 bidirectional hydrogenase complex protein HoxU; Va 97.48
PRK13984 604 putative oxidoreductase; Provisional 97.48
PRK13748561 putative mercuric reductase; Provisional 97.47
PF06100500 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross 97.46
PLN03000 881 amine oxidase 97.46
TIGR00397213 mauM_napG MauM/NapG family ferredoxin-type protein 97.45
PRK05675570 sdhA succinate dehydrogenase flavoprotein subunit; 97.45
PRK12809 639 putative oxidoreductase Fe-S binding subunit; Revi 97.45
KOG1800|consensus468 97.43
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 97.43
TIGR01317485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 97.4
COG2878198 Predicted NADH:ubiquinone oxidoreductase, subunit 97.39
PLN02976 1713 amine oxidase 97.36
PRK07118280 ferredoxin; Validated 97.35
PRK09326 341 F420H2 dehydrogenase subunit F; Provisional 97.34
TIGR03478321 DMSO_red_II_bet DMSO reductase family type II enzy 97.31
PRK12770352 putative glutamate synthase subunit beta; Provisio 97.3
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 97.29
PRK09476254 napG quinol dehydrogenase periplasmic component; P 97.28
PF1324798 Fer4_11: 4Fe-4S dicluster domain; PDB: 2VPY_F 2VPX 97.26
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 97.24
COG3383 978 Uncharacterized anaerobic dehydrogenase [General f 97.22
PF1348467 Fer4_16: 4Fe-4S double cluster binding domain 97.22
PF1280017 Fer4_4: 4Fe-4S binding domain; InterPro: IPR001450 97.19
PRK14993244 tetrathionate reductase subunit B; Provisional 97.16
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 97.12
PRK10330181 formate dehydrogenase-H ferredoxin subunit; Provis 97.08
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 97.07
TIGR02951161 DMSO_dmsB DMSO reductase, iron-sulfur subunit. Thi 97.07
PRK10882 328 hydrogenase 2 protein HybA; Provisional 97.06
TIGR02064402 dsrA sulfite reductase, dissimilatory-type alpha s 97.05
PRK08493 819 NADH dehydrogenase subunit G; Validated 97.04
PF1469759 Fer4_21: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE 97.02
COG2303542 BetA Choline dehydrogenase and related flavoprotei 97.0
COG0437203 HybA Fe-S-cluster-containing hydrogenase component 96.95
PRK05329422 anaerobic glycerol-3-phosphate dehydrogenase subun 96.95
TIGR03862376 flavo_PP4765 uncharacterized flavoprotein, PP_4765 96.92
TIGR01810532 betA choline dehydrogenase. This enzyme is a membe 96.92
TIGR01582283 FDH-beta formate dehydrogenase, beta subunit, Fe-S 96.92
COG4231640 Indolepyruvate ferredoxin oxidoreductase, alpha an 96.9
PF1279815 Fer4_3: 4Fe-4S binding domain; InterPro: IPR001450 96.87
COG1148 622 HdrA Heterodisulfide reductase, subunit A and rela 96.79
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 96.73
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 96.7
TIGR03336595 IOR_alpha indolepyruvate ferredoxin oxidoreductase 96.66
KOG0405|consensus478 96.66
TIGR02163255 napH_ ferredoxin-type protein, NapH/MauN family. M 96.62
PF00996438 GDI: GDP dissociation inhibitor; InterPro: IPR0182 96.61
PRK05035 695 electron transport complex protein RnfC; Provision 96.59
PRK12779944 putative bifunctional glutamate synthase subunit b 96.59
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductas 96.5
KOG3851|consensus446 96.48
COG114491 Pyruvate:ferredoxin oxidoreductase and related 2-o 96.46
PRK12387 180 formate hydrogenlyase complex iron-sulfur subunit; 96.44
KOG2495|consensus491 96.4
COG1251 793 NirB NAD(P)H-nitrite reductase [Energy production 96.34
COG1142165 HycB Fe-S-cluster-containing hydrogenase component 96.31
PRK09477271 napH quinol dehydrogenase membrane component; Prov 96.29
TIGR02745 434 ccoG_rdxA_fixG cytochrome c oxidase accessory prot 96.26
TIGR01660 492 narH nitrate reductase, beta subunit. The Nitrate 96.24
PRK098531019 putative selenate reductase subunit YgfK; Provisio 96.19
KOG0063|consensus 592 96.17
KOG1336|consensus478 96.15
KOG1238|consensus623 96.05
COG1143172 NuoI Formate hydrogenlyase subunit 6/NADH:ubiquino 96.04
TIGR01973 603 NuoG NADH-quinone oxidoreductase, chain G. This mo 95.9
TIGR01945435 rnfC electron transport complex, RnfABCDGE type, C 95.89
PF1323752 Fer4_10: 4Fe-4S dicluster domain; PDB: 2FGO_A. 95.83
PRK12771564 putative glutamate synthase (NADPH) small subunit; 95.72
TIGR0293691 fdxN_nitrog ferredoxin III, nif-specific. Members 95.72
PRK09626103 oorD 2-oxoglutarate-acceptor oxidoreductase subuni 95.66
PF0003724 Fer4: 4Fe-4S binding domain; InterPro: IPR001450 T 95.63
TIGR02486314 RDH reductive dehalogenase. This model represents 95.62
PF1283724 Fer4_6: 4Fe-4S binding domain; InterPro: IPR001450 95.61
KOG4716|consensus503 95.55
COG1600337 Uncharacterized Fe-S protein [Energy production an 95.53
PRK07860 797 NADH dehydrogenase subunit G; Validated 95.51
TIGR033151012 Se_ygfK putative selenate reductase, YgfK subunit. 95.44
PF01593450 Amino_oxidase: Flavin containing amine oxidoreduct 95.33
COG2221 317 DsrA Dissimilatory sulfite reductase (desulfovirid 95.29
TIGR0217978 PorD_KorD 2-oxoacid:acceptor oxidoreductase, delta 95.28
>KOG2415|consensus Back     alignment and domain information 
Probab=100.00  E-value=1.8e-113  Score=813.02  Aligned_cols=545  Identities=54%  Similarity=0.994  Sum_probs=522.4

Q ss_pred             CCCCCCCCcccEEEECchhHHHHHHHHHHhccccCCCCCcEEEEcCCCCCCCceeecceeChhhHHhhccccc-cCCccc
Q psy14496         14 KYGPRESIEYDVIIVGGGPSGLSAAIRLKQLAIKKNKEIKICVLEKGSELGAHILSGAIIDPRSIFELFPKEK-LNKLFN   92 (561)
Q Consensus        14 ~~~~~~~~~~dVvIVGaGpAGLa~A~~La~~~~~~~~G~~V~ViEk~~~~g~~~~~G~~~~~~~l~~l~~~~~-~~~~~~   92 (561)
                      .+++|+...+||+|||||||||++|+.|.++.++++..++|+|+||+..+|++.++|++++|.++++++++|. .+.++.
T Consensus        68 v~~~R~~e~~Dv~IVG~GPAGLsaAIrlKQla~~~~~dlrVcvvEKaa~~GghtlSGaviep~aldEL~P~wke~~apl~  147 (621)
T KOG2415|consen   68 VNMERESEEVDVVIVGAGPAGLSAAIRLKQLAAKANKDLRVCVVEKAAEVGGHTLSGAVIEPGALDELLPDWKEDGAPLN  147 (621)
T ss_pred             ccchhhhccccEEEECCCchhHHHHHHHHHHHHhcCCceEEEEEeeccccCCceecceeeccchhhhhCcchhhcCCccc
Confidence            3455777889999999999999999999999888889999999999999999999999999999999999999 889999


Q ss_pred             cccchhhhhhhcCCCCcccCCCCCCceeecCCcEEeeHHHHHHHHHHHHHHCCCEEEcCceEeEEEEcCCCCEEEEEecc
Q psy14496         93 TPVIEERFLFLSSKKSYKIPSWILPICFKNHGNYIISLSDLVRWMGKKAENMGIDIFSGFSASEILYDSKNNVCGIATNN  172 (561)
Q Consensus        93 ~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~i~r~~l~~~L~~~a~~~gv~i~~g~~v~~i~~~~~g~v~~V~~~~  172 (561)
                      .+++.+.+.++.....+.+|   .|..+.++++|+++.++|.+||.++|++.||+|+++..+.++++++++.|.||.|.|
T Consensus       148 t~vT~d~~~fLt~~~~i~vP---v~~pm~NhGNYvv~L~~~v~wLg~kAEe~GvEiyPg~aaSevly~edgsVkGiaT~D  224 (621)
T KOG2415|consen  148 TPVTSDKFKFLTGKGRISVP---VPSPMDNHGNYVVSLGQLVRWLGEKAEELGVEIYPGFAASEVLYDEDGSVKGIATND  224 (621)
T ss_pred             ccccccceeeeccCceeecC---CCcccccCCcEEEEHHHHHHHHHHHHHhhCceeccccchhheeEcCCCcEeeEeecc
Confidence            99999999999998888887   456788999999999999999999999999999999999999999999999999999


Q ss_pred             cccccCCceecccccCeEEecCEEEEccCCCchhhHHHHHHcCCCCCCCCccccceeEEEEeeCCCccCCCcEEEEeccC
Q psy14496        173 FGINKEGIIKKNFQLGMELYAKYTLFAEGSRGHLSKQIIKKFNLDNKKDPQTYSLGIKELWTINPKLHKKGLVIHTIGWP  252 (561)
Q Consensus       173 ~~~~~~g~~~~~f~~g~~i~ad~vV~AdG~~s~~~~~l~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p  252 (561)
                      .|+.++|.+|.+|+.|+++.|++.|.|+|+++.+.++++++++++....+++|++|++++|++++.++.++.+.|+++||
T Consensus       225 ~GI~k~G~pKd~FerGme~hak~TifAEGc~G~Lskqi~kkf~Lr~n~e~qtYglGlKEvWei~~~~~~pG~v~HT~GwP  304 (621)
T KOG2415|consen  225 VGISKDGAPKDTFERGMEFHAKVTIFAEGCHGSLSKQIIKKFDLRENCEPQTYGLGLKEVWEIDPENHNPGEVAHTLGWP  304 (621)
T ss_pred             ccccCCCCccccccccceecceeEEEeccccchhHHHHHHHhCcccCCCcceeccccceeEecChhhcCCcceeeeccCc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCceEEEEEcCCCeEEEEEEecCCCCCCCCChHHHHHHhhhChhHHHhhcCCeeeeecceeeccCCCccCCeeecC
Q psy14496        253 LDYKTYGGGFLYHMENNQISIGYIISLDYKNPYLSPFEEFQRYKTHPKICKILKGGKRISYGARTITTGGLQSLPEFIFD  332 (561)
Q Consensus       253 ~~~~~~g~~~~~~~~~~~~~ig~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~  332 (561)
                      ++...||++|+|+.++..+.+|+++.+++.+|..+|+.+||+++.||.++..+++++++.|+++++.++|+++.|+++++
T Consensus       305 l~~~tYGGsFlYh~~d~~VavGlVVgLdY~NP~lsP~~EFQk~K~hP~i~~vleGgk~i~YgARaLNEGGfQsiPkl~FP  384 (621)
T KOG2415|consen  305 LDNDTYGGSFLYHFNDPLVAVGLVVGLDYKNPYLSPYKEFQKMKHHPSISKVLEGGKRIAYGARALNEGGFQSIPKLVFP  384 (621)
T ss_pred             ccCCccCceeEEEcCCCeEEEEEEEEecCCCCCCCHHHHHHHhhcCcchhhhhcCcceeeehhhhhccCCcccCcccccC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CEEEEecCCccCCCcccccchHHHHHHHHHHHHHHHHHhcCCCccc----hhhHHHHHhhchhhHhhhhhhccchhhh--
Q psy14496        333 GGAFIGCNAGFMNVSRIKGIHTSIKSGILVADSIFKKICSNNKFNK----LITYKTSFQASWLYKELYKARNFKPAMK--  406 (561)
Q Consensus       333 ~v~lvGDAa~~~~P~~g~G~~~Ai~~a~~lA~~l~~~l~~~~~~~~----l~~y~~~~~~~~~~~~~~~~~~~~~~~~--  406 (561)
                      +-+|||.+|+++|.....|.++||.+|+++|++|.+++.+...+..    +..|++.++++|+.++++..||+++.|+  
T Consensus       385 GG~liGcSaGFlNVpKIKGTHtAMKSGmlAAesif~ai~~~~~~k~~~~~~~~Ye~nlkds~V~KeLysvRNirPsf~~~  464 (621)
T KOG2415|consen  385 GGALIGCSAGFLNVPKIKGTHTAMKSGMLAAESIFEAIKGLPQSKMAGLDPTTYEENLKDSYVWKELYSVRNIRPSFHGK  464 (621)
T ss_pred             CceEeecccccccccccccchhhhhcchhHHHHHHHHHhcCccccccccChhhHHHhhhhhHHHHHHHHhhccCcccccc
Confidence            9999999999999999999999999999999999999975542221    5699999999999999999999999995  


Q ss_pred             hhhhHHHHHHHHHHHHhcCCCCccccCCCCccCCcccccCCCCCCCCCCCCccccccccceeccccccCCCCCCceEEcC
Q psy14496        407 KGLYIGMLIIGIDQILFSGKFPFTLHNINSDYTYLEPASKHIPIKYPNPDNKLTFDKLSSIYVSNINHDEDQPIHLILKN  486 (561)
Q Consensus       407 ~g~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~fd~~~~~~~~~~~~~~~~~~h~~~~~  486 (561)
                      .|.|.||..+++..++.+|+.||+|+|+..|.+.+++++++.++.||+||++|+||.++||+++|++|++|||||++++|
T Consensus       465 lG~ygGmiySgi~~~~lkG~~PwTLkh~~~D~e~l~pa~k~~pI~YPKPDg~lSFDlltSvs~sgTnH~~dqP~HL~l~~  544 (621)
T KOG2415|consen  465 LGLYGGMIYSGIFSYVLKGKVPWTLKHGKNDHEALKPASKYKPIVYPKPDGVLSFDLLTSVSRSGTNHDEDQPAHLTLRD  544 (621)
T ss_pred             cccccchhhhhhHHHhhcCccceeeccCCCchhhccchhhCCCcccCCCCceEEEeecchhhccCCCCCCCCCceeeecC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCcccccccccccccccccCCeeEEEEeecCc--eeEEEEccCCCccCCcccccCCCCCeeEECCCCCCCCCCCCC
Q psy14496        487 KKIPIHINFSIYAGPEARYCPAGVYEFIIEKNK--IQHLQINAQNCIHCKTCDIKDPTQNIEWITPEGGSGTNYPNM  561 (561)
Q Consensus       487 ~~~c~~~~~~~~~~~c~~~CP~~~~~~~~~~~~--~~~~~~~~~~C~~Cg~C~~~cp~~~i~~~~p~g~~g~~~~~~  561 (561)
                      .++..+.+++.|.++..+||||+|||+++++.+  +++++||.+|||||+||+|+.|.++|+|.+||||.||.|..|
T Consensus       545 ~~ip~~~nf~~y~gpE~rfCPAgVYEyV~dE~~~~~krlqINaQNCiHCKtCDIKdP~QnI~W~vPeGGgGP~Y~~m  621 (621)
T KOG2415|consen  545 DDIPVKVNFPVYKGPESRFCPAGVYEYVPDEAGPVGKRLQINAQNCIHCKTCDIKDPKQNINWVVPEGGGGPKYTLM  621 (621)
T ss_pred             CCcchhcCcccccChhhccCCccceeecccccCCCcceEEEccccceecccccccCcccCceeeCcCCCCCCCcccC
Confidence            999999999999999999999999999887644  359999999999999999999999999999999999999987

>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>PF05187 ETF_QO: Electron transfer flavoprotein-ubiquinone oxidoreductase; InterPro: IPR007859 Electron-transfer flavoprotein-ubiquinone oxidoreductase (ETF-QO) in the inner mitochondrial membrane accepts electrons from electron-transfer flavoprotein which is located in the mitochondrial matrix and reduces ubiquinone in the mitochondrial membrane Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PTZ00367 squalene epoxidase; Provisional Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>KOG2614|consensus Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>COG2440 FixX Ferredoxin-like protein [Energy production and conversion] Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan Back     alignment and domain information
>KOG1298|consensus Back     alignment and domain information
>PRK15449 ferredoxin-like protein FixX; Provisional Back     alignment and domain information
>TIGR01789 lycopene_cycl lycopene cyclase Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>KOG3855|consensus Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>COG0579 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>PLN02464 glycerol-3-phosphate dehydrogenase Back     alignment and domain information
>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK07804 L-aspartate oxidase; Provisional Back     alignment and domain information
>COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK07121 hypothetical protein; Validated Back     alignment and domain information
>PTZ00383 malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>TIGR01813 flavo_cyto_c flavocytochrome c Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>PF08491 SE: Squalene epoxidase; InterPro: IPR013698 This domain is found in squalene epoxidase (SE) and related proteins which are found in taxonomically diverse groups of eukaryotes and also in bacteria Back     alignment and domain information
>PRK06481 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase Back     alignment and domain information
>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08274 tricarballylate dehydrogenase; Validated Back     alignment and domain information
>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit Back     alignment and domain information
>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional Back     alignment and domain information
>PRK08275 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>PF14697 Fer4_21: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_C 2O01_C 2WSC_C 3LW5_C 1H7X_C 1H7W_A 1GT8_A 1GTE_B 1GTH_B Back     alignment and domain information
>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK05257 malate:quinone oxidoreductase; Validated Back     alignment and domain information
>PF00890 FAD_binding_2: FAD binding domain of the Pfam family Back     alignment and domain information
>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK09231 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK12839 hypothetical protein; Provisional Back     alignment and domain information
>KOG2820|consensus Back     alignment and domain information
>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit Back     alignment and domain information
>PRK06854 adenylylsulfate reductase subunit alpha; Validated Back     alignment and domain information
>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK13339 malate:quinone oxidoreductase; Reviewed Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>KOG1399|consensus Back     alignment and domain information
>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>COG1144 Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, delta subunit [Energy production and conversion] Back     alignment and domain information
>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06175 L-aspartate oxidase; Provisional Back     alignment and domain information
>TIGR00136 gidA glucose-inhibited division protein A Back     alignment and domain information
>PRK08401 L-aspartate oxidase; Provisional Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>PRK12834 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>PLN02815 L-aspartate oxidase Back     alignment and domain information
>TIGR00551 nadB L-aspartate oxidase Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK06134 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PLN02612 phytoene desaturase Back     alignment and domain information
>PRK12842 putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>PRK12843 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK08626 fumarate reductase flavoprotein subunit; Provisional Back     alignment and domain information
>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>COG1143 NuoI Formate hydrogenlyase subunit 6/NADH:ubiquinone oxidoreductase 23 kD subunit (chain I) [Energy production and conversion] Back     alignment and domain information
>PRK13977 myosin-cross-reactive antigen; Provisional Back     alignment and domain information
>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>COG1142 HycB Fe-S-cluster-containing hydrogenase components 2 [Energy production and conversion] Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle Back     alignment and domain information
>KOG2844|consensus Back     alignment and domain information
>PRK07395 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup Back     alignment and domain information
>TIGR02731 phytoene_desat phytoene desaturase Back     alignment and domain information
>PRK09077 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PTZ00306 NADH-dependent fumarate reductase; Provisional Back     alignment and domain information
>TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit Back     alignment and domain information
>TIGR00562 proto_IX_ox protoporphyrinogen oxidase Back     alignment and domain information
>PRK12416 protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>PRK08071 L-aspartate oxidase; Provisional Back     alignment and domain information
>KOG2853|consensus Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>COG1146 Ferredoxin [Energy production and conversion] Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR02732 zeta_caro_desat carotene 7,8-desaturase Back     alignment and domain information
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>PF13247 Fer4_11: 4Fe-4S dicluster domain; PDB: 2VPY_F 2VPX_B 2VPZ_B 2VPW_F 3IR7_B 1Y5N_B 1R27_D 3EGW_B 1Y5I_B 1Q16_B Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>KOG2852|consensus Back     alignment and domain information
>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK07512 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PF13454 NAD_binding_9: FAD-NAD(P)-binding Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>COG1053 SdhA Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>KOG2404|consensus Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>KOG3923|consensus Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>CHL00065 psaC photosystem I subunit VII Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>KOG3256|consensus Back     alignment and domain information
>TIGR02936 fdxN_nitrog ferredoxin III, nif-specific Back     alignment and domain information
>PRK08348 NADH-plastoquinone oxidoreductase subunit; Provisional Back     alignment and domain information
>KOG2960|consensus Back     alignment and domain information
>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>PF13187 Fer4_9: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_C 2O01_C 2WSC_C 3LW5_C 2VKR_C 1KQG_B 1KQF_B 3GYX_J Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK09624 porD pyuvate ferredoxin oxidoreductase subunit delta; Reviewed Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>COG0437 HybA Fe-S-cluster-containing hydrogenase components 1 [Energy production and conversion] Back     alignment and domain information
>KOG2665|consensus Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>TIGR02060 aprB adenosine phosphosulphate reductase, beta subunit Back     alignment and domain information
>PLN00071 photosystem I subunit VII; Provisional Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>TIGR02179 PorD_KorD 2-oxoacid:acceptor oxidoreductase, delta subunit, pyruvate/2-ketoisovalerate family Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>PRK09625 porD pyruvate flavodoxin oxidoreductase subunit delta; Reviewed Back     alignment and domain information
>PTZ00363 rab-GDP dissociation inhibitor; Provisional Back     alignment and domain information
>COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK09626 oorD 2-oxoglutarate-acceptor oxidoreductase subunit OorD; Reviewed Back     alignment and domain information
>KOG0029|consensus Back     alignment and domain information
>PF12838 Fer4_7: 4Fe-4S dicluster domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>KOG1335|consensus Back     alignment and domain information
>TIGR03048 PS_I_psaC photosystem I iron-sulfur protein PsaC Back     alignment and domain information
>TIGR01660 narH nitrate reductase, beta subunit Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>PRK09623 vorD 2-ketoisovalerate ferredoxin oxidoreductase subunit delta; Reviewed Back     alignment and domain information
>KOG0042|consensus Back     alignment and domain information
>PF13237 Fer4_10: 4Fe-4S dicluster domain; PDB: 2FGO_A Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK08222 hydrogenase 4 subunit H; Validated Back     alignment and domain information
>TIGR01944 rnfB electron transport complex, RnfABCDGE type, B subunit Back     alignment and domain information
>TIGR02462 pyranose_ox pyranose oxidase Back     alignment and domain information
>TIGR03478 DMSO_red_II_bet DMSO reductase family type II enzyme, iron-sulfur subunit Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>COG1231 Monoamine oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03197 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain Back     alignment and domain information
>COG0029 NadB Aspartate oxidase [Coenzyme metabolism] Back     alignment and domain information
>TIGR01582 FDH-beta formate dehydrogenase, beta subunit, Fe-S containing Back     alignment and domain information
>PRK02651 photosystem I subunit VII; Provisional Back     alignment and domain information
>PRK12387 formate hydrogenlyase complex iron-sulfur subunit; Provisional Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>TIGR02352 thiamin_ThiO glycine oxidase ThiO Back     alignment and domain information
>PRK06273 ferredoxin; Provisional Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>PF00037 Fer4: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>PRK05888 NADH dehydrogenase subunit I; Provisional Back     alignment and domain information
>COG1149 MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion] Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>TIGR00403 ndhI NADH-plastoquinone oxidoreductase subunit I protein Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>COG3573 Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>COG4529 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK06991 ferredoxin; Provisional Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>PRK05113 electron transport complex protein RnfB; Provisional Back     alignment and domain information
>PRK10194 ferredoxin-type protein; Provisional Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>COG3349 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>COG1145 NapF Ferredoxin [Energy production and conversion] Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>PLN02268 probable polyamine oxidase Back     alignment and domain information
>KOG0404|consensus Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>TIGR03149 cyt_nit_nrfC cytochrome c nitrite reductase, Fe-S protein Back     alignment and domain information
>TIGR01971 NuoI NADH-quinone oxidoreductase, chain I Back     alignment and domain information
>PF12837 Fer4_6: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters Back     alignment and domain information
>TIGR02066 dsrB sulfite reductase, dissimilatory-type beta subunit Back     alignment and domain information
>TIGR02494 PFLE_PFLC glycyl-radical enzyme activating protein family Back     alignment and domain information
>PLN02568 polyamine oxidase Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK14993 tetrathionate reductase subunit B; Provisional Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>PRK08764 ferredoxin; Provisional Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>TIGR00402 napF ferredoxin-type protein NapF Back     alignment and domain information
>TIGR02163 napH_ ferredoxin-type protein, NapH/MauN family Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>PF12797 Fer4_2: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PLN02576 protoporphyrinogen oxidase Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PRK09898 hypothetical protein; Provisional Back     alignment and domain information
>PRK09476 napG quinol dehydrogenase periplasmic component; Provisional Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>CHL00014 ndhI NADH dehydrogenase subunit I Back     alignment and domain information
>COG2768 Uncharacterized Fe-S center protein [General function prediction only] Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK09477 napH quinol dehydrogenase membrane component; Provisional Back     alignment and domain information
>PRK10882 hydrogenase 2 protein HybA; Provisional Back     alignment and domain information
>TIGR03224 benzo_boxA benzoyl-CoA oxygenase/reductase, BoxA protein Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>TIGR03377 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase, anaerobic, A subunit Back     alignment and domain information
>PRK10330 formate dehydrogenase-H ferredoxin subunit; Provisional Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02951 DMSO_dmsB DMSO reductase, iron-sulfur subunit Back     alignment and domain information
>PRK07118 ferredoxin; Validated Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>TIGR02700 flavo_MJ0208 archaeoflavoprotein, MJ0208 family Back     alignment and domain information
>TIGR00397 mauM_napG MauM/NapG family ferredoxin-type protein Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK14028 pyruvate ferredoxin oxidoreductase subunit gamma/delta; Provisional Back     alignment and domain information
>KOG0399|consensus Back     alignment and domain information
>PLN02785 Protein HOTHEAD Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>COG0562 Glf UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG1276|consensus Back     alignment and domain information
>KOG2311|consensus Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>COG3075 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03287 methan_mark_16 putative methanogenesis marker 16 metalloprotein Back     alignment and domain information
>COG3486 IucD Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>PLN02676 polyamine oxidase Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>PLN02529 lysine-specific histone demethylase 1 Back     alignment and domain information
>KOG4254|consensus Back     alignment and domain information
>TIGR02912 sulfite_red_C sulfite reductase, subunit C Back     alignment and domain information
>KOG1336|consensus Back     alignment and domain information
>PRK08318 dihydropyrimidine dehydrogenase subunit B; Validated Back     alignment and domain information
>PLN02328 lysine-specific histone demethylase 1 homolog Back     alignment and domain information
>TIGR02512 Fe_only_hydrog hydrogenases, Fe-only Back     alignment and domain information
>COG2907 Predicted NAD/FAD-binding protein [General function prediction only] Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PLN02487 zeta-carotene desaturase Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>COG2221 DsrA Dissimilatory sulfite reductase (desulfoviridin), alpha and beta subunits [Energy production and conversion] Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>TIGR02176 pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxidoreductase, homodimeric Back     alignment and domain information
>PRK00783 DNA-directed RNA polymerase subunit D; Provisional Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>cd07030 RNAP_D D subunit of Archaeal RNA polymerase Back     alignment and domain information
>COG1206 Gid NAD(FAD)-utilizing enzyme possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR03294 FrhG coenzyme F420 hydrogenase, subunit gamma Back     alignment and domain information
>PRK09898 hypothetical protein; Provisional Back     alignment and domain information
>PRK13795 hypothetical protein; Provisional Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>PRK10194 ferredoxin-type protein; Provisional Back     alignment and domain information
>TIGR03149 cyt_nit_nrfC cytochrome c nitrite reductase, Fe-S protein Back     alignment and domain information
>KOG0685|consensus Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>PRK02106 choline dehydrogenase; Validated Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>PRK07569 bidirectional hydrogenase complex protein HoxU; Validated Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>PF06100 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross-reactive antigen like family ; InterPro: IPR010354 Members of this family are thought to have structural features in common with the beta chain of the class II antigens, as well as myosin, and may play an important role in the pathogenesis [] Back     alignment and domain information
>PLN03000 amine oxidase Back     alignment and domain information
>TIGR00397 mauM_napG MauM/NapG family ferredoxin-type protein Back     alignment and domain information
>PRK05675 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>KOG1800|consensus Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>COG2878 Predicted NADH:ubiquinone oxidoreductase, subunit RnfB [Energy production and conversion] Back     alignment and domain information
>PLN02976 amine oxidase Back     alignment and domain information
>PRK07118 ferredoxin; Validated Back     alignment and domain information
>PRK09326 F420H2 dehydrogenase subunit F; Provisional Back     alignment and domain information
>TIGR03478 DMSO_red_II_bet DMSO reductase family type II enzyme, iron-sulfur subunit Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>PRK09476 napG quinol dehydrogenase periplasmic component; Provisional Back     alignment and domain information
>PF13247 Fer4_11: 4Fe-4S dicluster domain; PDB: 2VPY_F 2VPX_B 2VPZ_B 2VPW_F 3IR7_B 1Y5N_B 1R27_D 3EGW_B 1Y5I_B 1Q16_B Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>COG3383 Uncharacterized anaerobic dehydrogenase [General function prediction only] Back     alignment and domain information
>PF13484 Fer4_16: 4Fe-4S double cluster binding domain Back     alignment and domain information
>PF12800 Fer4_4: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters Back     alignment and domain information
>PRK14993 tetrathionate reductase subunit B; Provisional Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PRK10330 formate dehydrogenase-H ferredoxin subunit; Provisional Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>TIGR02951 DMSO_dmsB DMSO reductase, iron-sulfur subunit Back     alignment and domain information
>PRK10882 hydrogenase 2 protein HybA; Provisional Back     alignment and domain information
>TIGR02064 dsrA sulfite reductase, dissimilatory-type alpha subunit Back     alignment and domain information
>PRK08493 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PF14697 Fer4_21: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_C 2O01_C 2WSC_C 3LW5_C 1H7X_C 1H7W_A 1GT8_A 1GTE_B 1GTH_B Back     alignment and domain information
>COG2303 BetA Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] Back     alignment and domain information
>COG0437 HybA Fe-S-cluster-containing hydrogenase components 1 [Energy production and conversion] Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>TIGR03862 flavo_PP4765 uncharacterized flavoprotein, PP_4765 family Back     alignment and domain information
>TIGR01810 betA choline dehydrogenase Back     alignment and domain information
>TIGR01582 FDH-beta formate dehydrogenase, beta subunit, Fe-S containing Back     alignment and domain information
>COG4231 Indolepyruvate ferredoxin oxidoreductase, alpha and beta subunits [Energy production and conversion] Back     alignment and domain information
>PF12798 Fer4_3: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>TIGR03336 IOR_alpha indolepyruvate ferredoxin oxidoreductase, alpha subunit Back     alignment and domain information
>KOG0405|consensus Back     alignment and domain information
>TIGR02163 napH_ ferredoxin-type protein, NapH/MauN family Back     alignment and domain information
>PF00996 GDI: GDP dissociation inhibitor; InterPro: IPR018203 Rab proteins constitute a family of small GTPases that serve a regulatory role in vesicular membrane traffic [, ]; C-terminal geranylgeranylation is crucial for their membrane association and function Back     alignment and domain information
>PRK05035 electron transport complex protein RnfC; Provisional Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>KOG3851|consensus Back     alignment and domain information
>COG1144 Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, delta subunit [Energy production and conversion] Back     alignment and domain information
>PRK12387 formate hydrogenlyase complex iron-sulfur subunit; Provisional Back     alignment and domain information
>KOG2495|consensus Back     alignment and domain information
>COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>COG1142 HycB Fe-S-cluster-containing hydrogenase components 2 [Energy production and conversion] Back     alignment and domain information
>PRK09477 napH quinol dehydrogenase membrane component; Provisional Back     alignment and domain information
>TIGR02745 ccoG_rdxA_fixG cytochrome c oxidase accessory protein FixG Back     alignment and domain information
>TIGR01660 narH nitrate reductase, beta subunit Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>KOG0063|consensus Back     alignment and domain information
>KOG1336|consensus Back     alignment and domain information
>KOG1238|consensus Back     alignment and domain information
>COG1143 NuoI Formate hydrogenlyase subunit 6/NADH:ubiquinone oxidoreductase 23 kD subunit (chain I) [Energy production and conversion] Back     alignment and domain information
>TIGR01973 NuoG NADH-quinone oxidoreductase, chain G Back     alignment and domain information
>TIGR01945 rnfC electron transport complex, RnfABCDGE type, C subunit Back     alignment and domain information
>PF13237 Fer4_10: 4Fe-4S dicluster domain; PDB: 2FGO_A Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>TIGR02936 fdxN_nitrog ferredoxin III, nif-specific Back     alignment and domain information
>PRK09626 oorD 2-oxoglutarate-acceptor oxidoreductase subunit OorD; Reviewed Back     alignment and domain information
>PF00037 Fer4: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters Back     alignment and domain information
>TIGR02486 RDH reductive dehalogenase Back     alignment and domain information
>PF12837 Fer4_6: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters Back     alignment and domain information
>KOG4716|consensus Back     alignment and domain information
>COG1600 Uncharacterized Fe-S protein [Energy production and conversion] Back     alignment and domain information
>PRK07860 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>PF01593 Amino_oxidase: Flavin containing amine oxidoreductase This is a subset of the Pfam family; InterPro: IPR002937 This entry consists of various amine oxidases, including maize polyamine oxidase (PAO) [], L-amino acid oxidases (LAO) and various flavin containing monoamine oxidases (MAO) Back     alignment and domain information
>COG2221 DsrA Dissimilatory sulfite reductase (desulfoviridin), alpha and beta subunits [Energy production and conversion] Back     alignment and domain information
>TIGR02179 PorD_KorD 2-oxoacid:acceptor oxidoreductase, delta subunit, pyruvate/2-ketoisovalerate family Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query561
2gmh_A584 Structure Of Porcine Electron Transfer Flavoprotein 1e-172
>pdb|2GMH|A Chain A, Structure Of Porcine Electron Transfer Flavoprotein- Ubiquinone Oxidoreductase In Complexed With Ubiquinone Length = 584 Back     alignment and structure 
Iteration: 1

 Score =  602 bits (1552), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 292/557 (52%), Positives = 392/557 (70%), Gaps = 16/557 (2%)
Query: 18  RESIEYDVIIVGGGPSGLSAAIRLKQLAIKKNKEIKICVLEKGSELGAHILSGAIIDPRS 77
           R + E DV+IVG GP+GLSAA RLKQLA +  K++++C++EK + +GAH LSGA +DPR+
Sbjct: 31  RFAEEADVVIVGAGPAGLSAATRLKQLAAQHEKDLRVCLVEKAAHIGAHTLSGACLDPRA 90
Query: 78  IFELFP--KEKLNKLFNTPVIEERFLFLSSKKSYKIPSWILP-ICFKNHGNYIISLSDLV 134
             ELFP  KEK   L NTPV E+RF  L+ K  Y+IP  ILP +   NHGNY++ L  LV
Sbjct: 91  FEELFPDWKEKGAPL-NTPVTEDRFGILTEK--YRIPVPILPGLPMNNHGNYVVRLGHLV 147
Query: 135 RWMGKKAENMGIDIFSGFSASEILYDSKNNVCGIATNNFGINKEGIIKKNFQLGMELYAK 194
            WMG++AE +G++++ G++A+EIL+    +V GIATN+ GI K+G  K  F+ G+EL+AK
Sbjct: 148 SWMGEQAEALGVEVYPGYAAAEILFHEDGSVKGIATNDVGIQKDGAPKTTFERGLELHAK 207
Query: 195 YTLFAEGSRGHLSKQIIKKFNLDNKKDPQTYSLGIKELWTINPKLHKKGLVIHTIGWPLD 254
            T+FAEG  GHL+KQ+ KKF+L    +PQTY +G+KELW I+ K  K G V HT+GWPLD
Sbjct: 208 VTIFAEGCHGHLAKQLYKKFDLRANCEPQTYGIGLKELWVIDEKKWKPGRVDHTVGWPLD 267
Query: 255 YKTYGGGFLYHMENNQ--ISIGYIISLDYKNPYLSPFEEFQRYKTHPKICKILKGGKRIS 312
             TYGG FLYH+   +  +++G+++ LDY+NPYLSPF EFQR+K HP I   L+GGKRI+
Sbjct: 268 RHTYGGSFLYHLNEGEPLLALGFVVGLDYQNPYLSPFREFQRWKHHPSIKPTLEGGKRIA 327
Query: 313 YGARTITTGGLQSLPEFIFDGGAFIGCNAGFMNVSRIKGIHTSIKSGILVADSIFKKICS 372
           YGAR +  GG QS+P+  F GG  IGC+ GFMNV +IKG HT++KSG L A+SIF ++ S
Sbjct: 328 YGARALNEGGFQSIPKLTFPGGLLIGCSPGFMNVPKIKGTHTAMKSGTLAAESIFNQLTS 387
Query: 373 NNKFNKLI-----TYKTSFQASWLYKELYKARNFKPAMKK--GLYIGMLIIGIDQILFSG 425
            N  +K I      Y+ + + SW++KELY  RN +P+     G+Y GM+  GI   +F G
Sbjct: 388 ENLQSKTIGLHVTEYEDNLKNSWVWKELYSVRNIRPSCHGILGVYGGMIYTGIFYWIFRG 447
Query: 426 KFPFTLHNINSDYTYLEPASKHIPIKYPNPDNKLTFDKLSSIYVSNINHDEDQPIHLILK 485
             P+TL +  SD   L+PA    PI+YP PD +++FD LSS+ +S  NH+ DQP HL LK
Sbjct: 448 MEPWTLKHKGSDSDQLKPAKDCTPIEYPKPDGQISFDLLSSVALSGTNHEHDQPAHLTLK 507
Query: 486 NKKIPIHINFSIYAGPEARYCPAGVYEFI-IEKNKIQHLQINAQNCIHCKTCDIKDPTQN 544
           +  +P++ N SIY GPE R+CPAGVYEF+ +E+     LQINAQNC+HCKTCDIKDP+QN
Sbjct: 508 DDSVPVNRNLSIYDGPEQRFCPAGVYEFVPLEQGDGFRLQINAQNCVHCKTCDIKDPSQN 567
Query: 545 IEWITPEGGSGTNYPNM 561
           I W+ PEGG G  Y  M
Sbjct: 568 INWVVPEGGGGPAYNGM 584

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query561
2gmh_A584 Electron transfer flavoprotein-ubiquinone oxidored 0.0
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 7e-43
3atr_A453 Conserved archaeal protein; saturating double bond 7e-41
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 3e-25
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 3e-21
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 8e-20
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 5e-19
3e1t_A512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 3e-17
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 1e-14
3i3l_A591 Alkylhalidase CMLS; flavin-dependent halogenase, c 2e-13
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 3e-10
3lov_A475 Protoporphyrinogen oxidase; structural genomics, J 2e-08
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 2e-08
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 2e-08
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 2e-08
2b9w_A424 Putative aminooxidase; isomerase, conjugated linol 3e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-08
1sez_A504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 3e-08
1pn0_A 665 Phenol 2-monooxygenase; two dimers, TLS refinement 5e-08
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 5e-08
2ivd_A478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 6e-08
2qa2_A499 CABE, polyketide oxygenase CABE; FAD, angucycline, 6e-08
2qa1_A500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 7e-08
3ihg_A535 RDME; flavoenzyme, anthracycline, polyketide biosy 8e-08
3fmw_A570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 1e-07
2dkh_A639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 1e-07
2r0c_A549 REBC; flavin adenine dinucleotide, monooxygenase, 2e-07
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 2e-07
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 2e-07
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 3e-07
3gyx_A 662 Adenylylsulfate reductase; oxidoreductase; HET: FA 3e-07
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 5e-07
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 7e-07
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 9e-07
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 9e-07
1w4x_A542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 1e-06
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 1e-06
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 1e-06
2gqf_A401 Hypothetical protein HI0933; structural genomics, 2e-06
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 2e-06
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 2e-06
4fk1_A304 Putative thioredoxin reductase; structural genomic 2e-06
3axb_A448 Putative oxidoreductase; dinucleotide-binding fold 3e-06
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 3e-06
1jnr_A643 Adenylylsulfate reductase; oxidoreductase; HET: FA 3e-06
2yg5_A453 Putrescine oxidase; oxidoreductase, flavin; HET: F 3e-06
3utf_A513 UDP-galactopyranose mutase; nucleotide binding, fl 5e-06
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 5e-06
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 7e-06
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 1e-05
1n4w_A504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 1e-05
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 2e-05
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 2e-05
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 2e-05
3pl8_A623 Pyranose 2-oxidase; substrate complex, H167A mutan 2e-05
2jae_A489 L-amino acid oxidase; oxidoreductase, dimerisation 2e-05
2ywl_A180 Thioredoxin reductase related protein; uncharacter 3e-05
4dsg_A484 UDP-galactopyranose mutase; rossmann fold, flavin 3e-05
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 3e-05
2iid_A498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 4e-05
1coy_A507 Cholesterol oxidase; oxidoreductase(oxygen recepto 5e-05
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 5e-05
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 5e-05
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 5e-05
1ojt_A482 Surface protein; redox-active center, glycolysis, 6e-05
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 7e-05
1s3e_A520 Amine oxidase [flavin-containing] B; human monoami 7e-05
3dme_A369 Conserved exported protein; structural genomics, P 7e-05
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 7e-05
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 8e-05
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 8e-05
1rsg_A516 FMS1 protein; FAD binding motif, oxidoreductase; H 9e-05
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 9e-05
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 1e-04
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 1e-04
3hdq_A397 UDP-galactopyranose mutase; substrate and inhibito 1e-04
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 1e-04
3c4a_A381 Probable tryptophan hydroxylase VIOD; alpha-beta p 2e-04
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 2e-04
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 2e-04
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 2e-04
3ayj_A 721 Pro-enzyme of L-phenylalanine oxidase; amino acid 2e-04
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 2e-04
1i8t_A367 UDP-galactopyranose mutase; rossman fold, FAD, con 3e-04
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 3e-04
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 3e-04
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 3e-04
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 4e-04
1kf6_A602 Fumarate reductase flavoprotein; respiration, fuma 4e-04
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 4e-04
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 5e-04
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 5e-04
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 5e-04
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 5e-04
1yqz_A438 Coenzyme A disulfide reductase; oxidoreductase; HE 6e-04
2bi7_A384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 6e-04
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 6e-04
1v0j_A399 UDP-galactopyranose mutase; flavoprotein, isomeras 6e-04
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 6e-04
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 7e-04
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Length = 584 Back     alignment and structure
 Score =  810 bits (2095), Expect = 0.0
 Identities = 283/556 (50%), Positives = 385/556 (69%), Gaps = 12/556 (2%)

Query: 17  PRESIEYDVIIVGGGPSGLSAAIRLKQLAIKKNKEIKICVLEKGSELGAHILSGAIIDPR 76
            R + E DV+IVG GP+GLSAA RLKQLA +  K++++C++EK + +GAH LSGA +DPR
Sbjct: 30  ERFAEEADVVIVGAGPAGLSAATRLKQLAAQHEKDLRVCLVEKAAHIGAHTLSGACLDPR 89

Query: 77  SIFELFPKEK-LNKLFNTPVIEERFLFLSSKKSYKIPSWILPICFKNHGNYIISLSDLVR 135
           +  ELFP  K      NTPV E+RF  L+ K    +P  +  +   NHGNY++ L  LV 
Sbjct: 90  AFEELFPDWKEKGAPLNTPVTEDRFGILTEKYRIPVP-ILPGLPMNNHGNYVVRLGHLVS 148

Query: 136 WMGKKAENMGIDIFSGFSASEILYDSKNNVCGIATNNFGINKEGIIKKNFQLGMELYAKY 195
           WMG++AE +G++++ G++A+EIL+    +V GIATN+ GI K+G  K  F+ G+EL+AK 
Sbjct: 149 WMGEQAEALGVEVYPGYAAAEILFHEDGSVKGIATNDVGIQKDGAPKTTFERGLELHAKV 208

Query: 196 TLFAEGSRGHLSKQIIKKFNLDNKKDPQTYSLGIKELWTINPKLHKKGLVIHTIGWPLDY 255
           T+FAEG  GHL+KQ+ KKF+L    +PQTY +G+KELW I+ K  K G V HT+GWPLD 
Sbjct: 209 TIFAEGCHGHLAKQLYKKFDLRANCEPQTYGIGLKELWVIDEKKWKPGRVDHTVGWPLDR 268

Query: 256 KTYGGGFLYHMENNQ--ISIGYIISLDYKNPYLSPFEEFQRYKTHPKICKILKGGKRISY 313
            TYGG FLYH+   +  +++G+++ LDY+NPYLSPF EFQR+K HP I   L+GGKRI+Y
Sbjct: 269 HTYGGSFLYHLNEGEPLLALGFVVGLDYQNPYLSPFREFQRWKHHPSIKPTLEGGKRIAY 328

Query: 314 GARTITTGGLQSLPEFIFDGGAFIGCNAGFMNVSRIKGIHTSIKSGILVADSIFKKICSN 373
           GAR +  GG QS+P+  F GG  IGC+ GFMNV +IKG HT++KSG L A+SIF ++ S 
Sbjct: 329 GARALNEGGFQSIPKLTFPGGLLIGCSPGFMNVPKIKGTHTAMKSGTLAAESIFNQLTSE 388

Query: 374 NKFNK-----LITYKTSFQASWLYKELYKARNFKPAMKK--GLYIGMLIIGIDQILFSGK 426
           N  +K     +  Y+ + + SW++KELY  RN +P+     G+Y GM+  GI   +F G 
Sbjct: 389 NLQSKTIGLHVTEYEDNLKNSWVWKELYSVRNIRPSCHGILGVYGGMIYTGIFYWIFRGM 448

Query: 427 FPFTLHNINSDYTYLEPASKHIPIKYPNPDNKLTFDKLSSIYVSNINHDEDQPIHLILKN 486
            P+TL +  SD   L+PA    PI+YP PD +++FD LSS+ +S  NH+ DQP HL LK+
Sbjct: 449 EPWTLKHKGSDSDQLKPAKDCTPIEYPKPDGQISFDLLSSVALSGTNHEHDQPAHLTLKD 508

Query: 487 KKIPIHINFSIYAGPEARYCPAGVYEFI-IEKNKIQHLQINAQNCIHCKTCDIKDPTQNI 545
             +P++ N SIY GPE R+CPAGVYEF+ +E+     LQINAQNC+HCKTCDIKDP+QNI
Sbjct: 509 DSVPVNRNLSIYDGPEQRFCPAGVYEFVPLEQGDGFRLQINAQNCVHCKTCDIKDPSQNI 568

Query: 546 EWITPEGGSGTNYPNM 561
            W+ PEGG G  Y  M
Sbjct: 569 NWVVPEGGGGPAYNGM 584
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Length = 344 Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Length = 453 Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Length = 284 Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} SCOP: c.3.1.6 PDB: 3fpz_A* Length = 326 Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Length = 421 Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Length = 512 Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Length = 405 Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Length = 591 Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Length = 470 Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Length = 475 Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Length = 463 Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Length = 477 Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Length = 399 Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Length = 424 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Length = 504 Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Length = 665 Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Length = 447 Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Length = 478 Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Length = 499 Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Length = 500 Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Length = 535 Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Length = 570 Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Length = 639 Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Length = 549 Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Length = 572 Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Length = 394 Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Length = 357 Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Length = 662 Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Length = 369 Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Length = 566 Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Length = 540 Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Length = 549 Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Length = 542 Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Length = 297 Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Length = 545 Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Length = 401 Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Length = 417 Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Length = 571 Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Length = 304 Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Length = 448 Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Length = 381 Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Length = 643 Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Length = 453 Back     alignment and structure
>3utf_A UDP-galactopyranose mutase; nucleotide binding, flavin adenine dinucleotide BIND isomerase; HET: FDA; 2.25A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Length = 513 Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Length = 510 Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Length = 431 Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Length = 492 Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Length = 504 Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Length = 421 Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Length = 466 Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Length = 474 Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Length = 623 Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Length = 489 Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Length = 180 Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Length = 484 Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Length = 472 Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Length = 498 Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Length = 507 Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 470 Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Length = 478 Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 455 Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Length = 482 Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Length = 491 Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Length = 520 Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Length = 369 Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 458 Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Length = 319 Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Length = 467 Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Length = 516 Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Length = 499 Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Length = 468 Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Length = 405 Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Length = 397 Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Length = 523 Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Length = 381 Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Length = 495 Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Length = 382 Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Length = 476 Back     alignment and structure
>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Length = 721 Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Length = 425 Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Length = 367 Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Length = 464 Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Length = 438 Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Length = 310 Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Length = 323 Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Length = 602 Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Length = 379 Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Length = 455 Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Length = 588 Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Length = 480 Back     alignment and structure
>1yqz_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.54A {Staphylococcus aureus} Length = 438 Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Length = 384 Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Length = 521 Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Length = 399 Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Length = 342 Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Length = 565 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query561
2gmh_A584 Electron transfer flavoprotein-ubiquinone oxidored 100.0
3oz2_A397 Digeranylgeranylglycerophospholipid reductase; str 100.0
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 100.0
3atr_A453 Conserved archaeal protein; saturating double bond 100.0
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 99.97
3e1t_A512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 99.97
2qa1_A500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 99.97
2qa2_A499 CABE, polyketide oxygenase CABE; FAD, angucycline, 99.97
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 99.97
3fmw_A570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 99.97
3i3l_A591 Alkylhalidase CMLS; flavin-dependent halogenase, c 99.97
1pn0_A665 Phenol 2-monooxygenase; two dimers, TLS refinement 99.97
4hb9_A412 Similarities with probable monooxygenase; flavin, 99.96
3ihg_A535 RDME; flavoenzyme, anthracycline, polyketide biosy 99.96
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 99.96
2dkh_A639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 99.96
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 99.96
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 99.96
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 99.96
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 99.95
2r0c_A549 REBC; flavin adenine dinucleotide, monooxygenase, 99.95
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 99.94
3c4a_A381 Probable tryptophan hydroxylase VIOD; alpha-beta p 99.93
2weu_A511 Tryptophan 5-halogenase; regioselectivity, antifun 99.92
2aqj_A538 Tryptophan halogenase, pRNA; flavin-dependent halo 99.92
2pyx_A526 Tryptophan halogenase; structural genomics, JOI fo 99.92
2e4g_A550 Tryptophan halogenase; flavin-binding, rebeccamyci 99.91
3ihm_A430 Styrene monooxygenase A; rossman fold, anti-parall 99.88
2bry_A497 NEDD9 interacting protein with calponin homology a 99.71
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 99.7
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 99.68
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 99.66
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 99.63
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 99.63
3ps9_A676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 99.6
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 99.59
3dme_A369 Conserved exported protein; structural genomics, P 99.59
3pvc_A689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 99.59
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 99.52
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 99.51
3axb_A448 Putative oxidoreductase; dinucleotide-binding fold 99.47
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 99.47
3da1_A561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 99.45
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 99.45
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 99.44
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 99.44
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 99.42
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 99.41
2ywl_A180 Thioredoxin reductase related protein; uncharacter 99.41
3nlc_A549 Uncharacterized protein VP0956; FAD-binding protei 99.4
4dgk_A501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 99.4
2qcu_A501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 99.4
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 99.39
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 99.39
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 99.38
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 99.37
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 99.35
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 99.35
2cul_A232 Glucose-inhibited division protein A-related PROT 99.33
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 99.32
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 99.32
2gqf_A401 Hypothetical protein HI0933; structural genomics, 99.32
3g3e_A351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 99.27
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 99.26
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 99.26
3ces_A 651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 99.25
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 99.24
3cp8_A 641 TRNA uridine 5-carboxymethylaminomethyl modificati 99.24
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 99.24
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 99.23
2zxi_A637 TRNA uridine 5-carboxymethylaminomethyl modificat 99.23
2wdq_A588 Succinate dehydrogenase flavoprotein subunit; succ 99.23
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 99.22
2rgh_A571 Alpha-glycerophosphate oxidase; flavoprotein oxida 99.22
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 99.21
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 99.21
1w4x_A542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 99.21
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 99.21
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 99.19
1kf6_A602 Fumarate reductase flavoprotein; respiration, fuma 99.18
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 99.16
2h88_A621 Succinate dehydrogenase flavoprotein subunit; comp 99.16
4fk1_A304 Putative thioredoxin reductase; structural genomic 99.15
2bs2_A660 Quinol-fumarate reductase flavoprotein subunit A; 99.14
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 99.14
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 99.13
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 99.11
1jnr_A643 Adenylylsulfate reductase; oxidoreductase; HET: FA 99.11
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 99.1
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 99.1
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 99.09
3fpz_A326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 99.08
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 99.07
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 99.07
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 99.07
2e5v_A472 L-aspartate oxidase; archaea, oxidoreductase; HET: 99.06
1chu_A540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 99.06
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 99.05
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 99.03
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 99.03
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 99.03
3gyx_A662 Adenylylsulfate reductase; oxidoreductase; HET: FA 99.03
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 99.0
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 98.99
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 98.98
2ivd_A478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 98.98
3lov_A475 Protoporphyrinogen oxidase; structural genomics, J 98.97
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 98.96
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 98.94
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 98.88
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 98.87
3r9u_A315 Thioredoxin reductase; structural genomics, center 98.87
1jb0_C80 Photosystem I iron-sulfur center; membrane protein 98.84
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 98.84
1ojt_A482 Surface protein; redox-active center, glycolysis, 98.82
4b63_A501 L-ornithine N5 monooxygenase; oxidoreductase, side 98.8
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 98.79
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 98.78
1bc6_A77 7-Fe ferredoxin; electron transport, iron-sulfur; 98.78
7fd1_A106 FD1, protein (7-Fe ferredoxin I); electron transpo 98.77
1xer_A103 Ferredoxin; electron transport, iron-sulfur, dupli 98.77
1h98_A78 Ferredoxin; electron transport, thermophilic, iron 98.76
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 98.75
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 98.75
3eun_A82 Ferredoxin; electron transport, [4Fe-4S] cluster, 98.75
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 98.74
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 98.74
2v2k_A105 Ferredoxin; iron, transport, iron-sulfur, mycobact 98.73
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 98.73
3p1w_A475 Rabgdi protein; GDI RAB, malaria, structural genom 98.73
2fdn_A55 Ferredoxin; electron transport, iron-sulfur, 4Fe-4 98.72
1dwl_A59 Ferredoxin I; electron transfer, model, heteronucl 98.72
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 98.7
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 98.7
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 98.68
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 98.68
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 98.67
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 98.67
2fgo_A82 Ferredoxin; allochromatium vinosum, [4Fe-4S] clust 98.66
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 98.66
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 98.66
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 98.65
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 98.64
3gyx_B166 Adenylylsulfate reductase; oxidoreductase; HET: FA 98.62
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 98.62
1jnr_B150 Adenylylsulfate reductase; oxidoreductase; HET: FA 98.62
4dna_A463 Probable glutathione reductase; structural genomic 98.62
1rgv_A80 Ferredoxin; electron transport; 2.90A {Thauera aro 98.62
3pl8_A623 Pyranose 2-oxidase; substrate complex, H167A mutan 98.6
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 98.59
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 98.59
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 98.58
4gde_A513 UDP-galactopyranose mutase; flavin adenine dinucle 98.58
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 98.58
3hyw_A430 Sulfide-quinone reductase; monotopic membrane prot 98.57
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 98.57
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 98.57
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 98.56
4gut_A776 Lysine-specific histone demethylase 1B; histone de 98.56
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 98.56
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 98.54
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 98.54
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 98.54
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 98.54
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 98.53
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 98.53
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 98.52
3i9v_9182 NADH-quinone oxidoreductase subunit 9; electron tr 98.52
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 98.52
1fec_A490 Trypanothione reductase; redox-active center, oxid 98.51
1dax_A64 Ferredoxin I; electron transport, electron-transfe 98.5
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 98.49
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 98.48
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 98.48
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 98.47
2zvs_A85 Uncharacterized ferredoxin-like protein YFHL; elec 98.47
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 98.47
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 98.47
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 98.45
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 98.45
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 98.45
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 98.44
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 98.44
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 98.43
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 98.42
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 98.42
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 98.42
1gte_A1025 Dihydropyrimidine dehydrogenase; electron transfer 98.42
3qvp_A583 Glucose oxidase; oxidoreductase; HET: NAG BMA MAN 98.42
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 98.41
1y56_A493 Hypothetical protein PH1363; dehydrogenase, protei 98.4
1f2g_A58 Ferredoxin II; electron transport, FDII desulfovib 98.4
3q9t_A577 Choline dehydrogenase and related flavoproteins; g 98.39
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 98.39
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 98.36
2vpz_B195 NRFC protein; oxidoreductase, molybdopterin guanin 98.36
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 98.35
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 98.35
3or1_B386 Sulfite reductase beta; dissimilatory sulfite redu 98.34
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 98.34
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 98.31
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 98.3
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 98.29
3vrd_B401 FCCB subunit, flavocytochrome C flavin subunit; su 98.29
3hdq_A397 UDP-galactopyranose mutase; substrate and inhibito 98.29
1rsg_A516 FMS1 protein; FAD binding motif, oxidoreductase; H 98.28
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 98.28
2b9w_A424 Putative aminooxidase; isomerase, conjugated linol 98.27
1rof_A60 Ferredoxin; electron transport, iron-sulfur; NMR { 98.26
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 98.26
2e1m_A376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 98.25
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 98.25
2yg5_A453 Putrescine oxidase; oxidoreductase, flavin; HET: F 98.25
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 98.25
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 98.23
1hfe_L 421 Protein (Fe-only hydrogenase (E.C.1.18.99.1) (larg 98.23
1s3e_A520 Amine oxidase [flavin-containing] B; human monoami 98.23
1iqz_A81 Ferredoxin; iron-sulfer protein, ultlahigh resolut 98.23
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 98.21
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 98.21
2jae_A489 L-amino acid oxidase; oxidoreductase, dimerisation 98.2
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 98.19
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 98.18
1sez_A504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 98.18
1v0j_A399 UDP-galactopyranose mutase; flavoprotein, isomeras 98.17
3mm5_B366 Sulfite reductase, dissimilatory-type subunit BET; 98.16
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 98.16
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 98.15
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 98.14
1i8t_A367 UDP-galactopyranose mutase; rossman fold, FAD, con 98.13
2ivf_B 352 Ethylbenzene dehydrogenase beta-subunit; anaerobic 98.12
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 98.12
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 98.12
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 98.11
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 98.11
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 98.1
1q16_B 512 Respiratory nitrate reductase 1 beta chain; membra 98.09
2bi7_A384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 98.09
1ti6_B 274 Pyrogallol hydroxytransferase small subunit; molyb 98.09
4dsg_A484 UDP-galactopyranose mutase; rossmann fold, flavin 98.07
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 98.06
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 98.05
1kqf_B 294 FDH-N beta S, formate dehydrogenase, nitrate-induc 98.05
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 98.05
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 98.03
2iid_A498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 98.02
1sj1_A66 Ferredoxin; thermostability, iron-sulfur cluster, 98.01
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 98.01
3fim_B566 ARYL-alcohol oxidase; AAO, lignin degradation, oxi 98.01
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 98.01
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 98.0
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 98.0
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 98.0
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 98.0
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 98.0
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 97.99
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 97.99
2c42_A 1231 Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron, 97.96
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 97.95
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 97.95
1ojt_A482 Surface protein; redox-active center, glycolysis, 97.93
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 97.93
4dna_A463 Probable glutathione reductase; structural genomic 97.92
1fec_A490 Trypanothione reductase; redox-active center, oxid 97.92
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 97.91
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 97.91
3mm5_A 418 Sulfite reductase, dissimilatory-type subunit ALP; 97.9
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 97.88
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 97.87
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 97.87
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 97.86
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 97.84
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 97.84
3g5s_A443 Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy 97.83
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 97.83
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 97.81
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 97.81
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 97.78
2z3y_A662 Lysine-specific histone demethylase 1; chromatin, 97.77
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 97.76
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 97.75
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 97.75
2xag_A852 Lysine-specific histone demethylase 1; amine oxida 97.74
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 97.74
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 97.73
3c8y_A 574 Iron hydrogenase 1; dithiomethylether, H-cluster, 97.7
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 97.7
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 97.69
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 97.67
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 97.67
1ti6_B 274 Pyrogallol hydroxytransferase small subunit; molyb 97.67
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 97.6
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 97.59
3r9u_A315 Thioredoxin reductase; structural genomics, center 97.58
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 97.58
1h0h_B214 Formate dehydrogenase (small subunit); tungsten se 97.57
1kdg_A546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 97.55
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 97.54
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 97.53
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 97.5
3t37_A526 Probable dehydrogenase; BET alpha beta fold, ADP b 97.5
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 97.5
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 97.49
3ayj_A 721 Pro-enzyme of L-phenylalanine oxidase; amino acid 97.48
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 97.46
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 97.45
2ivf_B 352 Ethylbenzene dehydrogenase beta-subunit; anaerobic 97.45
3or1_A 437 Sulfite reductase alpha; dissimilatory sulfite red 97.44
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 97.42
2vpz_B195 NRFC protein; oxidoreductase, molybdopterin guanin 97.38
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 97.37
1q16_B 512 Respiratory nitrate reductase 1 beta chain; membra 97.32
4fk1_A304 Putative thioredoxin reductase; structural genomic 97.32
1h0h_B214 Formate dehydrogenase (small subunit); tungsten se 97.28
1gpe_A587 Protein (glucose oxidase); oxidoreductase(flavopro 97.27
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 97.26
1n4w_A504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 97.26
2pa8_D265 DNA-directed RNA polymerase subunit D; ferredoxin- 97.24
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 97.22
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 97.2
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 97.2
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 97.2
3i9v_3 783 NADH-quinone oxidoreductase subunit 3; electron tr 97.17
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 97.17
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 97.15
1coy_A507 Cholesterol oxidase; oxidoreductase(oxygen recepto 97.15
1kqf_B294 FDH-N beta S, formate dehydrogenase, nitrate-induc 97.14
1vg0_A 650 RAB proteins geranylgeranyltransferase component A 97.02
1ju2_A536 HydroxynitrIle lyase; flavin, GMC oxidoreductase, 96.98
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 96.96
2jbv_A546 Choline oxidase; alcohol oxidation, flavoenyzme ox 96.94
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 96.86
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 96.82
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 96.76
3eun_A82 Ferredoxin; electron transport, [4Fe-4S] cluster, 96.55
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 96.54
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 96.47
1dax_A64 Ferredoxin I; electron transport, electron-transfe 96.43
1dwl_A59 Ferredoxin I; electron transfer, model, heteronucl 96.4
1iqz_A81 Ferredoxin; iron-sulfer protein, ultlahigh resolut 96.28
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 96.27
2zvs_A85 Uncharacterized ferredoxin-like protein YFHL; elec 96.25
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 96.18
2fgo_A82 Ferredoxin; allochromatium vinosum, [4Fe-4S] clust 96.18
1xer_A103 Ferredoxin; electron transport, iron-sulfur, dupli 96.17
2fdn_A55 Ferredoxin; electron transport, iron-sulfur, 4Fe-4 96.14
1rgv_A80 Ferredoxin; electron transport; 2.90A {Thauera aro 96.12
1sj1_A66 Ferredoxin; thermostability, iron-sulfur cluster, 96.11
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 96.1
1jb0_C80 Photosystem I iron-sulfur center; membrane protein 96.08
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 96.03
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 96.02
3vrd_B401 FCCB subunit, flavocytochrome C flavin subunit; su 95.93
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 95.86
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 95.77
4b63_A501 L-ornithine N5 monooxygenase; oxidoreductase, side 95.62
1id1_A153 Putative potassium channel protein; RCK domain, E. 95.6
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 95.49
1rof_A60 Ferredoxin; electron transport, iron-sulfur; NMR { 95.39
1bc6_A77 7-Fe ferredoxin; electron transport, iron-sulfur; 95.34
1f2g_A58 Ferredoxin II; electron transport, FDII desulfovib 95.23
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 95.09
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 95.07
1lss_A140 TRK system potassium uptake protein TRKA homolog; 94.84
1h98_A78 Ferredoxin; electron transport, thermophilic, iron 94.79
7fd1_A106 FD1, protein (7-Fe ferredoxin I); electron transpo 94.65
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 94.64
3i9v_9182 NADH-quinone oxidoreductase subunit 9; electron tr 94.6
2wdq_B238 Succinate dehydrogenase iron-sulfur subunit; succi 94.13
2c42_A 1231 Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron, 93.85
2v2k_A105 Ferredoxin; iron, transport, iron-sulfur, mycobact 93.8
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 93.77
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 93.64
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 93.57
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 93.32
1hfe_L 421 Protein (Fe-only hydrogenase (E.C.1.18.99.1) (larg 93.2
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 93.18
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 93.13
3ado_A319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 93.06
2x5o_A439 UDP-N-acetylmuramoylalanine--D-glutamate ligase; A 92.98
1kf6_B243 Fumarate reductase iron-sulfur protein; respiratio 92.9
3hn2_A312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 92.9
3qha_A296 Putative oxidoreductase; seattle structural genomi 92.77
3lk7_A451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 92.76
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 92.5
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 92.46
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 92.42
3gg2_A450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 92.38
3g17_A294 Similar to 2-dehydropantoate 2-reductase; structur 92.35
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 92.32
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 92.31
3k96_A356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 92.29
2h88_B252 Succinate dehydrogenase IP subunit; complex II, me 92.13
3vtf_A444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 92.01
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 91.9
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 91.88
3hyw_A430 Sulfide-quinone reductase; monotopic membrane prot 91.88
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 91.87
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 91.85
4g65_A461 TRK system potassium uptake protein TRKA; structur 91.67
1ks9_A291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 91.64
1z82_A335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 91.64
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 91.58
1kyq_A274 Met8P, siroheme biosynthesis protein Met8; homodim 91.57
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 91.54
3cf4_A 807 Acetyl-COA decarboxylase/synthase alpha subunit; m 91.49
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 91.45
3l9w_A413 Glutathione-regulated potassium-efflux system Pro 91.35
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 91.33
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 91.32
1ur5_A309 Malate dehydrogenase; oxidoreductase, tricarboxyli 91.28
3ego_A307 Probable 2-dehydropantoate 2-reductase; structural 91.24
3ghy_A335 Ketopantoate reductase protein; oxidoreductase, NA 91.24
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 91.24
4a7p_A446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 91.02
3k6j_A460 Protein F01G10.3, confirmed by transcript evidenc; 90.94
2y0c_A478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 90.81
1evy_A366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 90.76
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 90.68
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 90.67
3c85_A183 Putative glutathione-regulated potassium-efflux S 90.67
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 90.61
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 90.57
1bg6_A359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 90.56
1zej_A293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 90.53
4ezb_A317 Uncharacterized conserved protein; structural geno 90.5
3tl2_A315 Malate dehydrogenase; center for structural genomi 90.49
3l6d_A306 Putative oxidoreductase; structural genomics, prot 90.46
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 90.34
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 90.3
1y6j_A318 L-lactate dehydrogenase; southeast collaboratory f 90.23
2a9f_A398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 90.14
2p4q_A497 6-phosphogluconate dehydrogenase, decarboxylating; 90.04
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 89.71
3pid_A432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 89.57
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 89.46
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 89.45
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 89.43
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 89.39
1vpd_A299 Tartronate semialdehyde reductase; structural geno 89.39
1guz_A310 Malate dehydrogenase; oxidoreductase, tricarboxyli 89.34
1zcj_A463 Peroxisomal bifunctional enzyme; peroxisomal multi 89.33
2bs2_B241 Quinol-fumarate reductase iron-sulfur subunit B; 2 89.24
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 89.21
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 89.2
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 89.18
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 89.14
3pqe_A326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 89.14
1vg0_A650 RAB proteins geranylgeranyltransferase component A 89.1
2rcy_A262 Pyrroline carboxylate reductase; malaria, structur 88.9
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 88.61
4gbj_A297 6-phosphogluconate dehydrogenase NAD-binding; stru 88.57
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 88.55
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 88.5
1yj8_A375 Glycerol-3-phosphate dehydrogenase; SGPP, structur 88.44
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 88.39
3p7m_A321 Malate dehydrogenase; putative dehydrogenase, enzy 88.38
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 88.33
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 88.27
3hwr_A318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 88.26
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 88.15
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 88.14
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 88.13
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 88.04
2izz_A322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 88.04
1txg_A335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 88.02
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 88.0
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 87.89
3c7a_A404 Octopine dehydrogenase; L) stereospecific opine de 87.89
3d1l_A266 Putative NADP oxidoreductase BF3122; structural ge 87.81
1mv8_A436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 87.75
2pv7_A298 T-protein [includes: chorismate mutase (EC 5.4.99 87.65
2z3y_A662 Lysine-specific histone demethylase 1; chromatin, 87.6
3mog_A483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 87.57
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 87.56
1x0v_A354 GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase 87.48
3ldh_A330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 87.43
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 87.38
2r6j_A318 Eugenol synthase 1; phenylpropene, PIP reductase, 87.28
1a5z_A319 L-lactate dehydrogenase; oxidoreductase, glycolysi 87.23
3d0o_A317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 87.23
1oju_A294 MDH, malate dehydrogenase; hyperthermophilic, oxid 87.22
1n7h_A381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 87.21
2zyd_A480 6-phosphogluconate dehydrogenase, decarboxylating; 86.99
3qsg_A312 NAD-binding phosphogluconate dehydrogenase-like P; 86.95
3ius_A286 Uncharacterized conserved protein; APC63810, silic 86.94
3nep_X314 Malate dehydrogenase; halophIle, molecular adpatat 86.86
4e21_A358 6-phosphogluconate dehydrogenase (decarboxylating; 86.63
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 86.61
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 86.59
4gwg_A484 6-phosphogluconate dehydrogenase, decarboxylating; 86.23
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 86.14
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 86.11
3vku_A326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 86.01
3tri_A280 Pyrroline-5-carboxylate reductase; amino acid bios 85.88
1yqg_A263 Pyrroline-5-carboxylate reductase; structural geno 85.88
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 85.85
3ktd_A341 Prephenate dehydrogenase; structural genomics, joi 85.85
1ldn_A316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 85.8
4aj2_A331 L-lactate dehydrogenase A chain; oxidoreductase-in 85.78
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
Probab=100.00  E-value=1.1e-89  Score=740.11  Aligned_cols=544  Identities=52%  Similarity=0.966  Sum_probs=468.8

Q ss_pred             CCCCCCcccEEEECchhHHHHHHHHHHhccccCCCCCcEEEEcCCCCCCCceeecceeChhhHHhhccccc-cCCccccc
Q psy14496         16 GPRESIEYDVIIVGGGPSGLSAAIRLKQLAIKKNKEIKICVLEKGSELGAHILSGAIIDPRSIFELFPKEK-LNKLFNTP   94 (561)
Q Consensus        16 ~~~~~~~~dVvIVGaGpAGLa~A~~La~~~~~~~~G~~V~ViEk~~~~g~~~~~G~~~~~~~l~~l~~~~~-~~~~~~~~   94 (561)
                      +++++|++||+|||||||||++|+.|++...+.+||++|+||||.+.++.+..+|..+.+++++.+++.|. .+.++...
T Consensus        29 ~~~~~~~~DVvIVGaG~aGlaaA~~La~~~~~~~~G~~V~vlEk~~~~g~~~~~g~~l~~~~l~~ll~~~~~~g~~~~~~  108 (584)
T 2gmh_A           29 MERFAEEADVVIVGAGPAGLSAATRLKQLAAQHEKDLRVCLVEKAAHIGAHTLSGACLDPRAFEELFPDWKEKGAPLNTP  108 (584)
T ss_dssp             CCCCEEECSEEEECCSHHHHHHHHHHHHHHHHTTCCCCEEEECSSSSTTTTCCCCCEECTHHHHHHCTTHHHHTCCCCEE
T ss_pred             ccccccCCCEEEECcCHHHHHHHHHHHhcccccCCCCcEEEEeCCCCCCCccccccccCHHHHHHHHHHHHhcCCceeee
Confidence            46777889999999999999999999987555566999999999999888777888999999999988876 44555444


Q ss_pred             cchhhhhhhcCCCCcccCCCCCCc-eeecCCcEEeeHHHHHHHHHHHHHHCCCEEEcCceEeEEEEcCCCCEEEEEeccc
Q psy14496         95 VIEERFLFLSSKKSYKIPSWILPI-CFKNHGNYIISLSDLVRWMGKKAENMGIDIFSGFSASEILYDSKNNVCGIATNNF  173 (561)
Q Consensus        95 ~~~~~~~~~~~~~~~~~~~~~~p~-~~~~~~~~~i~r~~l~~~L~~~a~~~gv~i~~g~~v~~i~~~~~g~v~~V~~~~~  173 (561)
                      +..+.+.++.....+.++  ..|. .+.+.+.+.++|..|.++|.+++++.|++|+++++|+++..++++.+++|.+.+.
T Consensus       109 ~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~v~r~~l~~~L~~~a~~~Gv~i~~g~~v~~l~~~~~g~V~gV~~~~~  186 (584)
T 2gmh_A          109 VTEDRFGILTEKYRIPVP--ILPGLPMNNHGNYVVRLGHLVSWMGEQAEALGVEVYPGYAAAEILFHEDGSVKGIATNDV  186 (584)
T ss_dssp             CCEEEEEEECSSCEEECC--CCTTSTTCCTTCEECCHHHHHHHHHHHHHHTTCEEETTCCEEEEEECTTSSEEEEEECCE
T ss_pred             echhheeeeccCCCcccc--ccCccccccCCCEEEeHHHHHHHHHHHHHHcCCEEEcCCEEEEEEEcCCCCEEEEEeCCc
Confidence            444445555544333333  1122 2334558899999999999999999999999999999999876678889999877


Q ss_pred             ccccCCceecccccCeEEecCEEEEccCCCchhhHHHHHHcCCCCCCCCccccceeEEEEeeCCCccCCCcEEEEeccCC
Q psy14496        174 GINKEGIIKKNFQLGMELYAKYTLFAEGSRGHLSKQIIKKFNLDNKKDPQTYSLGIKELWTINPKLHKKGLVIHTIGWPL  253 (561)
Q Consensus       174 ~~~~~g~~~~~f~~g~~i~ad~vV~AdG~~s~~~~~l~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~  253 (561)
                      +.+++|+.+.+|++|.+++||+||+|||.+|.+++++..++++.....+..++++++.+|.++.....++...|.++||+
T Consensus       187 g~~~~G~~~~~~~~g~~i~Ad~VV~AdG~~S~vr~~l~~~~gl~~~~~p~~~g~g~~~~~~v~~~~~~~~~~~~~~g~~~  266 (584)
T 2gmh_A          187 GIQKDGAPKTTFERGLELHAKVTIFAEGCHGHLAKQLYKKFDLRANCEPQTYGIGLKELWVIDEKKWKPGRVDHTVGWPL  266 (584)
T ss_dssp             EECTTSCEEEEEECCCEEECSEEEECCCTTCHHHHHHHHHTTTTTTSCCCCEEEEEEEEEECCGGGCCTTEEEEEEETTS
T ss_pred             cccCCCCcccccCCceEEECCEEEEeeCCCchHHHHHHHHhCCCCCCCchhHHhhhhhheecCcccccCCeEEEEEeccc
Confidence            76778988889999999999999999999999999998888887766677778888888877766566777789999988


Q ss_pred             CCCCCceEEEEEcC--CCeEEEEEEecCCCCCCCCChHHHHHHhhhChhHHHhhcCCeeeeecceeeccCCCccCCeeec
Q psy14496        254 DYKTYGGGFLYHME--NNQISIGYIISLDYKNPYLSPFEEFQRYKTHPKICKILKGGKRISYGARTITTGGLQSLPEFIF  331 (561)
Q Consensus       254 ~~~~~g~~~~~~~~--~~~~~ig~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~  331 (561)
                      .....++.|+||..  ++.+++++....+..++..++.+.++.|+.+|.+.++++.++.+.++.+.++..++...++|..
T Consensus       267 ~~~~~gg~~~~~~~~~~~~~~vg~~~~~~~~~~~~~~~~~l~~~~~~p~i~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~  346 (584)
T 2gmh_A          267 DRHTYGGSFLYHLNEGEPLLALGFVVGLDYQNPYLSPFREFQRWKHHPSIKPTLEGGKRIAYGARALNEGGFQSIPKLTF  346 (584)
T ss_dssp             CTTSCEEEEEEECCSSSCEEEEEEEEETTCCCTTCCHHHHHHHHTTSTTTHHHHTTCEEEEEEEEEEECCGGGGCCCCEE
T ss_pred             cCCcCCceEEEEecCCCCeEEEEEEEecCcccccCChHHHHHHHHhChHHHHHhCCCeEEEecceEccCCCcccCCcccc
Confidence            75667788999987  7899999988776656666677889998888999999998888888877777777777889999


Q ss_pred             CCEEEEecCCccCCCcccccchHHHHHHHHHHHHHHHHHhcCC--Cccc---hhhHHHHHhhchhhHhhhhhhccchhhh
Q psy14496        332 DGGAFIGCNAGFMNVSRIKGIHTSIKSGILVADSIFKKICSNN--KFNK---LITYKTSFQASWLYKELYKARNFKPAMK  406 (561)
Q Consensus       332 ~~v~lvGDAa~~~~P~~g~G~~~Ai~~a~~lA~~l~~~l~~~~--~~~~---l~~y~~~~~~~~~~~~~~~~~~~~~~~~  406 (561)
                      +|++|+|||||+++|+.|+|+++||+||.+||+.|...+..++  ...+   |+.|+++++++|+.++++.+++++++|+
T Consensus       347 ~rv~LvGDAAh~~~P~~GqG~~~Ai~da~~LA~~L~~~~~~g~~~~~~a~~~L~~Ye~~r~~~~v~~~l~~~r~~~~~~~  426 (584)
T 2gmh_A          347 PGGLLIGCSPGFMNVPKIKGTHTAMKSGTLAAESIFNQLTSENLQSKTIGLHVTEYEDNLKNSWVWKELYSVRNIRPSCH  426 (584)
T ss_dssp             TTEEECTTTTCCCBTTTTBCHHHHHHHHHHHHHHHHHHHTCCCCCCSSSSCCCTHHHHHHHTSHHHHHHHHTTTTTGGGG
T ss_pred             CCEEEEcccccccCccccccHHHHHHHHHHHHHHHHHHHHcCCcchhhhhhhHHHHHHHHHHhHHHHHHHHHhChhHHHH
Confidence            9999999999999999999999999999999999999886553  3333   8999999999999999999999999884


Q ss_pred             -h-hhhHHHHHHHHHHHHhcCCCCccccCCCCccCCcccccCCCCCCCCCCCCccccccccceeccccccCCCCCCceEE
Q psy14496        407 -K-GLYIGMLIIGIDQILFSGKFPFTLHNINSDYTYLEPASKHIPIKYPNPDNKLTFDKLSSIYVSNINHDEDQPIHLIL  484 (561)
Q Consensus       407 -~-g~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~fd~~~~~~~~~~~~~~~~~~h~~~  484 (561)
                       + |.|.+++..++..|+.+|+.||+++|..+|+.+++++.+..+++||+||++|+||+++|||+|+++|+||||+||+|
T Consensus       427 ~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~hl~~  506 (584)
T 2gmh_A          427 GILGVYGGMIYTGIFYWIFRGMEPWTLKHKGSDSDQLKPAKDCTPIEYPKPDGQISFDLLSSVALSGTNHEHDQPAHLTL  506 (584)
T ss_dssp             STTTHHHHHHHHHHHTTTTTTCCSCCCCCCSCGGGCCCCGGGSCCCCCCCCCSSSSCCHHHHHHTTTCBCCSSSCCSEEE
T ss_pred             HhhccHHHHHHHHHHHHHcCCCCCCccCCCCCCchhhhhHHhcCCCCCCCccccccccccchhhhccccccCCCCCeEEE
Confidence             4 99999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCCCcccccccccccccccccCCeeEEEEeecCc-eeEEEEccCCCccCCcccccCCCCCeeEECCCCCCCCCCCCC
Q psy14496        485 KNKKIPIHINFSIYAGPEARYCPAGVYEFIIEKNK-IQHLQINAQNCIHCKTCDIKDPTQNIEWITPEGGSGTNYPNM  561 (561)
Q Consensus       485 ~~~~~c~~~~~~~~~~~c~~~CP~~~~~~~~~~~~-~~~~~~~~~~C~~Cg~C~~~cp~~~i~~~~p~g~~g~~~~~~  561 (561)
                      +|.++|...|...|+++|+++||++||++++++++ ..++++|+++|||||||+++||++||+|++|+||+||+|++|
T Consensus       507 ~d~~~~~~~~~~~~~~~c~~~CPa~~~~~~~~~~~~~~~~~i~~~~Ci~C~~C~~~cp~~~i~~~~p~gg~g~~~~~~  584 (584)
T 2gmh_A          507 KDDSVPVNRNLSIYDGPEQRFCPAGVYEFVPLEQGDGFRLQINAQNCVHCKTCDIKDPSQNINWVVPEGGGGPAYNGM  584 (584)
T ss_dssp             SSTTHHHHTHHHHHCCTHHHHCTTCCEEEEECSSTTCEEEEECGGGCCCCCHHHHHCTTCCEEECCCSTTCBCCCSCC
T ss_pred             cCcccchhhchhhhcchhhhcCChhhEEEeecCCCCceEEEEeCCCCcCCCCchhhCCCCCceeECCCCCCCcCccCC
Confidence            99999988888888999999999999999543222 227999999999999999999999999999999999999998
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae} Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>1jb0_C Photosystem I iron-sulfur center; membrane protein, multiprotein-pigment complex, photosynthes; HET: CL1 PQN BCR LHG LMG; 2.50A {Synechococcus elongatus} SCOP: d.58.1.2 PDB: 3pcq_C* 1k0t_A 2wsc_C* 2wse_C* 2wsf_C* 3lw5_C* 2o01_C* Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>1bc6_A 7-Fe ferredoxin; electron transport, iron-sulfur; NMR {Bacillus schlegelii} SCOP: d.58.1.2 PDB: 1bd6_A 1bqx_A 1bwe_A Back     alignment and structure
>7fd1_A FD1, protein (7-Fe ferredoxin I); electron transport, iron-sulfur; 1.30A {Azotobacter vinelandii} SCOP: d.58.1.2 PDB: 1fda_A 1fdb_A 1fer_A 1axq_A 5fd1_A 6fdr_A 6fd1_A 7fdr_A 1frh_A 1fri_A 1fdd_A 1frl_A 1d3w_A 1frm_A 1frx_A 1g6b_A 1pc4_A 1frj_A 2fd2_A 1fd2_A ... Back     alignment and structure
>1xer_A Ferredoxin; electron transport, iron-sulfur, duplication; 2.00A {Sulfolobus tokodaii str} SCOP: d.58.1.3 PDB: 2vkr_A Back     alignment and structure
>1h98_A Ferredoxin; electron transport, thermophilic, iron-sulfur, azotobacter, hydrogen bonds, stability, high resolution; 1.64A {Thermus aquaticus} SCOP: d.58.1.2 Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3eun_A Ferredoxin; electron transport, [4Fe-4S] cluster, 4Fe-4S, iron, iron-sulfur, metal-binding, transport; 1.05A {Allochromatium vinosum} SCOP: d.58.1.1 PDB: 1blu_A 3exy_A Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>2v2k_A Ferredoxin; iron, transport, iron-sulfur, mycobacterium tuberculosis, Fe cluster, metal-binding, electron transfer, transport; 1.6A {Mycobacterium smegmatis} Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>2fdn_A Ferredoxin; electron transport, iron-sulfur, 4Fe-4S; 0.94A {Clostridium acidurici} SCOP: d.58.1.1 PDB: 1fdn_A 1fca_A 1clf_A 1dur_A Back     alignment and structure
>1dwl_A Ferredoxin I; electron transfer, model, heteronuclear docking; HET: HEC; NMR {Desulfomicrobium norvegicum} SCOP: i.4.1.1 Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>2fgo_A Ferredoxin; allochromatium vinosum, [4Fe-4S] cluster, reduction potential, iron binding protein electron transport; 1.32A {Pseudomonas aeruginosa} Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>3gyx_B Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>1jnr_B Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: d.58.1.5 PDB: 1jnz_B* 2fja_B* 2fjb_B* 2fjd_B* 2fje_B* Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>1rgv_A Ferredoxin; electron transport; 2.90A {Thauera aromatica} SCOP: d.58.1.1 Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>3i9v_9 NADH-quinone oxidoreductase subunit 9; electron transport, respiratory chain, cell flavoprotein, FMN, iron, iron-sulfur, membrane; HET: FMN; 3.10A {Thermus thermophilus} PDB: 2ybb_8* 2fug_9* 3iam_9* 3ias_9* 3m9s_9* Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>1dax_A Ferredoxin I; electron transport, electron-transfer protein, 4Fe-4S cluster; NMR {Desulfovibrio africanus} SCOP: d.58.1.4 PDB: 1dfd_A 1fxr_A Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>2zvs_A Uncharacterized ferredoxin-like protein YFHL; electron transport, [4Fe-4S] clusters, iron-SULF clusters, reduction potential; 1.65A {Escherichia coli} Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>1f2g_A Ferredoxin II; electron transport, FDII desulfovibrio gigas; NMR {Desulfovibrio gigas} SCOP: d.58.1.4 PDB: 1fxd_A Back     alignment and structure
>3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>2vpz_B NRFC protein; oxidoreductase, molybdopterin guanine dinucleotide, iron-sulfur, metal-binding, molybdopterin; HET: MGD; 2.40A {Thermus thermophilus} PDB: 2vpx_B* 2vpw_B* 2vpy_B* Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>3or1_B Sulfite reductase beta; dissimilatory sulfite reductase, sulfate reduction, oxidored sulfite reduction; HET: SRM; 1.76A {Desulfovibrio gigas} PDB: 3or2_B* 2v4j_B* 2xsj_B* Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>1rof_A Ferredoxin; electron transport, iron-sulfur; NMR {Thermotoga maritima} SCOP: d.58.1.4 PDB: 1vjw_A Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>1hfe_L Protein (Fe-only hydrogenase (E.C.1.18.99.1) (larger subunit)); hydrogene metabolism, periplasm; 1.60A {Desulfovibrio vulgaris subsp} SCOP: c.96.1.1 d.58.1.5 PDB: 1e08_A* 1gx7_A* Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>1iqz_A Ferredoxin; iron-sulfer protein, ultlahigh resolution analysis, geometry of [4Fe-4S] cluster, electron transport; 0.92A {Bacillus thermoproteolyticus} SCOP: d.58.1.4 PDB: 1ir0_A 1wtf_A* Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Back     alignment and structure
>3mm5_B Sulfite reductase, dissimilatory-type subunit BET; alpha-beta-protein, oxidoreductase; HET: SRM; 1.80A {Archaeoglobus fulgidus} PDB: 3c7b_B* 3mm6_B* 3mm7_B* 3mm8_B* 3mm9_B* 3mma_B* 3mmb_B* 3mmc_B* Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Back     alignment and structure
>2ivf_B Ethylbenzene dehydrogenase beta-subunit; anaerobic hydrocarbon degradation, MOCO, Fe/S cluster, MO- B enzyme, DMSO reductase family; HET: MES MGD MD1 HEM; 1.88A {Aromatoleum aromaticum} Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>1q16_B Respiratory nitrate reductase 1 beta chain; membrane protein, electron-transfer, oxidoreductase; HET: FME MD1 HEM AGA 3PH; 1.90A {Escherichia coli} SCOP: d.58.1.5 PDB: 1r27_B* 1siw_B* 1y5i_B* 1y5l_B* 1y5n_B* 3ir5_B* 3ir6_B* 3ir7_B* 1y4z_B* 3egw_B* Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>1ti6_B Pyrogallol hydroxytransferase small subunit; molybdenum binding enzyme, MGD-cofactors, DMSO-reductase family, 4Fe-4S-cluster; HET: MGD BTT; 2.00A {Pelobacter acidigallici} SCOP: b.3.5.1 d.58.1.5 PDB: 1ti2_B* 1ti4_B* 1vld_N* 1vle_N* 1vlf_N* Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>1kqf_B FDH-N beta S, formate dehydrogenase, nitrate-inducible, iron-SU subunit; oxidoreductase, selenium, selenocysteine, seCys, molybdenum; HET: MGD HEM CDL; 1.60A {Escherichia coli} SCOP: d.58.1.5 f.23.22.1 PDB: 1kqg_B* Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>1sj1_A Ferredoxin; thermostability, iron-sulfur cluster, hexammine cobalt(III), electron transport; HET: NCO; 1.50A {Pyrococcus furiosus} SCOP: d.58.1.4 PDB: 1siz_A* 2z8q_A 3pni_A Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>2c42_A Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron, iron-sulfur, iron-sulfur cluster, pyruvate catabolism, TPP-dependent enzyme; HET: TPP; 1.78A {Desulfovibrio africanus} SCOP: c.36.1.8 c.36.1.12 c.48.1.3 c.64.1.1 d.58.1.5 PDB: 1b0p_A* 1kek_A* 2c3o_A* 2c3p_A* 2c3u_A* 2c3y_A* 2c3m_A* 2pda_A* 2uza_A* Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>3mm5_A Sulfite reductase, dissimilatory-type subunit ALP; alpha-beta-protein, oxidoreductase; HET: SRM; 1.80A {Archaeoglobus fulgidus} PDB: 3mm6_A* 3mm7_A* 3mm8_A* 3mm9_A* 3mma_A* 3mmb_A* 3mmc_A* 3c7b_A* Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>3c8y_A Iron hydrogenase 1; dithiomethylether, H-cluster, iron-sulfur binding, oxidoreductase; HET: HCN; 1.39A {Clostridium pasteurianum} SCOP: c.96.1.1 d.15.4.2 d.58.1.5 PDB: 1c4c_A* 1c4a_A* 1feh_A* Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>1ti6_B Pyrogallol hydroxytransferase small subunit; molybdenum binding enzyme, MGD-cofactors, DMSO-reductase family, 4Fe-4S-cluster; HET: MGD BTT; 2.00A {Pelobacter acidigallici} SCOP: b.3.5.1 d.58.1.5 PDB: 1ti2_B* 1ti4_B* 1vld_N* 1vle_N* 1vlf_N* Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>1h0h_B Formate dehydrogenase (small subunit); tungsten selenium formate dehydrogenase, selenocysteine, molybdopterin, MGD, iron-sulphur cluster; HET: 2MD MGD EPE; 1.8A {Desulfovibrio gigas} SCOP: d.58.1.5 Back     alignment and structure
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>2ivf_B Ethylbenzene dehydrogenase beta-subunit; anaerobic hydrocarbon degradation, MOCO, Fe/S cluster, MO- B enzyme, DMSO reductase family; HET: MES MGD MD1 HEM; 1.88A {Aromatoleum aromaticum} Back     alignment and structure
>3or1_A Sulfite reductase alpha; dissimilatory sulfite reductase, sulfate reduction, oxidored sulfite reduction; HET: SRM; 1.76A {Desulfovibrio gigas} PDB: 3or2_A* 2v4j_A* 2xsj_A* Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>2vpz_B NRFC protein; oxidoreductase, molybdopterin guanine dinucleotide, iron-sulfur, metal-binding, molybdopterin; HET: MGD; 2.40A {Thermus thermophilus} PDB: 2vpx_B* 2vpw_B* 2vpy_B* Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>1q16_B Respiratory nitrate reductase 1 beta chain; membrane protein, electron-transfer, oxidoreductase; HET: FME MD1 HEM AGA 3PH; 1.90A {Escherichia coli} SCOP: d.58.1.5 PDB: 1r27_B* 1siw_B* 1y5i_B* 1y5l_B* 1y5n_B* 3ir5_B* 3ir6_B* 3ir7_B* 1y4z_B* 3egw_B* Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>1h0h_B Formate dehydrogenase (small subunit); tungsten selenium formate dehydrogenase, selenocysteine, molybdopterin, MGD, iron-sulphur cluster; HET: 2MD MGD EPE; 1.8A {Desulfovibrio gigas} SCOP: d.58.1.5 Back     alignment and structure
>1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Back     alignment and structure
>2pa8_D DNA-directed RNA polymerase subunit D; ferredoxin-like Fe-S binding motif, platform for RNA polymer assembly, transferase; 1.76A {Sulfolobus solfataricus} PDB: 2pmz_D 3hkz_D 2waq_D 2wb1_D 2y0s_D Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3i9v_3 NADH-quinone oxidoreductase subunit 3; electron transport, respiratory chain, cell flavoprotein, FMN, iron, iron-sulfur, membrane; HET: FMN; 3.10A {Thermus thermophilus} PDB: 2ybb_3* 2fug_3* 3iam_3* 3ias_3* 3m9s_3* Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Back     alignment and structure
>1kqf_B FDH-N beta S, formate dehydrogenase, nitrate-inducible, iron-SU subunit; oxidoreductase, selenium, selenocysteine, seCys, molybdenum; HET: MGD HEM CDL; 1.60A {Escherichia coli} SCOP: d.58.1.5 f.23.22.1 PDB: 1kqg_B* Back     alignment and structure
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Back     alignment and structure
>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>3eun_A Ferredoxin; electron transport, [4Fe-4S] cluster, 4Fe-4S, iron, iron-sulfur, metal-binding, transport; 1.05A {Allochromatium vinosum} SCOP: d.58.1.1 PDB: 1blu_A 3exy_A Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>1dax_A Ferredoxin I; electron transport, electron-transfer protein, 4Fe-4S cluster; NMR {Desulfovibrio africanus} SCOP: d.58.1.4 PDB: 1dfd_A 1fxr_A Back     alignment and structure
>1dwl_A Ferredoxin I; electron transfer, model, heteronuclear docking; HET: HEC; NMR {Desulfomicrobium norvegicum} SCOP: i.4.1.1 Back     alignment and structure
>1iqz_A Ferredoxin; iron-sulfer protein, ultlahigh resolution analysis, geometry of [4Fe-4S] cluster, electron transport; 0.92A {Bacillus thermoproteolyticus} SCOP: d.58.1.4 PDB: 1ir0_A 1wtf_A* Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>2zvs_A Uncharacterized ferredoxin-like protein YFHL; electron transport, [4Fe-4S] clusters, iron-SULF clusters, reduction potential; 1.65A {Escherichia coli} Back     alignment and structure
>2fgo_A Ferredoxin; allochromatium vinosum, [4Fe-4S] cluster, reduction potential, iron binding protein electron transport; 1.32A {Pseudomonas aeruginosa} Back     alignment and structure
>1xer_A Ferredoxin; electron transport, iron-sulfur, duplication; 2.00A {Sulfolobus tokodaii str} SCOP: d.58.1.3 PDB: 2vkr_A Back     alignment and structure
>2fdn_A Ferredoxin; electron transport, iron-sulfur, 4Fe-4S; 0.94A {Clostridium acidurici} SCOP: d.58.1.1 PDB: 1fdn_A 1fca_A 1clf_A 1dur_A Back     alignment and structure
>1rgv_A Ferredoxin; electron transport; 2.90A {Thauera aromatica} SCOP: d.58.1.1 Back     alignment and structure
>1sj1_A Ferredoxin; thermostability, iron-sulfur cluster, hexammine cobalt(III), electron transport; HET: NCO; 1.50A {Pyrococcus furiosus} SCOP: d.58.1.4 PDB: 1siz_A* 2z8q_A 3pni_A Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>1jb0_C Photosystem I iron-sulfur center; membrane protein, multiprotein-pigment complex, photosynthes; HET: CL1 PQN BCR LHG LMG; 2.50A {Synechococcus elongatus} SCOP: d.58.1.2 PDB: 3pcq_C* 1k0t_A 2wsc_C* 2wse_C* 2wsf_C* 3lw5_C* 2o01_C* Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>1rof_A Ferredoxin; electron transport, iron-sulfur; NMR {Thermotoga maritima} SCOP: d.58.1.4 PDB: 1vjw_A Back     alignment and structure
>1bc6_A 7-Fe ferredoxin; electron transport, iron-sulfur; NMR {Bacillus schlegelii} SCOP: d.58.1.2 PDB: 1bd6_A 1bqx_A 1bwe_A Back     alignment and structure
>1f2g_A Ferredoxin II; electron transport, FDII desulfovibrio gigas; NMR {Desulfovibrio gigas} SCOP: d.58.1.4 PDB: 1fxd_A Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>1h98_A Ferredoxin; electron transport, thermophilic, iron-sulfur, azotobacter, hydrogen bonds, stability, high resolution; 1.64A {Thermus aquaticus} SCOP: d.58.1.2 Back     alignment and structure
>7fd1_A FD1, protein (7-Fe ferredoxin I); electron transport, iron-sulfur; 1.30A {Azotobacter vinelandii} SCOP: d.58.1.2 PDB: 1fda_A 1fdb_A 1fer_A 1axq_A 5fd1_A 6fdr_A 6fd1_A 7fdr_A 1frh_A 1fri_A 1fdd_A 1frl_A 1d3w_A 1frm_A 1frx_A 1g6b_A 1pc4_A 1frj_A 2fd2_A 1fd2_A ... Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3i9v_9 NADH-quinone oxidoreductase subunit 9; electron transport, respiratory chain, cell flavoprotein, FMN, iron, iron-sulfur, membrane; HET: FMN; 3.10A {Thermus thermophilus} PDB: 2ybb_8* 2fug_9* 3iam_9* 3ias_9* 3m9s_9* Back     alignment and structure
>2wdq_B Succinate dehydrogenase iron-sulfur subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_B* 2acz_B* 1nek_B* 2wdr_B* 2wdv_B* 2ws3_B* 2wu2_B* 2wu5_B* 2wp9_B* Back     alignment and structure
>2c42_A Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron, iron-sulfur, iron-sulfur cluster, pyruvate catabolism, TPP-dependent enzyme; HET: TPP; 1.78A {Desulfovibrio africanus} SCOP: c.36.1.8 c.36.1.12 c.48.1.3 c.64.1.1 d.58.1.5 PDB: 1b0p_A* 1kek_A* 2c3o_A* 2c3p_A* 2c3u_A* 2c3y_A* 2c3m_A* 2pda_A* 2uza_A* Back     alignment and structure
>2v2k_A Ferredoxin; iron, transport, iron-sulfur, mycobacterium tuberculosis, Fe cluster, metal-binding, electron transfer, transport; 1.6A {Mycobacterium smegmatis} Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>1hfe_L Protein (Fe-only hydrogenase (E.C.1.18.99.1) (larger subunit)); hydrogene metabolism, periplasm; 1.60A {Desulfovibrio vulgaris subsp} SCOP: c.96.1.1 d.58.1.5 PDB: 1e08_A* 1gx7_A* Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* Back     alignment and structure
>1kf6_B Fumarate reductase iron-sulfur protein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.1.2.1 d.15.4.2 PDB: 1kfy_B* 1l0v_B* 2b76_B* 3cir_B* 3p4p_B* 3p4q_B* 3p4r_B* 3p4s_B* Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>2h88_B Succinate dehydrogenase IP subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_B* 1yq3_B* 2fbw_B* 2h89_B* 2wqy_B* 3aef_B* 3abv_B* 3ae1_B* 3ae3_B* 3ae2_B* 3ae5_B* 3ae6_B* 3ae7_B* 3ae8_B* 3ae9_B* 3aea_B* 3aeb_B* 3aec_B* 3aed_B* 3aee_B* ... Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3cf4_A Acetyl-COA decarboxylase/synthase alpha subunit; methanomicrobia, iron-nikel-sulfur, 4Fe-NI-4S, oxidoreductas; 2.00A {Methanosarcina barkeri} Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>2bs2_B Quinol-fumarate reductase iron-sulfur subunit B; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.1.2.1 d.15.4.2 PDB: 2bs3_B* 1e7p_B* 1qlb_B* 2bs4_B* Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>3c7a_A Octopine dehydrogenase; L) stereospecific opine dehydrogenas, oxidorecutase, oxidoreductase; HET: NAD; 2.10A {Pecten maximus} PDB: 3c7c_B* 3c7d_B* 3iqd_B* Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Back     alignment and structure
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 561
d2gmha1380 c.3.1.2 (A:4-236,A:336-482) Electron transfer flav 1e-47
d2gmha1380 c.3.1.2 (A:4-236,A:336-482) Electron transfer flav 3e-45
d2gmha3102 d.58.1.6 (A:483-584) Electron transfer flavoprotei 2e-44
d2gmha299 d.16.1.8 (A:237-335) Electron transfer flavoprotei 7e-41
d1rp0a1278 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi 2e-22
d2gjca1311 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Th 1e-19
d2i0za1251 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {B 2e-14
d1b5qa1347 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Mai 8e-14
d1k0ia1292 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydr 9e-12
d1jnra2356 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reduct 4e-11
d2gqfa1253 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein H 2e-10
d2ivda1347 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen ox 2e-10
d1pn0a1360 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {So 1e-09
d1kf6a2311 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Es 4e-09
d1y0pa2308 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 ( 5e-09
d2v5za1383 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {H 8e-09
d3c96a1288 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Ps 2e-08
d1qo8a2317 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 ( 2e-08
d2iida1370 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {M 3e-08
d1d4ca2322 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 ( 4e-08
d2bcgg1297 c.3.1.3 (G:5-301) Guanine nucleotide dissociation 7e-08
d1seza1373 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen ox 8e-08
d2voua1265 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydr 1e-07
d1chua2305 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {E 1e-07
d2bs2a2336 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wo 1e-07
d1ebda1223 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehyd 2e-07
d1d5ta1336 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide di 4e-07
d1ojta1229 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide deh 4e-07
d1neka2330 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase 4e-07
d2dw4a2449 c.3.1.2 (A:274-654,A:764-831) Lysine-specific hist 5e-07
d1dxla1221 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehyd 7e-07
d1w4xa1298 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxy 8e-07
d2gv8a1335 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monox 9e-07
d1lvla1220 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehyd 9e-07
d2gf3a1281 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bac 1e-06
d1feca1240 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductas 2e-06
d2f5va1379 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {W 2e-06
d1gpea1391 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penic 2e-06
d1onfa1259 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase 2e-06
d1v59a1233 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehyd 2e-06
d2bi7a1314 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mu 3e-06
d3coxa1370 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of 4e-06
d1aoga1238 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductas 6e-06
d1cf3a1385 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Asper 6e-06
d1i8ta1298 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mu 6e-06
d1h6va1235 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin 7e-06
d3lada1229 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehyd 7e-06
d1n4wa1367 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of 1e-05
d1cjca2230 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase 1e-05
d3grsa1221 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase 2e-05
d1gesa1217 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase 2e-05
d1lqta2239 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reduct 3e-05
d1mo9a1261 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketop 3e-05
d1ryia1276 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO { 3e-05
d1fl2a1184 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide 3e-05
d1xdia1233 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehyd 3e-05
d1vdca1192 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase 3e-05
d1pj5a2305 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine ox 4e-05
d1kdga1360 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain 7e-05
d1trba1190 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase 1e-04
d1ju2a1351 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase { 1e-04
d2cula1230 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {T 2e-04
d1gtea4196 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine de 0.001
d1c0pa1268 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxida 0.002
d1vjwa_59 d.58.1.4 (A:) Ferredoxin A {Thermotoga maritima [T 0.002
d1nhpa1198 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enter 0.003
d1m6ia1213 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing f 0.003
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Length = 380 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD-linked reductases, N-terminal domain
domain: Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO
species: Pig (Sus scrofa) [TaxId: 9823]

 Score =  168 bits (426), Expect = 1e-47
 Identities = 101/207 (48%), Positives = 144/207 (69%), Gaps = 2/207 (0%)

Query: 18  RESIEYDVIIVGGGPSGLSAAIRLKQLAIKKNKEIKICVLEKGSELGAHILSGAIIDPRS 77
           R + E DV+IVG GP+GLSAA RLKQLA +  K++++C++EK + +GAH LSGA +DPR+
Sbjct: 28  RFAEEADVVIVGAGPAGLSAATRLKQLAAQHEKDLRVCLVEKAAHIGAHTLSGACLDPRA 87

Query: 78  IFELFPKEK-LNKLFNTPVIEERFLFLSSKKSYKIPSWILPICFKNHGNYIISLSDLVRW 136
             ELFP  K      NTPV E+RF  L+ K    +P  +  +   NHGNY++ L  LV W
Sbjct: 88  FEELFPDWKEKGAPLNTPVTEDRFGILTEKYRIPVP-ILPGLPMNNHGNYVVRLGHLVSW 146

Query: 137 MGKKAENMGIDIFSGFSASEILYDSKNNVCGIATNNFGINKEGIIKKNFQLGMELYAKYT 196
           MG++AE +G++++ G++A+EIL+    +V GIATN+ GI K+G  K  F+ G+EL+AK T
Sbjct: 147 MGEQAEALGVEVYPGYAAAEILFHEDGSVKGIATNDVGIQKDGAPKTTFERGLELHAKVT 206

Query: 197 LFAEGSRGHLSKQIIKKFNLDNKKDPQ 223
           +FAEG  GHL+KQ+ KKF+L    +PQ
Sbjct: 207 IFAEGCHGHLAKQLYKKFDLRANCEPQ 233
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Length = 380 Back     information, alignment and structure
>d2gmha3 d.58.1.6 (A:483-584) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Length = 102 Back     information, alignment and structure
>d2gmha2 d.16.1.8 (A:237-335) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Length = 99 Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Length = 278 Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 311 Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Length = 251 Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Length = 347 Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Length = 292 Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 356 Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Length = 253 Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Length = 347 Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Length = 360 Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Length = 311 Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 308 Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Length = 383 Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Length = 288 Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 317 Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Length = 370 Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Length = 322 Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 297 Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 373 Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Length = 265 Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Length = 305 Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Length = 336 Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 223 Back     information, alignment and structure
>d1d5ta1 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide dissociation inhibitor, GDI {Cow (Bos taurus) [TaxId: 9913]} Length = 336 Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Length = 229 Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Length = 330 Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Length = 449 Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Length = 221 Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Length = 298 Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 335 Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 220 Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Length = 281 Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Length = 240 Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Length = 379 Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Length = 391 Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Length = 259 Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 233 Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Length = 314 Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Length = 370 Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Length = 238 Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Length = 385 Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 298 Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 235 Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Length = 229 Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Length = 367 Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Length = 230 Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Length = 217 Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Length = 239 Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Length = 261 Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Length = 276 Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Length = 184 Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 233 Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 192 Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Length = 305 Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Length = 360 Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Length = 190 Back     information, alignment and structure
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Length = 351 Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Length = 230 Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Length = 196 Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Length = 268 Back     information, alignment and structure
>d1vjwa_ d.58.1.4 (A:) Ferredoxin A {Thermotoga maritima [TaxId: 2336]} Length = 59 Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Length = 198 Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Length = 213 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query561
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 100.0
d2gmha3102 Electron transfer flavoprotein-ubiquinone oxidored 100.0
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 99.86
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 99.85
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 99.8
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 99.7
d2gmha299 Electron transfer flavoprotein-ubiquinone oxidored 99.68
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 99.67
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 99.58
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 99.53
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 99.51
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 99.5
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 99.49
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 99.43
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 99.42
d1neka2330 Succinate dehydogenase {Escherichia coli [TaxId: 5 99.38
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 99.36
d2bs2a2336 Fumarate reductase {Wolinella succinogenes [TaxId: 99.3
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 99.29
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 99.27
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 99.26
d1kf6a2311 Fumarate reductase {Escherichia coli [TaxId: 562]} 99.26
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 99.23
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 99.2
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 99.19
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 99.11
d1h98a_77 Ferredoxin {Thermus thermophilus [TaxId: 274]} 99.08
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 99.07
d1bc6a_77 Ferredoxin {Bacillus schlegelii [TaxId: 1484]} 99.07
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 99.06
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 99.05
d1chua2305 L-aspartate oxidase {Escherichia coli [TaxId: 562] 99.05
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 99.05
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 99.02
d1xera_103 Ferredoxin {Archaeon Sulfolobus sp. [TaxId: 2288]} 99.01
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 98.98
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 98.97
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 98.97
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 98.97
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 98.97
d1jb0c_80 Photosystem I iron-sulfur protein PsaC {Synechococ 98.96
d1jnra2356 Adenylylsulfate reductase A subunit {Archaeon Arch 98.96
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 98.95
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 98.95
d1blua_80 Ferredoxin II {Chromatium vinosum [TaxId: 1049]} 98.95
d2fdna_55 Ferredoxin II {Clostridium acidurici [TaxId: 1556] 98.94
d7fd1a_106 Ferredoxin {Azotobacter vinelandii [TaxId: 354]} 98.93
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 98.93
d1dura_55 Ferredoxin II {Peptostreptococcus asaccharolyticus 98.92
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 98.92
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 98.92
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 98.9
d1hfel285 Fe-only hydrogenase larger subunit, N-domain {Desu 98.88
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 98.88
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 98.87
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 98.87
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 98.86
d1jnrb_149 Adenylylsulfate reductase B subunit {Archaeon Arch 98.86
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 98.85
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 98.85
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 98.85
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 98.82
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 98.76
d1rgva_80 Ferredoxin II {Thauera aromatica [TaxId: 59405]} 98.76
d3c7bb165 DsrB insert domain {Archaeoglobus fulgidus [TaxId: 98.75
d2fug91154 NADH-quinone oxidoreductase chain 9, Nqo9 {Thermus 98.74
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 98.74
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 98.73
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 98.69
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 98.69
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 98.67
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 98.64
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 98.64
d1gtea5173 Dihydropyrimidine dehydrogenase, C-terminal domain 98.61
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 98.6
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 98.6
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 98.58
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 98.57
d1vjwa_59 Ferredoxin A {Thermotoga maritima [TaxId: 2336]} 98.55
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 98.55
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 98.53
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 98.51
d2c42a5117 Pyruvate-ferredoxin oxidoreductase, PFOR, domain V 98.49
d1fxra_64 Ferredoxin I {Sulfate-reducing bacteria (Desulfovi 98.48
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 98.47
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 98.47
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 98.42
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 98.41
d1kdga1360 Flavoprotein domain of flavocytochrome cellobiose 98.41
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 98.39
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 98.39
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 98.39
d3c8ya383 Fe-only hydrogenase, second domain {Clostridium pa 98.37
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 98.34
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 98.34
d1kqfb1244 Formate dehydrogenase N, iron-sulfur (beta) subuni 98.34
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 98.31
d1y5ib1 509 Respiratory nitrate reductase 1 beta chain {Escher 98.29
d1fxda_58 Ferredoxin I {Desulfovibrio gigas [TaxId: 879]} 98.2
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 98.19
d1sj1a_66 Fe3S4-ferredoxin PF1909 {Pyrococcus furiosus [TaxI 98.19
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 98.19
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 98.18
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 98.16
d1feca1240 Trypanothione reductase {Crithidia fasciculata [Ta 98.15
d1vlfn2195 Transhydroxylase beta subunit, BthL, N-terminal do 98.15
d1iqza_81 Ferredoxin {Bacillus thermoproteolyticus [TaxId: 1 97.99
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 97.97
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 97.87
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 97.83
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 97.78
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 97.75
d1gpea1391 Glucose oxidase {Penicillium amagasakiense [TaxId: 97.73
d1cf3a1385 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 97.7
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 97.59
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 97.48
d1ju2a1351 Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI 97.47
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 97.44
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 97.35
d2v4jb169 DsrB insert domain {Desulfovibrio vulgaris [TaxId: 97.33
d2fug34151 NADH-quinone oxidoreductase chain 3, Nqo3, domain 97.3
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 97.18
d1hfel285 Fe-only hydrogenase larger subunit, N-domain {Desu 97.06
d1vlfn2195 Transhydroxylase beta subunit, BthL, N-terminal do 97.01
d1blua_80 Ferredoxin II {Chromatium vinosum [TaxId: 1049]} 97.01
d1jb0c_80 Photosystem I iron-sulfur protein PsaC {Synechococ 96.89
d1y5ib1 509 Respiratory nitrate reductase 1 beta chain {Escher 96.83
d1xera_103 Ferredoxin {Archaeon Sulfolobus sp. [TaxId: 2288]} 96.81
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 96.78
d1kqfb1244 Formate dehydrogenase N, iron-sulfur (beta) subuni 96.76
d2fdna_55 Ferredoxin II {Clostridium acidurici [TaxId: 1556] 96.72
d1h0hb_214 Tungsten containing formate dehydrogenase, small s 96.47
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 96.45
d1rgva_80 Ferredoxin II {Thauera aromatica [TaxId: 59405]} 96.42
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 96.33
d1cjca1225 Adrenodoxin reductase of mitochondrial p450 system 96.31
d3c7ba166 DsrA insert domain {Archaeoglobus fulgidus [TaxId: 96.11
d1fxra_64 Ferredoxin I {Sulfate-reducing bacteria (Desulfovi 96.1
d1dura_55 Ferredoxin II {Peptostreptococcus asaccharolyticus 96.06
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 95.92
d1bc6a_77 Ferredoxin {Bacillus schlegelii [TaxId: 1484]} 95.92
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 95.91
d1vjwa_59 Ferredoxin A {Thermotoga maritima [TaxId: 2336]} 95.86
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 95.83
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 95.83
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 95.8
d1sj1a_66 Fe3S4-ferredoxin PF1909 {Pyrococcus furiosus [TaxI 95.78
d2c42a5117 Pyruvate-ferredoxin oxidoreductase, PFOR, domain V 95.62
d2v4ja181 DsrA insert domain {Desulfovibrio vulgaris [TaxId: 95.59
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 95.55
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 95.39
d1h98a_77 Ferredoxin {Thermus thermophilus [TaxId: 274]} 95.19
d3c8ya383 Fe-only hydrogenase, second domain {Clostridium pa 94.9
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 94.73
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 94.66
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 94.64
d2fug91154 NADH-quinone oxidoreductase chain 9, Nqo9 {Thermus 94.59
d1fxda_58 Ferredoxin I {Desulfovibrio gigas [TaxId: 879]} 94.51
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 94.44
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 94.42
d1h0hb_214 Tungsten containing formate dehydrogenase, small s 94.42
d1iqza_81 Ferredoxin {Bacillus thermoproteolyticus [TaxId: 1 94.38
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 94.26
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 94.18
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 94.14
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 93.93
d1gtea5173 Dihydropyrimidine dehydrogenase, C-terminal domain 93.9
d7fd1a_106 Ferredoxin {Azotobacter vinelandii [TaxId: 354]} 93.79
d1lqta1216 Ferredoxin:NADP reductase FprA {Mycobacterium tube 93.63
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 93.54
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 93.35
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 93.26
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 93.24
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 93.22
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 93.1
d1vg0a1491 Rab escort protein 1 {Rat (Rattus norvegicus) [Tax 92.97
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 92.94
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 92.9
d1id1a_153 Rck domain from putative potassium channel Kch {Es 92.82
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 92.6
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 92.15
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 92.09
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 91.98
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 91.88
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 91.71
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 91.7
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 91.56
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 91.34
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 91.19
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 91.16
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 91.02
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 90.95
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 90.9
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 90.85
d1a9xa3127 Carbamoyl phosphate synthetase (CPS), large subuni 90.81
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 90.8
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 90.76
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 90.59
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 90.4
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 90.24
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 89.92
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 89.58
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 89.35
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 88.99
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 88.96
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 88.81
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 88.77
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 88.58
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 88.44
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 88.24
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 87.85
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 87.59
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 87.44
d3c7bb165 DsrB insert domain {Archaeoglobus fulgidus [TaxId: 86.64
d2dt5a2126 Transcriptional repressor Rex, C-terminal domain { 86.62
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 86.57
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 86.14
d1nekb1132 Succinate dehydogenase {Escherichia coli [TaxId: 5 85.76
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 85.75
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 84.9
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 84.58
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 84.45
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 84.07
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 84.06
d1jnrb_149 Adenylylsulfate reductase B subunit {Archaeon Arch 83.78
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 83.69
d2bs2b1133 Fumarate reductase {Wolinella succinogenes [TaxId: 83.46
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 83.0
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 82.07
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 81.34
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 81.2
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 81.2
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 81.16
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 80.77
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 80.47
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 80.19
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD-linked reductases, N-terminal domain
domain: Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO
species: Pig (Sus scrofa) [TaxId: 9823]

Probab=100.00  E-value=2e-45  Score=372.19  Aligned_cols=356  Identities=46%  Similarity=0.818  Sum_probs=297.8

Q ss_pred             ccccccCCCCCCCCCcccEEEECchhHHHHHHHHHHhccccCCCCCcEEEEcCCCCCCCceeecceeChhhHHhhccccc
Q psy14496          7 LNHSLINKYGPRESIEYDVIIVGGGPSGLSAAIRLKQLAIKKNKEIKICVLEKGSELGAHILSGAIIDPRSIFELFPKEK   86 (561)
Q Consensus         7 ~~~~~~~~~~~~~~~~~dVvIVGaGpAGLa~A~~La~~~~~~~~G~~V~ViEk~~~~g~~~~~G~~~~~~~l~~l~~~~~   86 (561)
                      ++......++++++++|||||||||||||+||+.|+|+.+.++.|++|+||||...+|.++++|+++.++.+.++++.+.
T Consensus        17 ~~~~~~~~~m~~~~~e~DViIVGgGPAGlsaA~~LA~l~~~~~~Gl~VlllEK~~~pG~k~~~Ggvl~~~~l~~l~p~~~   96 (380)
T d2gmha1          17 QDKRWEGVNMERFAEEADVVIVGAGPAGLSAATRLKQLAAQHEKDLRVCLVEKAAHIGAHTLSGACLDPRAFEELFPDWK   96 (380)
T ss_dssp             SCGGGSSCCCCCCEEECSEEEECCSHHHHHHHHHHHHHHHHTTCCCCEEEECSSSSTTTTCCCCCEECTHHHHHHCTTHH
T ss_pred             cCccccccCcccccccCCEEEECCCHHHHHHHHHHHhhhhhhcCCCEEEEEcCCCCCCCCccccccccHHHHHHHccchh
Confidence            34445556677888899999999999999999999995444555999999999999999999999999999999999887


Q ss_pred             -cCCccccccchhhhhhhcCCCCcccCCCCCCceeecCCcEEeeHHHHHHHHHHHHHHCCCEEEcCceEeEEEEcCCCCE
Q psy14496         87 -LNKLFNTPVIEERFLFLSSKKSYKIPSWILPICFKNHGNYIISLSDLVRWMGKKAENMGIDIFSGFSASEILYDSKNNV  165 (561)
Q Consensus        87 -~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~i~r~~l~~~L~~~a~~~gv~i~~g~~v~~i~~~~~g~v  165 (561)
                       ...+.......+.+.++.......+.. ..+....+...+.+.+..+++++.+.+++.|+.+..++.+.++..++++.+
T Consensus        97 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~l~~~Ae~~g~~~~~~~~~~~~l~~~~g~~  175 (380)
T d2gmha1          97 EKGAPLNTPVTEDRFGILTEKYRIPVPI-LPGLPMNNHGNYVVRLGHLVSWMGEQAEALGVEVYPGYAAAEILFHEDGSV  175 (380)
T ss_dssp             HHTCCCCEECCEEEEEEECSSCEEECCC-CTTSTTCCTTCEECCHHHHHHHHHHHHHHTTCEEETTCCEEEEEECTTSSE
T ss_pred             hhccccccceecceEEEeeccccccccc-cCchhcccccceeehhhHHHHHHHHHHhhccceeeeecceeeeeeccCCce
Confidence             555555555555665665544433321 112234456689999999999999999999999999999999999888888


Q ss_pred             EEEEecccccccCCceecccccCeEEecCEEEEccCCCchhhHHHHHHcCCCCCCCCccccceeEEEEeeCCCccCCCcE
Q psy14496        166 CGIATNNFGINKEGIIKKNFQLGMELYAKYTLFAEGSRGHLSKQIIKKFNLDNKKDPQTYSLGIKELWTINPKLHKKGLV  245 (561)
Q Consensus       166 ~~V~~~~~~~~~~g~~~~~f~~g~~i~ad~vV~AdG~~s~~~~~l~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  245 (561)
                      .++.+.+....+++..+..+..+....++++|+++|.++.+.+++.+.+.+...                          
T Consensus       176 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~G~~G~l~k~li~~~~l~~~--------------------------  229 (380)
T d2gmha1         176 KGIATNDVGIQKDGAPKTTFERGLELHAKVTIFAEGCHGHLAKQLYKKFDLRAN--------------------------  229 (380)
T ss_dssp             EEEEECCEEECTTSCEEEEEECCCEEECSEEEECCCTTCHHHHHHHHHTTTTTT--------------------------
T ss_pred             eecccccccccccccccccccccccccccEEEEeeeCCCcchHHHHhhhhhccc--------------------------
Confidence            888888888888888888888889999999999999999888776644322110                          


Q ss_pred             EEEeccCCCCCCCceEEEEEcCCCeEEEEEEecCCCCCCCCChHHHHHHhhhChhHHHhhcCCeeeeecceeeccCCCcc
Q psy14496        246 IHTIGWPLDYKTYGGGFLYHMENNQISIGYIISLDYKNPYLSPFEEFQRYKTHPKICKILKGGKRISYGARTITTGGLQS  325 (561)
Q Consensus       246 ~~~~~~p~~~~~~g~~~~~~~~~~~~~ig~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~l~~~~~~~~~~~~~~~~~~~~  325 (561)
                                                                                             ..+..|+..
T Consensus       230 -----------------------------------------------------------------------~~~~~G~~s  238 (380)
T d2gmha1         230 -----------------------------------------------------------------------CEPQGGFQS  238 (380)
T ss_dssp             -----------------------------------------------------------------------SCCCCGGGG
T ss_pred             -----------------------------------------------------------------------ccccccccc
Confidence                                                                                   001123445


Q ss_pred             CCeeecCCEEEEecCCccCCCcccccchHHHHHHHHHHHHHHHHHhcCCCccc-----hhhHHHHHhhchhhHhhhhhhc
Q psy14496        326 LPEFIFDGGAFIGCNAGFMNVSRIKGIHTSIKSGILVADSIFKKICSNNKFNK-----LITYKTSFQASWLYKELYKARN  400 (561)
Q Consensus       326 ~~~~~~~~v~lvGDAa~~~~P~~g~G~~~Ai~~a~~lA~~l~~~l~~~~~~~~-----l~~y~~~~~~~~~~~~~~~~~~  400 (561)
                      +|++..+|++|+||||++++|++++|++.||.+|+++|+++.+++..++.+..     +..|++.++++|++++|+..||
T Consensus       239 ip~l~~~G~lLVGDAAG~vnP~~g~GI~~Am~SG~lAAeai~~al~~~~~~~~~~~~~~~~y~~~~~~s~~~~eL~~~rn  318 (380)
T d2gmha1         239 IPKLTFPGGLLIGCSPGFMNVPKIKGTHTAMKSGTLAAESIFNQLTSENLQSKTIGLHVTEYEDNLKNSWVWKELYSVRN  318 (380)
T ss_dssp             CCCCEETTEEECTTTTCCCBTTTTBCHHHHHHHHHHHHHHHHHHHTCCCCCCSSSSCCCTHHHHHHHTSHHHHHHHHTTT
T ss_pred             ccccccCCeeEEeccccccchhhcCCeeeeeccHHHHHHHHHHHHHcCCcccchhhhhhhhHHHHHHhhHHHHHHHHhhC
Confidence            66778899999999999999999999999999999999999999987765432     6789999999999999999999


Q ss_pred             cchhhh--hhhhHHHHHHHHHHHHhcCCCCccccCCCCccCCcccccCCCCCCCCCCCCccc
Q psy14496        401 FKPAMK--KGLYIGMLIIGIDQILFSGKFPFTLHNINSDYTYLEPASKHIPIKYPNPDNKLT  460 (561)
Q Consensus       401 ~~~~~~--~g~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~  460 (561)
                      +++.|+  +|++.|+++.++.+++++|+.||++.|..+|+.+++++.++.+++||+||++||
T Consensus       319 ~~~~~~~~~g~~~g~~~~~~~~~~~~g~~p~tl~~~~~d~~~l~~~~~~~~i~y~~~d~~~~  380 (380)
T d2gmha1         319 IRPSCHGILGVYGGMIYTGIFYWIFRGMEPWTLKHKGSDSDQLKPAKDCTPIEYPKPDGQIS  380 (380)
T ss_dssp             TTGGGGSTTTHHHHHHHHHHHTTTTTTCCSCCCCCCSCGGGCCCCGGGSCCCCCCCCCSSSS
T ss_pred             CCHHHHhhchHHHHHHHHHHHHHHhCCCCCccCCCCCCCHHHHHHHHhCCCCCCCCCCCccC
Confidence            999995  699999999999999999999999999999999999999999999999999986
>d2gmha3 d.58.1.6 (A:483-584) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2gmha2 d.16.1.8 (A:237-335) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1h98a_ d.58.1.2 (A:) Ferredoxin {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1bc6a_ d.58.1.2 (A:) Ferredoxin {Bacillus schlegelii [TaxId: 1484]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xera_ d.58.1.3 (A:) Ferredoxin {Archaeon Sulfolobus sp. [TaxId: 2288]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1jb0c_ d.58.1.2 (C:) Photosystem I iron-sulfur protein PsaC {Synechococcus elongatus [TaxId: 32046]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1blua_ d.58.1.1 (A:) Ferredoxin II {Chromatium vinosum [TaxId: 1049]} Back     information, alignment and structure
>d2fdna_ d.58.1.1 (A:) Ferredoxin II {Clostridium acidurici [TaxId: 1556]} Back     information, alignment and structure
>d7fd1a_ d.58.1.2 (A:) Ferredoxin {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1dura_ d.58.1.1 (A:) Ferredoxin II {Peptostreptococcus asaccharolyticus [TaxId: 1258]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1hfel2 d.58.1.5 (L:2-86) Fe-only hydrogenase larger subunit, N-domain {Desulfovibrio desulfuricans [TaxId: 876]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jnrb_ d.58.1.5 (B:) Adenylylsulfate reductase B subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1rgva_ d.58.1.1 (A:) Ferredoxin II {Thauera aromatica [TaxId: 59405]} Back     information, alignment and structure
>d3c7bb1 d.58.1.5 (B:197-261) DsrB insert domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2fug91 d.58.1.5 (9:26-179) NADH-quinone oxidoreductase chain 9, Nqo9 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1gtea5 d.58.1.5 (A:845-1017) Dihydropyrimidine dehydrogenase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vjwa_ d.58.1.4 (A:) Ferredoxin A {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2c42a5 d.58.1.5 (A:669-785) Pyruvate-ferredoxin oxidoreductase, PFOR, domain V {Desulfovibrio africanus [TaxId: 873]} Back     information, alignment and structure
>d1fxra_ d.58.1.4 (A:) Ferredoxin I {Sulfate-reducing bacteria (Desulfovibrio africanus) [TaxId: 873]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d3c8ya3 d.58.1.5 (A:127-209) Fe-only hydrogenase, second domain {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kqfb1 d.58.1.5 (B:2-245) Formate dehydrogenase N, iron-sulfur (beta) subunit {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1y5ib1 d.58.1.5 (B:1-509) Respiratory nitrate reductase 1 beta chain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fxda_ d.58.1.4 (A:) Ferredoxin I {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sj1a_ d.58.1.4 (A:) Fe3S4-ferredoxin PF1909 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1vlfn2 d.58.1.5 (N:1-195) Transhydroxylase beta subunit, BthL, N-terminal domain {Pelobacter acidigallici [TaxId: 35816]} Back     information, alignment and structure
>d1iqza_ d.58.1.4 (A:) Ferredoxin {Bacillus thermoproteolyticus [TaxId: 1427]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2v4jb1 d.58.1.5 (B:209-277) DsrB insert domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d2fug34 d.58.1.5 (3:96-246) NADH-quinone oxidoreductase chain 3, Nqo3, domain 2 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hfel2 d.58.1.5 (L:2-86) Fe-only hydrogenase larger subunit, N-domain {Desulfovibrio desulfuricans [TaxId: 876]} Back     information, alignment and structure
>d1vlfn2 d.58.1.5 (N:1-195) Transhydroxylase beta subunit, BthL, N-terminal domain {Pelobacter acidigallici [TaxId: 35816]} Back     information, alignment and structure
>d1blua_ d.58.1.1 (A:) Ferredoxin II {Chromatium vinosum [TaxId: 1049]} Back     information, alignment and structure
>d1jb0c_ d.58.1.2 (C:) Photosystem I iron-sulfur protein PsaC {Synechococcus elongatus [TaxId: 32046]} Back     information, alignment and structure
>d1y5ib1 d.58.1.5 (B:1-509) Respiratory nitrate reductase 1 beta chain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xera_ d.58.1.3 (A:) Ferredoxin {Archaeon Sulfolobus sp. [TaxId: 2288]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kqfb1 d.58.1.5 (B:2-245) Formate dehydrogenase N, iron-sulfur (beta) subunit {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fdna_ d.58.1.1 (A:) Ferredoxin II {Clostridium acidurici [TaxId: 1556]} Back     information, alignment and structure
>d1h0hb_ d.58.1.5 (B:) Tungsten containing formate dehydrogenase, small subunit {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1rgva_ d.58.1.1 (A:) Ferredoxin II {Thauera aromatica [TaxId: 59405]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d3c7ba1 d.58.1.5 (A:239-304) DsrA insert domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1fxra_ d.58.1.4 (A:) Ferredoxin I {Sulfate-reducing bacteria (Desulfovibrio africanus) [TaxId: 873]} Back     information, alignment and structure
>d1dura_ d.58.1.1 (A:) Ferredoxin II {Peptostreptococcus asaccharolyticus [TaxId: 1258]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1bc6a_ d.58.1.2 (A:) Ferredoxin {Bacillus schlegelii [TaxId: 1484]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1vjwa_ d.58.1.4 (A:) Ferredoxin A {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sj1a_ d.58.1.4 (A:) Fe3S4-ferredoxin PF1909 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2c42a5 d.58.1.5 (A:669-785) Pyruvate-ferredoxin oxidoreductase, PFOR, domain V {Desulfovibrio africanus [TaxId: 873]} Back     information, alignment and structure
>d2v4ja1 d.58.1.5 (A:242-322) DsrA insert domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1h98a_ d.58.1.2 (A:) Ferredoxin {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3c8ya3 d.58.1.5 (A:127-209) Fe-only hydrogenase, second domain {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2fug91 d.58.1.5 (9:26-179) NADH-quinone oxidoreductase chain 9, Nqo9 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1fxda_ d.58.1.4 (A:) Ferredoxin I {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1h0hb_ d.58.1.5 (B:) Tungsten containing formate dehydrogenase, small subunit {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d1iqza_ d.58.1.4 (A:) Ferredoxin {Bacillus thermoproteolyticus [TaxId: 1427]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gtea5 d.58.1.5 (A:845-1017) Dihydropyrimidine dehydrogenase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d7fd1a_ d.58.1.2 (A:) Ferredoxin {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1vg0a1 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d3c7bb1 d.58.1.5 (B:197-261) DsrB insert domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1nekb1 a.1.2.1 (B:107-238) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1jnrb_ d.58.1.5 (B:) Adenylylsulfate reductase B subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d2bs2b1 a.1.2.1 (B:107-239) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure