Psyllid ID: psy14514


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-
MFLVQTVLKGIYEENLPVFEGSSVWDSDYYTGQVGSYPYSGFYQDLSANHNDFLAQLDMLRKGGWITRATRVVFIDFSMYNANVNLFCFVK
ccEEEEcccccccccccEEEcccccccccEEEEEEEEccccEEEEccccHHHHHHHHHHcHHccccccccEEEEEEEEEEEccccEEEEEc
cEEEEEcccccccccccEEccHHHcccccccEEEEEEcccEEEEEccccHHHHHHHHHHHHHccccccccEEEEEEEEEEEccEEEEEEEc
MFLVQTVLKGiyeenlpvfegssvwdsdyytgqvgsypysgfyqdlsaNHNDFLAQLDMLrkggwitraTRVVFIDFSMYNANVNLFCFVK
MFLVQTVLKGIYEENLPVFEGSSVWDSDYYTGQVGSYPYSGFYQDLSANHNDFLAQLDMLRKGGWITRATRVVFIDFSMYNANVNLFCFVK
MFLVQTVLKGIYEENLPVFEGSSVWDSDYYTGQVGSYPYSGFYQDLSANHNDFLAQLDMLRKGGWITRATRVVFIDFSMYNANVNLFCFVK
*FLVQTVLKGIYEENLPVFEGSSVWDSDYYTGQVGSYPYSGFYQDLSANHNDFLAQLDMLRKGGWITRATRVVFIDFSMYNANVNLFCFV*
*FL**T*LKGIYEENLPVFEGSSVWDSDYYTGQVGSYPYSGFYQDLSANHNDFLAQLDMLRKGGWITRATRVVFIDFSMYNANVNLFCFVK
MFLVQTVLKGIYEENLPVFEGSSVWDSDYYTGQVGSYPYSGFYQDLSANHNDFLAQLDMLRKGGWITRATRVVFIDFSMYNANVNLFCFVK
MFLVQTVLKGIYEENLPVFEGSSVWDSDYYTGQVGSYPYSGFYQDLSANHNDFLAQLDMLRKGGWITRATRVVFIDFSMYNANVNLFCFVK
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFLVQTVLKGIYEENLPVFEGSSVWDSDYYTGQVGSYPYSGFYQDLSANHNDFLAQLDMLRKGGWITRATRVVFIDFSMYNANVNLFCFVK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query91 2.2.26 [Sep-21-2011]
O35245 966 Polycystin-2 OS=Mus muscu yes N/A 0.736 0.069 0.479 6e-13
Q4GZT3 970 Polycystin-2 OS=Bos tauru yes N/A 0.736 0.069 0.424 3e-12
Q13563 968 Polycystin-2 OS=Homo sapi yes N/A 0.714 0.067 0.464 1e-11
Q9P0L9 805 Polycystic kidney disease no N/A 0.659 0.074 0.483 2e-10
Q9NZM6 624 Polycystic kidney disease no N/A 0.725 0.105 0.454 7e-10
Q9JLG4 621 Polycystic kidney disease no N/A 0.714 0.104 0.461 1e-09
Q9U1S7 716 Polycystin-2 OS=Caenorhab yes N/A 0.659 0.083 0.409 9e-08
Q7TN88 2461 Polycystic kidney disease no N/A 0.648 0.023 0.389 1e-05
Q2EG98 2201 Polycystic kidney disease no N/A 0.648 0.026 0.338 2e-05
Q7Z442 2459 Polycystic kidney disease no N/A 0.714 0.026 0.323 0.0002
>sp|O35245|PKD2_MOUSE Polycystin-2 OS=Mus musculus GN=Pkd2 PE=1 SV=2 Back     alignment and function desciption
 Score = 72.8 bits (177), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 35/73 (47%), Positives = 44/73 (60%), Gaps = 6/73 (8%)

Query: 19  FEGSSVWDSDYYTGQVGSYPYSGFYQDLSANHNDFLAQLDMLRKGGWITRATRVVFIDFS 78
             GSS W      G + SY  +G+Y DLS    +  AQL  LR+  W+ R TR  FIDFS
Sbjct: 372 LNGSSHW------GIIASYSGAGYYLDLSRTREETAAQLAGLRRNFWLDRGTRAAFIDFS 425

Query: 79  MYNANVNLFCFVK 91
           +YNAN+NLFC V+
Sbjct: 426 VYNANINLFCVVR 438




Involved in fluid-flow mechanosensation by the primary cilium in renal epithelium. PKD1 and PKD2 may function through a common signaling pathway that is necessary for normal tubulogenesis (By similarity). Acts as a regulator of cilium length, together with PKD1. The dynamic control of cilium length is essential in the regulation of mechanotransductive signaling. The cilium length response creates a negative feedback loop whereby fluid shear-mediated deflection of the primary cilium, which decreases intracellular cAMP, leads to cilium shortening and thus decreases flow-induced signaling. Functions as a calcium permeable cation channel.
Mus musculus (taxid: 10090)
>sp|Q4GZT3|PKD2_BOVIN Polycystin-2 OS=Bos taurus GN=PKD2 PE=2 SV=1 Back     alignment and function description
>sp|Q13563|PKD2_HUMAN Polycystin-2 OS=Homo sapiens GN=PKD2 PE=1 SV=3 Back     alignment and function description
>sp|Q9P0L9|PK2L1_HUMAN Polycystic kidney disease 2-like 1 protein OS=Homo sapiens GN=PKD2L1 PE=1 SV=1 Back     alignment and function description
>sp|Q9NZM6|PK2L2_HUMAN Polycystic kidney disease 2-like 2 protein OS=Homo sapiens GN=PKD2L2 PE=2 SV=2 Back     alignment and function description
>sp|Q9JLG4|PK2L2_MOUSE Polycystic kidney disease 2-like 2 protein OS=Mus musculus GN=Pkd2l2 PE=2 SV=2 Back     alignment and function description
>sp|Q9U1S7|PKD2_CAEEL Polycystin-2 OS=Caenorhabditis elegans GN=pkd-2 PE=1 SV=3 Back     alignment and function description
>sp|Q7TN88|PK1L2_MOUSE Polycystic kidney disease protein 1-like 2 OS=Mus musculus GN=Pkd1l2 PE=2 SV=1 Back     alignment and function description
>sp|Q2EG98|PK1L3_MOUSE Polycystic kidney disease protein 1-like 3 OS=Mus musculus GN=Pkd1l3 PE=2 SV=2 Back     alignment and function description
>sp|Q7Z442|PK1L2_HUMAN Polycystic kidney disease protein 1-like 2 OS=Homo sapiens GN=PKD1L2 PE=1 SV=4 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query91
344284765 974 PREDICTED: polycystin-2 [Loxodonta afric 0.736 0.068 0.493 7e-13
47214258 857 unnamed protein product [Tetraodon nigro 0.714 0.075 0.507 6e-12
348567286 1007 PREDICTED: polycystin-2-like [Cavia porc 0.736 0.066 0.479 7e-12
410917964 902 PREDICTED: polycystin-2-like [Takifugu r 0.714 0.072 0.478 1e-11
301755566 926 PREDICTED: LOW QUALITY PROTEIN: polycyst 0.736 0.072 0.452 1e-11
355711750 621 polycystic kidney disease 2 [Mustela put 0.736 0.107 0.452 1e-11
223668066 910 polycystin-2 delta7 variant [Mus musculu 0.736 0.073 0.479 2e-11
395834298 1002 PREDICTED: polycystin-2 [Otolemur garnet 0.736 0.066 0.465 2e-11
2558835 966 polycystic kidney disease 2 [Mus musculu 0.736 0.069 0.479 3e-11
164519057 966 polycystin-2 [Mus musculus] gi|341941263 0.736 0.069 0.479 3e-11
>gi|344284765|ref|XP_003414135.1| PREDICTED: polycystin-2 [Loxodonta africana] Back     alignment and taxonomy information
 Score = 77.8 bits (190), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 36/73 (49%), Positives = 45/73 (61%), Gaps = 6/73 (8%)

Query: 19  FEGSSVWDSDYYTGQVGSYPYSGFYQDLSANHNDFLAQLDMLRKGGWITRATRVVFIDFS 78
             GSS W      G   +Y  +G+Y DLS    +  AQ+  LRK GW+ R TR VFIDFS
Sbjct: 379 LNGSSHW------GMTATYSGAGYYLDLSRTREETAAQIASLRKNGWLDRGTRAVFIDFS 432

Query: 79  MYNANVNLFCFVK 91
           +YNAN+NLFC V+
Sbjct: 433 VYNANINLFCVVR 445




Source: Loxodonta africana

Species: Loxodonta africana

Genus: Loxodonta

Family: Elephantidae

Order: Proboscidea

Class: Mammalia

Phylum: Chordata

Superkingdom: Eukaryota

>gi|47214258|emb|CAG01935.1| unnamed protein product [Tetraodon nigroviridis] Back     alignment and taxonomy information
>gi|348567286|ref|XP_003469431.1| PREDICTED: polycystin-2-like [Cavia porcellus] Back     alignment and taxonomy information
>gi|410917964|ref|XP_003972456.1| PREDICTED: polycystin-2-like [Takifugu rubripes] Back     alignment and taxonomy information
>gi|301755566|ref|XP_002913648.1| PREDICTED: LOW QUALITY PROTEIN: polycystin-2-like [Ailuropoda melanoleuca] Back     alignment and taxonomy information
>gi|355711750|gb|AES04114.1| polycystic kidney disease 2 [Mustela putorius furo] Back     alignment and taxonomy information
>gi|223668066|gb|ACN11624.1| polycystin-2 delta7 variant [Mus musculus] Back     alignment and taxonomy information
>gi|395834298|ref|XP_003790144.1| PREDICTED: polycystin-2 [Otolemur garnettii] Back     alignment and taxonomy information
>gi|2558835|gb|AAC53388.1| polycystic kidney disease 2 [Mus musculus] Back     alignment and taxonomy information
>gi|164519057|ref|NP_032887.3| polycystin-2 [Mus musculus] gi|341941263|sp|O35245.2|PKD2_MOUSE RecName: Full=Polycystin-2; AltName: Full=Polycystic kidney disease 2 protein homolog Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query91
ZFIN|ZDB-GENE-040827-4 904 pkd2 "polycystic kidney diseas 0.758 0.076 0.5 2e-12
UNIPROTKB|F1NE51 603 PKD2L2 "Uncharacterized protei 0.714 0.107 0.507 4.8e-12
UNIPROTKB|Q9P0L9 805 PKD2L1 "Polycystic kidney dise 0.659 0.074 0.483 1.4e-11
UNIPROTKB|F1RW49 970 PKD2 "Uncharacterized protein" 0.714 0.067 0.478 1.6e-11
MGI|MGI:1099818 966 Pkd2 "polycystic kidney diseas 0.714 0.067 0.492 2e-11
ZFIN|ZDB-GENE-030616-558 805 pkd2l1 "polycystic kidney dise 0.725 0.081 0.458 2.6e-11
RGD|1310272265 Pkd2l2 "polycystic kidney dise 0.692 0.237 0.492 2.7e-11
UNIPROTKB|Q2TBW4 600 PKD2L2 "Uncharacterized protei 0.725 0.11 0.484 2.7e-11
UNIPROTKB|F1PGE3 861 PKD2 "Uncharacterized protein" 0.714 0.075 0.450 2.8e-11
RGD|1559992 966 Pkd2 "polycystic kidney diseas 0.714 0.067 0.478 4.2e-11
ZFIN|ZDB-GENE-040827-4 pkd2 "polycystic kidney disease 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 178 (67.7 bits), Expect = 2.0e-12, P = 2.0e-12
 Identities = 35/70 (50%), Positives = 45/70 (64%)

Query:    22 SSVWDSDYYTGQVGSYPYSGFYQDLSANHNDFLAQLDMLRKGGWITRATRVVFIDFSMYN 81
             SS+ +S Y+ GQV +Y   G+YQDLS        QL  L+   W+ R TR VF+DFS+YN
Sbjct:   308 SSLGESSYW-GQVSTYGGGGYYQDLSRTREKSANQLQELKNNLWLDRGTRAVFLDFSIYN 366

Query:    82 ANVNLFCFVK 91
              NVNLFC V+
Sbjct:   367 GNVNLFCIVR 376




GO:0005509 "calcium ion binding" evidence=IEA
GO:0016020 "membrane" evidence=IEA
GO:0016323 "basolateral plasma membrane" evidence=IDA
GO:0005929 "cilium" evidence=IDA
GO:0048793 "pronephros development" evidence=IGI;IMP
GO:0005783 "endoplasmic reticulum" evidence=ISS;IDA
GO:0001947 "heart looping" evidence=IMP
GO:0003143 "embryonic heart tube morphogenesis" evidence=IMP
GO:0007368 "determination of left/right symmetry" evidence=IGI;IMP
GO:0003146 "heart jogging" evidence=IMP
GO:0016328 "lateral plasma membrane" evidence=ISS
GO:0072019 "proximal convoluted tubule development" evidence=IMP
GO:0009953 "dorsal/ventral pattern formation" evidence=IMP
GO:0072114 "pronephros morphogenesis" evidence=IMP
GO:0032965 "regulation of collagen biosynthetic process" evidence=IMP
UNIPROTKB|F1NE51 PKD2L2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q9P0L9 PKD2L1 "Polycystic kidney disease 2-like 1 protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RW49 PKD2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1099818 Pkd2 "polycystic kidney disease 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030616-558 pkd2l1 "polycystic kidney disease 2-like 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|1310272 Pkd2l2 "polycystic kidney disease 2-like 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q2TBW4 PKD2L2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PGE3 PKD2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|1559992 Pkd2 "polycystic kidney disease 2 (autosomal dominant)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query91
pfam08016 423 pfam08016, PKD_channel, Polycystin cation channel 1e-13
>gnl|CDD|219699 pfam08016, PKD_channel, Polycystin cation channel Back     alignment and domain information
 Score = 63.9 bits (156), Expect = 1e-13
 Identities = 25/67 (37%), Positives = 38/67 (56%)

Query: 25  WDSDYYTGQVGSYPYSGFYQDLSANHNDFLAQLDMLRKGGWITRATRVVFIDFSMYNANV 84
               ++ G + SYP  G+   L  +  + L +L  L+   W+ R TR VF++F++YNAN 
Sbjct: 109 LMGAWHWGHLASYPSGGYVVLLPLSREESLKRLAYLQDHNWLDRRTRAVFVEFTLYNANT 168

Query: 85  NLFCFVK 91
           NLFC V 
Sbjct: 169 NLFCVVT 175


This family contains the cation channel region of PKD1 and PKD2 proteins. Length = 423

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 91
PF08016 425 PKD_channel: Polycystin cation channel; InterPro: 99.9
KOG3599|consensus 798 99.87
PLN03223 1634 Polycystin cation channel protein; Provisional 99.69
smart0041948 HTH_CRP helix_turn_helix, cAMP Regulatory protein. 80.82
>PF08016 PKD_channel: Polycystin cation channel; InterPro: IPR013122 Polycystic kidney diseases (PKD) are disorders characterised by large numbers of cysts distributed throughout grossly-enlarged kidneys Back     alignment and domain information
Probab=99.90  E-value=4.8e-24  Score=167.58  Aligned_cols=64  Identities=41%  Similarity=0.758  Sum_probs=61.1

Q ss_pred             CCccceeeecCCCCeEEECCCCHHHHHHHHHHhhhCCcccCCCcEEEEEeeeeecCCceEEEeC
Q psy14514         28 DYYTGQVGSYPYSGFYQDLSANHNDFLAQLDMLRKGGWITRATRVVFIDFSMYNANVNLFCFVK   91 (91)
Q Consensus        28 ~~~~G~~~~Y~gGGYv~~L~~~~~~a~~~L~~L~~~~WiD~~TRAvfvEFtlYN~n~nLF~vVk   91 (91)
                      .|+.|++++|+||||+++|++++++|.++|++||+++|||++||||+|||++||||+||||+|+
T Consensus       114 ~~~~G~~~~Y~~gGY~~~L~~~~~~a~~~l~~L~~~~WiD~~Trav~vef~~YN~~~nlf~~v~  177 (425)
T PF08016_consen  114 YPYWGQFGTYGGGGYVVDLGRNKDEARSILQYLQQNNWIDRSTRAVFVEFTLYNPNTNLFSVVT  177 (425)
T ss_pred             CceeeeeeeeCCCcEEEECCCCHHHHHHHHHHHHhCcCcccCCceEEEEEEEEcCCCCeeEEEE
Confidence            3455999999999999999999999999999999999999999999999999999999999985



Cyst development is associated with impairment of kidney function, and ultimately kidney failure and death []. Most cases of autosomal dominant PKD result from mutations in the PKD1 gene that cause premature protein termination. A second gene for autosomal dominant polycystic kidney disease has been identified by positional cloning []. The predicted 968-amino acid sequence of the PKD2 gene product (polycystin-2) contains 6 transmembrane domains, with intracellular N- and C-termini. Polycystin-2 shares some similarity with the family of voltage-activated calcium (and sodium) channels, and contains a potential calcium-binding domain. Polycystin-2 is strongly expressed in ovary, foetal and adult kidney, testis, and small intestine. Polycystin-1 requires the presence of this protein for stable expression and is believed to interact with it via its C terminus. All mutations between exons 1 and 11 result in a truncated polycystin-2 that lacks a calcium-binding EF-hand domain and the cytoplasmic domains required for the interaction of polycystin-2 with polycystin-1 []. PKD2, although clinically milder than PKD1, has a deleterious impact on life expectancy. This entry contains proteins belonging to the polycystin family including Mucolipin and Polycystin-1 and -2 (PKD1 and PKD2). The domain contains the cation channel region of PKD1 and PKD2 proteins. PKD1 and PKD2 may function through a common signalling pathway that is necessary for normal tubulogenesis. The PKD2 gene product has six transmembrane spans with intracellular amino- and carboxyl-termini []. Mucolipin is a cationic channel which probably plays a role in the endocytic pathway and in the control of membrane trafficking of proteins and lipids. It could play a major role in the calcium ion transport regulating lysosomal exocytosis [, , ].

>KOG3599|consensus Back     alignment and domain information
>PLN03223 Polycystin cation channel protein; Provisional Back     alignment and domain information
>smart00419 HTH_CRP helix_turn_helix, cAMP Regulatory protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

No hit with probability above 80.00


Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

No hit with probability above 80.00