Psyllid ID: psy14585


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60------
MPSLEPVTGDQDDVISGMISPPSPQSGGAPTTGNDEAAMAVIMSLLEADAGLGGPVDFSGLPWPLP
ccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHccccccccccccccccc
ccccccccccccccccccEcccccccccccccccHHHHHHHHHHHHHHHccccccccccccccccc
mpslepvtgdqddvisgmisppspqsggapttgndEAAMAVIMSLLEadaglggpvdfsglpwplp
mpslepvtgdqddvISGMISPPSPQSGGAPTTGNDEAAMAVIMSLLEADaglggpvdfsglpwplp
MPSLEPVTGDQDDVISGMISPPSPQSGGAPTTGNDEAAMAVIMSLLEADAGLGGPVDFSGLPWPLP
***************************************AVIMSLLEADAGLGGPVDF********
**************************************MAVIMSLLEADAGLGGPVDFSGLPWPL*
*********DQDDVISGMISP**********TGNDEAAMAVIMSLLEADAGLGGPVDFSGLPWPLP
*******************************************SLLEADAGLGGPVDFSGLPWPLP
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooo
ooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPSLEPVTGDQDDVISGMISPPSPQSGGAPTTGNDEAAMAVIMSLLEADAGLGGPVDFSGLPWPLP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query66 2.2.26 [Sep-21-2011]
Q9I8T7633 Aryl hydrocarbon receptor yes N/A 0.575 0.060 0.842 2e-11
Q6YGZ5633 Aryl hydrocarbon receptor N/A N/A 0.575 0.060 0.842 2e-11
Q5R4T2625 Aryl hydrocarbon receptor yes N/A 0.575 0.060 0.842 3e-11
O00327626 Aryl hydrocarbon receptor yes N/A 0.575 0.060 0.842 3e-11
Q91YA9626 Aryl hydrocarbon receptor N/A N/A 0.575 0.060 0.842 3e-11
O88529626 Aryl hydrocarbon receptor N/A N/A 0.575 0.060 0.842 3e-11
Q9EPW1626 Aryl hydrocarbon receptor yes N/A 0.575 0.060 0.842 3e-11
A0MLS5626 Aryl hydrocarbon receptor yes N/A 0.575 0.060 0.842 3e-11
Q9WTL8632 Aryl hydrocarbon receptor yes N/A 0.575 0.060 0.842 3e-11
>sp|Q9I8T7|BMAL1_CHICK Aryl hydrocarbon receptor nuclear translocator-like protein 1 OS=Gallus gallus GN=ARNTL PE=1 SV=1 Back     alignment and function desciption
 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 34/38 (89%)

Query: 28  GAPTTGNDEAAMAVIMSLLEADAGLGGPVDFSGLPWPL 65
           G+ +  NDEAAMAVIMSLLEADAGLGGPVDFS LPWPL
Sbjct: 596 GSSSPSNDEAAMAVIMSLLEADAGLGGPVDFSDLPWPL 633




ARNTL-CLOCK heterodimers activate E-box element (3'-CACGTG-5') transcription of a number of proteins of the circadian clock. This transcription is inhibited in a feedback loop by PER, and also by CRY proteins.
Gallus gallus (taxid: 9031)
>sp|Q6YGZ5|BMAL1_TYTAL Aryl hydrocarbon receptor nuclear translocator-like protein 1 OS=Tyto alba GN=ARNTL PE=2 SV=1 Back     alignment and function description
>sp|Q5R4T2|BMAL1_PONAB Aryl hydrocarbon receptor nuclear translocator-like protein 1 OS=Pongo abelii GN=ARNTL PE=2 SV=1 Back     alignment and function description
>sp|O00327|BMAL1_HUMAN Aryl hydrocarbon receptor nuclear translocator-like protein 1 OS=Homo sapiens GN=ARNTL PE=1 SV=2 Back     alignment and function description
>sp|Q91YA9|BMAL1_NANGA Aryl hydrocarbon receptor nuclear translocator-like protein 1 OS=Nannospalax galili GN=Arntl PE=1 SV=1 Back     alignment and function description
>sp|O88529|BMAL1_MESAU Aryl hydrocarbon receptor nuclear translocator-like protein 1 OS=Mesocricetus auratus GN=ARNTL PE=2 SV=1 Back     alignment and function description
>sp|Q9EPW1|BMAL1_RAT Aryl hydrocarbon receptor nuclear translocator-like protein 1 OS=Rattus norvegicus GN=Arntl PE=2 SV=4 Back     alignment and function description
>sp|A0MLS5|BMAL1_HORSE Aryl hydrocarbon receptor nuclear translocator-like protein 1 OS=Equus caballus GN=ARNTL PE=2 SV=1 Back     alignment and function description
>sp|Q9WTL8|BMAL1_MOUSE Aryl hydrocarbon receptor nuclear translocator-like protein 1 OS=Mus musculus GN=Arntl PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query66
157126327 657 circadian protein clock/arnt/bmal/pas [A 0.742 0.074 0.764 1e-13
157126329 647 circadian protein clock/arnt/bmal/pas [A 0.742 0.075 0.764 1e-13
345484580 823 PREDICTED: aryl hydrocarbon receptor nuc 0.848 0.068 0.716 2e-13
116235171 611 CYCLE [Athalia rosae] 0.787 0.085 0.740 3e-13
158294552 642 AGAP005655-PA [Anopheles gambiae str. PE 0.772 0.079 0.735 4e-13
371534934 744 cycle protein [Aedes aegypti] 0.742 0.065 0.745 6e-13
380014080 830 PREDICTED: aryl hydrocarbon receptor nuc 0.878 0.069 0.7 7e-13
121945613 601 circadian transcription modulator CYCLE 0.848 0.093 0.736 7e-13
328776724 925 PREDICTED: cycle [Apis mellifera] 0.878 0.062 0.7 8e-13
305682540 644 CYCLE [Thermobia domestica] 0.787 0.080 0.754 8e-13
>gi|157126327|ref|XP_001654596.1| circadian protein clock/arnt/bmal/pas [Aedes aegypti] gi|108882568|gb|EAT46793.1| AAEL002049-PA, partial [Aedes aegypti] Back     alignment and taxonomy information
 Score = 80.5 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 39/51 (76%), Positives = 41/51 (80%), Gaps = 2/51 (3%)

Query: 18  MISPPS--PQSGGAPTTGNDEAAMAVIMSLLEADAGLGGPVDFSGLPWPLP 66
           ++SP    P S    T GNDEAAMAVIMSLLEADAGLGGPVDFSGLPWPLP
Sbjct: 607 IVSPEHEVPHSQANSTDGNDEAAMAVIMSLLEADAGLGGPVDFSGLPWPLP 657




Source: Aedes aegypti

Species: Aedes aegypti

Genus: Aedes

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|157126329|ref|XP_001654597.1| circadian protein clock/arnt/bmal/pas [Aedes aegypti] gi|108882569|gb|EAT46794.1| AAEL002049-PB, partial [Aedes aegypti] Back     alignment and taxonomy information
>gi|345484580|ref|XP_001602684.2| PREDICTED: aryl hydrocarbon receptor nuclear translocator-like protein 1-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|116235171|dbj|BAF35030.1| CYCLE [Athalia rosae] Back     alignment and taxonomy information
>gi|158294552|ref|XP_556301.3| AGAP005655-PA [Anopheles gambiae str. PEST] gi|157015616|gb|EAL39880.3| AGAP005655-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|371534934|gb|AEX32872.1| cycle protein [Aedes aegypti] Back     alignment and taxonomy information
>gi|380014080|ref|XP_003691071.1| PREDICTED: aryl hydrocarbon receptor nuclear translocator-like protein 1-like [Apis florea] Back     alignment and taxonomy information
>gi|121945613|dbj|BAF44540.1| circadian transcription modulator CYCLE [Dianemobius nigrofasciatus] Back     alignment and taxonomy information
>gi|328776724|ref|XP_001121441.2| PREDICTED: cycle [Apis mellifera] Back     alignment and taxonomy information
>gi|305682540|dbj|BAJ16354.1| CYCLE [Thermobia domestica] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query66
UNIPROTKB|Q5R4T2625 ARNTL "Aryl hydrocarbon recept 0.575 0.060 0.842 5e-12
UNIPROTKB|O00327626 ARNTL "Aryl hydrocarbon recept 0.575 0.060 0.842 5e-12
UNIPROTKB|Q91YA9626 Arntl "Aryl hydrocarbon recept 0.833 0.087 0.610 2.3e-11
UNIPROTKB|E1BLF5626 ARNTL "Uncharacterized protein 0.575 0.060 0.842 2.9e-11
UNIPROTKB|A0MLS5626 ARNTL "Aryl hydrocarbon recept 0.575 0.060 0.842 2.9e-11
UNIPROTKB|O88529626 ARNTL "Aryl hydrocarbon recept 0.575 0.060 0.842 2.9e-11
RGD|62003626 Arntl "aryl hydrocarbon recept 0.575 0.060 0.842 2.9e-11
UNIPROTKB|Q9EPW1626 Arntl "Aryl hydrocarbon recept 0.575 0.060 0.842 2.9e-11
ZFIN|ZDB-GENE-000509-1626 arntl1a "aryl hydrocarbon rece 0.575 0.060 0.842 2.9e-11
UNIPROTKB|E2R130627 ARNTL "Uncharacterized protein 0.575 0.060 0.842 2.9e-11
UNIPROTKB|Q5R4T2 ARNTL "Aryl hydrocarbon receptor nuclear translocator-like protein 1" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
 Score = 165 (63.1 bits), Expect = 5.0e-12, Sum P(2) = 5.0e-12
 Identities = 32/38 (84%), Positives = 34/38 (89%)

Query:    28 GAPTTGNDEAAMAVIMSLLEADAGLGGPVDFSGLPWPL 65
             G+ +  NDEAAMAVIMSLLEADAGLGGPVDFS LPWPL
Sbjct:   588 GSSSPSNDEAAMAVIMSLLEADAGLGGPVDFSDLPWPL 625


GO:0005667 "transcription factor complex" evidence=ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
GO:0032922 "circadian regulation of gene expression" evidence=ISS
UNIPROTKB|O00327 ARNTL "Aryl hydrocarbon receptor nuclear translocator-like protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q91YA9 Arntl "Aryl hydrocarbon receptor nuclear translocator-like protein 1" [Nannospalax galili (taxid:1026970)] Back     alignment and assigned GO terms
UNIPROTKB|E1BLF5 ARNTL "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|A0MLS5 ARNTL "Aryl hydrocarbon receptor nuclear translocator-like protein 1" [Equus caballus (taxid:9796)] Back     alignment and assigned GO terms
UNIPROTKB|O88529 ARNTL "Aryl hydrocarbon receptor nuclear translocator-like protein 1" [Mesocricetus auratus (taxid:10036)] Back     alignment and assigned GO terms
RGD|62003 Arntl "aryl hydrocarbon receptor nuclear translocator-like" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q9EPW1 Arntl "Aryl hydrocarbon receptor nuclear translocator-like protein 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-000509-1 arntl1a "aryl hydrocarbon receptor nuclear translocator-like 1a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E2R130 ARNTL "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9EPW1BMAL1_RATNo assigned EC number0.84210.57570.0607yesN/A
Q5R4T2BMAL1_PONABNo assigned EC number0.84210.57570.0608yesN/A
O00327BMAL1_HUMANNo assigned EC number0.84210.57570.0607yesN/A
Q9I8T7BMAL1_CHICKNo assigned EC number0.84210.57570.0600yesN/A
A0MLS5BMAL1_HORSENo assigned EC number0.84210.57570.0607yesN/A
Q9WTL8BMAL1_MOUSENo assigned EC number0.84210.57570.0601yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

No hit with probability above 80.00


Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

No hit with probability above 80.00


Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

No hit with probability above 80.00