Psyllid ID: psy14589


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-----
GEPLPRVDYTAEETKTWGEVFRNLTKLYPTHACKEHNHVFPLLIQNCGYAEDNIPQLEDISKFLKDSTGFSLRPVAGLLSSRDFLAGLAFRVFHSTQYIRHPSKPLYTPEPDTLFIIGANRGNGLAAIQVGKAYGLTVFASVGCPVGVAKAYGLGADYVVDHTIRELDRFANQILSYGSELDADHPGFTDPVYRARRKYFADLAFNYKHFFFFFFFFFFFFFFFFFFYFFFFFFFFFYFFYFLLLSQPLIQSCHSCPFSLFDFVIFSNHQDEVGALAKTLKLFKKHNVNLLHIESRSSTRIENNYEFMVECAPGGDLSSVIESLRSSCSYINIISRNHNQFHGVPWFPRRIRELDRFANQILSYGSELDADHPGFTDPVYRARRKYFADLAFNYKHSILLMPEHNHVFPLLIQNCGYAEDNIPQLEDISKFLKDSTGFSLRPVAGLLSSRDFLAGLAFRVFHSTQYIRHPSKPLYTPEPDVCHELLGHVPLFADPSFAQFSQEIGLASLGAPDEYVERLATSNNFMIVPRLASLSPDSTGFSLRPVAGLLSSRDFLAGLAFRVFHSTQYIRHPSKPLYTPEPDVCHELLGHVPLFADPSFAQFSQEIGLASLGAPYLFYYVCHELLGHVPLFADPSFAQFSQEIGLASLGAPWLL
ccccccccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHccccccccccHHHHHHHHHHccccEEEEccccccHHHHHHHHHccEEcccccccccccccccccccEEEEcccccccccHHHHHHHHHHHHHccccccccccccccccccccEEEcccccccccccccccccccccccccccccHHHHHcHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEccccccccccccccccEEEEEEEccccccHHHHHHHHHHHcccEEEEEEccccccccccEEEEEEEcccccHHHHHHHHHccccEEEEEcccccccccccccccHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccccccccHHHHHHHHHHccccEEEEccccccHHHHHHHHHccccccccccccccccccccccHHHHHHHccccccccHHHHHHHHHHHHHcccccHHHHHHHHHccccHHHHHHccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccHHHHHHcccccccccHHHHHHHHHHHHccccccccccHHHHHHHHHccccccccccccccccccccccccccc
ccccccccccHHHHHHHHHHHHHHHHHHHHHEcHHHHHHHHHHHHHHccEccEcccHHHHHHHHHHHcccEEEEcccEccHHHHHHHHcccEEEEcccccccccccccccccHHHHHHccccccHHHHHHHHHHcccccccHHHHHHHcEEEEEEEEccHHcEHHHHHHHHHHcccccHHHcccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHccccccccccEEEEEEcccccHHHHHHHHHHHHHcccEEEEEEEcccccccccEEEEEEEcccHHHHHHHHHHHHHHcHEEEEcccccccccccccccEHHHHHHHHHHcccccHHHcccccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccEccEcccHHHHHHHHHHHHccEEEEccccccHHHHHHHHcccEEEEcccccccccccccccccHHHHHHHcHHHHccHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccHccccccccHHHccEEEEEcccccHHHHHHHHHccEEEEEccccccccccccccccHHHHHHHHcHHHHcHHHHHHHHHHHHHHHHccccHHHHHHHHHHcHHHHccHHHHHHHHHHHHHHccccccc
geplprvdytaeeTKTWGEVFRNLTklypthackehnhvfplliqncgyaednipqLEDISKFLkdstgfslrpvagllsSRDFLAGLAFRVFhstqyirhpskplytpepdtLFIIGANRGNGLAAIQVGKAYGLTVFASVGCPVGVAKAYGLGADYVVDHTIRELDRFANQILSYgseldadhpgftdpVYRARRKYFADLAFNYkhffffffffffffffffffyffffFFFFFYFFYFLLlsqpliqschscpfslfdFVIFSNHQDEVGALAKTLKLFKKHNVNLLHIESRSSTRIENNYEFMvecapggdlsSVIESLRSSCSYINIISrnhnqfhgvpwfprRIRELDRFANQILSYgseldadhpgftdpVYRARRKYFADLAFNYKhsillmpehnhvfplliqncgyaednipqLEDISKFLkdstgfslrpvagllsSRDFLAGLAFRVFhstqyirhpskplytpepdvchellghvplfadpsfaqfSQEIGlaslgapdEYVERLatsnnfmivprlaslspdstgfslrpvagllsSRDFLAGLAFRVFhstqyirhpskplytpepdvchellghvplfadpsfaqfSQEIGLaslgapylFYYVCHELlghvplfadpsfaqFSQEIGLaslgapwll
geplprvdytaeetktwgeVFRNLTKLYPTHACKEHNHVFPLLIQNCGYAEDNIPQLEDISKFLKDSTGFSLRPVAGLLSSRDFLAGLAFRVFHSTQYIRHPSKPLYTPEPDTLFIIGANRGNGLAAIQVGKAYGLTVFASVGCPVGVAKAYGLGADYVVDHTIRELDRFANQILSygseldadhpGFTDPVYRARRKYFADLAFNYKHFFFFFFFFFFFFFFFFFFYFFFFFFFFFYFFYFLLLSQPLIQSCHSCPFSLFDFVIFSNHQDEVGALAKTLKLFKKHnvnllhiesrsstrieNNYEFMVECAPGGDLSSVIESLRSSCSYINIISrnhnqfhgvPWFPRRIRELDRFANQILSygseldadhpgFTDPVYRARRKYFADLAFNYKHSILLMPEHNHVFPLLIQNCGYAEDNIPQLEDISKFLKDSTGFSLRPVAGLLSSRDFLAGLAFRVFHSTQYIRHPSKPLYTPEPDVCHELLGHVPLFADPSFAQFSQEIGLASLGAPDEYVERLATSNNFMIVPRLASLSPDSTGFSLRPVAGLLSSRDFLAGLAFRVFHSTQYIRHPSKPLYTPEPDVCHELLGHVPLFADPSFAQFSQEIGLASLGAPYLFYYVCHELLGHVPLFADPSFAQFSQEIGLASLGAPWLL
GEPLPRVDYTAEETKTWGEVFRNLTKLYPTHACKEHNHVFPLLIQNCGYAEDNIPQLEDISKFLKDSTGFSLRPVAGLLSSRDFLAGLAFRVFHSTQYIRHPSKPLYTPEPDTLFIIGANRGNGLAAIQVGKAYGLTVFASVGCPVGVAKAYGLGADYVVDHTIRELDRFANQILSYGSELDADHPGFTDPVYRARRKYFADLAFNYKHffffffffffffffffffyfffffffffyffyfLLLSQPLIQSCHSCPFSLFDFVIFSNHQDEVGALAKTLKLFKKHNVNLLHIESRSSTRIENNYEFMVECAPGGDLSSVIESLRSSCSYINIISRNHNQFHGVPWFPRRIRELDRFANQILSYGSELDADHPGFTDPVYRARRKYFADLAFNYKHSILLMPEHNHVFPLLIQNCGYAEDNIPQLEDISKFLKDSTGFSLRPVAGLLSSRDFLAGLAFRVFHSTQYIRHPSKPLYTPEPDVCHELLGHVPLFADPSFAQFSQEIGLASLGAPDEYVERLATSNNFMIVPRLASLSPDSTGFSLRPVAGLLSSRDFLAGLAFRVFHSTQYIRHPSKPLYTPEPDVCHELLGHVPLFADPSFAQFSQEIGLASLGAPYLFYYVCHELLGHVPLFADPSFAQFSQEIGLASLGAPWLL
**********AEETKTWGEVFRNLTKLYPTHACKEHNHVFPLLIQNCGYAEDNIPQLEDISKFLKDSTGFSLRPVAGLLSSRDFLAGLAFRVFHSTQYIRHPSKPLYTPEPDTLFIIGANRGNGLAAIQVGKAYGLTVFASVGCPVGVAKAYGLGADYVVDHTIRELDRFANQILSYGSELDADHPGFTDPVYRARRKYFADLAFNYKHFFFFFFFFFFFFFFFFFFYFFFFFFFFFYFFYFLLLSQPLIQSCHSCPFSLFDFVIFSNHQDEVGALAKTLKLFKKHNVNLLHIESRSSTRIENNYEFMVECAPGGDLSSVIESLRSSCSYINIISRNHNQFHGVPWFPRRIRELDRFANQILSYGSELDADHPGFTDPVYRARRKYFADLAFNYKHSILLMPEHNHVFPLLIQNCGYAEDNIPQLEDISKFLKDSTGFSLRPVAGLLSSRDFLAGLAFRVFHSTQYIRHPSKPLYTPEPDVCHELLGHVPLFADPSFAQFSQEIGLASLGAPDEYVERLATSNNFMIVPRLASLSPDSTGFSLRPVAGLLSSRDFLAGLAFRVFHSTQYIRHPSKPLYTPEPDVCHELLGHVPLFADPSFAQFSQEIGLASLGAPYLFYYVCHELLGHVPLFADPSFAQFSQEIGLASLGAPW**
GEPLPRVDYTAEETKTWGEVFRNLTKLYPTHACKEHNHVFPLLIQNCGYAEDNIPQLEDISKFLKDSTGFSLRPVAGLLSSRDFLAGLAFRVFHSTQYIRHPSKPLYTPEPDTLFIIGANRGNGLAAIQVGKAYGLTVFASVGCPVGVAKAYGLGADYVVDHTIRELDRFANQILSYGSELDADHPGFTDPVYRARRKYFADLAFNYKHFFFFFFFFFFFFFFFFFFYFFFFFFFFFYFFYFLL*******************VIFSNHQDEVGALAKTLKLFKKHNVNLLHIESRS****ENNYEFMVECAPGGDLSSVIESLRSSCSYINIISRNHNQFHGVPWFPRRIRELDRFANQILSYGSELDADHPGFTDPVYRARRKYFADLAFNYKHSILLMPEHNHVFPLLIQNCGYAEDNIPQLEDISKFLKDSTGFSLRPVAGLLSSRDFLAGLAFRVFHSTQYIRHPSKPLYTPEPDVCHELLGHVPLFADPSFAQFSQEIGLASLGAPDEYVERLATSNNFMIVPRL***********LRPVAGLLSSRDFLAGLAFRVFHSTQYIRHPSKPLYTPEPDVCHELLGHVPLFADPSFAQFSQEIGLASLGAPYLFYYVCHELLGHVPLFADPSFAQFSQEIGLASLGAPWLL
GEPLPRVDYTAEETKTWGEVFRNLTKLYPTHACKEHNHVFPLLIQNCGYAEDNIPQLEDISKFLKDSTGFSLRPVAGLLSSRDFLAGLAFRVFHSTQYIRHPSKPLYTPEPDTLFIIGANRGNGLAAIQVGKAYGLTVFASVGCPVGVAKAYGLGADYVVDHTIRELDRFANQILSYGSELDADHPGFTDPVYRARRKYFADLAFNYKHFFFFFFFFFFFFFFFFFFYFFFFFFFFFYFFYFLLLSQPLIQSCHSCPFSLFDFVIFSNHQDEVGALAKTLKLFKKHNVNLLHIESRSSTRIENNYEFMVECAPGGDLSSVIESLRSSCSYINIISRNHNQFHGVPWFPRRIRELDRFANQILSYGSELDADHPGFTDPVYRARRKYFADLAFNYKHSILLMPEHNHVFPLLIQNCGYAEDNIPQLEDISKFLKDSTGFSLRPVAGLLSSRDFLAGLAFRVFHSTQYIRHPSKPLYTPEPDVCHELLGHVPLFADPSFAQFSQEIGLASLGAPDEYVERLATSNNFMIVPRLASLSPDSTGFSLRPVAGLLSSRDFLAGLAFRVFHSTQYIRHPSKPLYTPEPDVCHELLGHVPLFADPSFAQFSQEIGLASLGAPYLFYYVCHELLGHVPLFADPSFAQFSQEIGLASLGAPWLL
*EPLPRVDYTAEETKTWGEVFRNLTKLYPTHACKEHNHVFPLLIQNCGYAEDNIPQLEDISKFLKDSTGFSLRPVAGLLSSRDFLAGLAFRVFHSTQYIRHPSKPLYTPEPDTLFIIGANRGNGLAAIQVGKAYGLTVFASVGCPVGVAKAYGLGADYVVDHTIRELDRFANQILSYGSELDADHPGFTDPVYRARRKYFADLAFNYKHFFFFFFFFFFFFFFFFFFYFFFFFFFFFYFFYFLLLSQPLIQSCHSCPFSLFDFVIFSNHQDEVGALAKTLKLFKKHNVNLLHIESRSSTRIENNYEFMVECAPGGDLSSVIESLRSSCSYINIISRNHNQFHGVPWFPRRIRELDRFANQILSYGSELDADHPGFTDPVYRARRKYFADLAFNYKHSILLMPEHNHVFPLLIQNCGYAEDNIPQLEDISKFLKDSTGFSLRPVAGLLSSRDFLAGLAFRVFHSTQYIRHPSKPLYTPEPDVCHELLGHVPLFADPSFAQFSQEIGLASLGAPDEYVERLATSNNFMIVPRLASLSPDSTGFSLRPVAGLLSSRDFLAGLAFRVFHSTQYIRHPSKPLYTPEPDVCHELLGHVPLFADPSFAQFSQEIGLASLGAPYLFYYVCHELLGHVPLFADPSFAQFSQEIGLASLGAPWLL
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
GEPLPRVDYTAEETKTWGEVFRNLTKLYPTHACKEHNHVFPLLIQNCGYAEDNIPQLEDISKFLKDSTGFSLRPVAGLLSSRDFLAGLAFRVFHSTQYIRHPSKPLYTPEPDTLFIIGANRGNGLAAIQVGKAYGLTVFASVGCPVGVAKAYGLGADYVVDHTIRELDRFANQILSYGSELDADHPGFTDPVYRARRKYFADLAFNYKHFFFFFFFFFFFFFFFFFFYFFFFFFFFFYFFYFLLLSQPLIQSCHSCPFSLFDFVIFSNHQDEVGALAKTLKLFKKHNVNLLHIESRSSTRIENNYEFMVECAPGGDLSSVIESLRSSCSYINIISRNHNQFHGVPWFPRRIRELDRFANQILSYGSELDADHPGFTDPVYRARRKYFADLAFNYKHSILLMPEHNHVFPLLIQNCGYAEDNIPQLEDISKFLKDSTGFSLRPVAGLLSSRDFLAGLAFRVFHSTQYIRHPSKPLYTPEPDVCHELLGHVPLFADPSFAQFSQEIGLASLGAPDEYVERLATSNNFMIVPRLASLSPDSTGFSLRPVAGLLSSRDFLAGLAFRVFHSTQYIRHPSKPLYTPEPDVCHELLGHVPLFADPSFAQFSQEIGLASLGAPYLFYYVCHELLGHVPLFADPSFAQFSQEIGLASLGAPWLL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query655 2.2.26 [Sep-21-2011]
P17276452 Protein henna OS=Drosophi yes N/A 0.377 0.546 0.672 1e-103
P04176453 Phenylalanine-4-hydroxyla yes N/A 0.424 0.613 0.573 6e-92
P16331453 Phenylalanine-4-hydroxyla yes N/A 0.424 0.613 0.573 8e-92
P00439452 Phenylalanine-4-hydroxyla yes N/A 0.424 0.615 0.570 4e-90
Q2KIH7451 Phenylalanine-4-hydroxyla yes N/A 0.424 0.616 0.554 4e-89
P90925457 Probable phenylalanine-4- yes N/A 0.425 0.610 0.537 2e-87
P70080445 Tryptophan 5-hydroxylase no N/A 0.392 0.577 0.546 3e-83
P17752444 Tryptophan 5-hydroxylase no N/A 0.421 0.621 0.525 1e-80
Q92142481 Tryptophan 5-hydroxylase N/A N/A 0.387 0.528 0.532 3e-80
P09810444 Tryptophan 5-hydroxylase no N/A 0.425 0.628 0.520 9e-80
>sp|P17276|PH4H_DROME Protein henna OS=Drosophila melanogaster GN=Hn PE=2 SV=3 Back     alignment and function desciption
 Score =  377 bits (967), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 187/278 (67%), Positives = 213/278 (76%), Gaps = 31/278 (11%)

Query: 274 GALAKTLKLFKKHNVNLLHIESRSSTRIENNYEFMVEC-APGGDLSSVIESLRSSCSYIN 332
           GALA  L +FKKH++NL+HIESRSS R+   YEF VE     G L   IE ++  CSY N
Sbjct: 46  GALANILAIFKKHDINLVHIESRSSLRVPG-YEFFVEADGKSGALGKAIEDVKEQCSYFN 104

Query: 333 IISRNH-NQFHGVPWFPRRIRELDRFANQILSYGSELDADHPGFTDPVYRARRKYFADLA 391
           IISR++ +    VPWFPRRIR+LDRFANQILSYGSELDADHPGFTDP YR RRKYFAD+A
Sbjct: 105 IISRDYKDNATAVPWFPRRIRDLDRFANQILSYGSELDADHPGFTDPEYRKRRKYFADIA 164

Query: 392 FNYKHSILL----------------------------MPEHNHVFPLLIQNCGYAEDNIP 423
           +NYKH   L                              E+NHVFPLL+ NCG+ EDNIP
Sbjct: 165 YNYKHGEPLPHVDYTKEEIETWGIIFRNLTKLYKTHACREYNHVFPLLVDNCGFREDNIP 224

Query: 424 QLEDISKFLKDSTGFSLRPVAGLLSSRDFLAGLAFRVFHSTQYIRHPSKPLYTPEPDVCH 483
           QLED+S FL+D TGF+LRPVAGLLSSRDFLAGLAFRVFHSTQYIRHPSKP+YTPEPDVCH
Sbjct: 225 QLEDVSNFLRDCTGFTLRPVAGLLSSRDFLAGLAFRVFHSTQYIRHPSKPMYTPEPDVCH 284

Query: 484 ELLGHVPLFADPSFAQFSQEIGLASLGAPDEYVERLAT 521
           EL+GHVPLFADP+FAQFSQEIGLASLGAPD+Y+E+L+T
Sbjct: 285 ELMGHVPLFADPAFAQFSQEIGLASLGAPDDYIEKLST 322





Drosophila melanogaster (taxid: 7227)
EC: 1EC: .EC: 1EC: 4EC: .EC: 1EC: 6EC: .EC: 4
>sp|P04176|PH4H_RAT Phenylalanine-4-hydroxylase OS=Rattus norvegicus GN=Pah PE=1 SV=3 Back     alignment and function description
>sp|P16331|PH4H_MOUSE Phenylalanine-4-hydroxylase OS=Mus musculus GN=Pah PE=1 SV=4 Back     alignment and function description
>sp|P00439|PH4H_HUMAN Phenylalanine-4-hydroxylase OS=Homo sapiens GN=PAH PE=1 SV=1 Back     alignment and function description
>sp|Q2KIH7|PH4H_BOVIN Phenylalanine-4-hydroxylase OS=Bos taurus GN=PAH PE=2 SV=1 Back     alignment and function description
>sp|P90925|PH4H_CAEEL Probable phenylalanine-4-hydroxylase 1 OS=Caenorhabditis elegans GN=pah-1 PE=1 SV=2 Back     alignment and function description
>sp|P70080|TPH1_CHICK Tryptophan 5-hydroxylase 1 OS=Gallus gallus GN=TPH1 PE=1 SV=1 Back     alignment and function description
>sp|P17752|TPH1_HUMAN Tryptophan 5-hydroxylase 1 OS=Homo sapiens GN=TPH1 PE=1 SV=4 Back     alignment and function description
>sp|Q92142|TPH_XENLA Tryptophan 5-hydroxylase OS=Xenopus laevis GN=tph PE=2 SV=1 Back     alignment and function description
>sp|P09810|TPH1_RAT Tryptophan 5-hydroxylase 1 OS=Rattus norvegicus GN=Tph1 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query655
242017617433 tyrosine/tryptophan monooxygenase, putat 0.435 0.658 0.698 1e-117
307168571439 Protein henna [Camponotus floridanus] 0.435 0.649 0.677 1e-114
66501322463 PREDICTED: protein henna-like isoform 2 0.435 0.615 0.686 1e-114
380013058464 PREDICTED: protein henna-like [Apis flor 0.435 0.614 0.677 1e-113
389885660447 phenylalanine hydroxylase [Polyrhachis v 0.435 0.637 0.667 1e-112
340719082494 PREDICTED: protein henna-like [Bombus te 0.435 0.576 0.670 1e-112
350423313464 PREDICTED: protein henna-like [Bombus im 0.435 0.614 0.670 1e-112
332021702461 Protein henna [Acromyrmex echinatior] 0.442 0.629 0.657 1e-112
156552627459 PREDICTED: protein henna-like [Nasonia v 0.435 0.620 0.667 1e-112
383859706464 PREDICTED: protein henna-like [Megachile 0.435 0.614 0.658 1e-111
>gi|242017617|ref|XP_002429284.1| tyrosine/tryptophan monooxygenase, putative [Pediculus humanus corporis] gi|212514180|gb|EEB16546.1| tyrosine/tryptophan monooxygenase, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  429 bits (1104), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 222/318 (69%), Positives = 245/318 (77%), Gaps = 33/318 (10%)

Query: 264 VIFSNHQDEVGALAKTLKLFKKHNVNLLHIESRSSTRIENNYEFMVECAPGGDLSSVIES 323
           +IFS  +DEVGALAK LK+F+K  VNLLHIESRSS+R  N YEFMVECAPGG+LS+ IE+
Sbjct: 19  LIFSPKEDEVGALAKALKMFEKQKVNLLHIESRSSSRFTNQYEFMVECAPGGNLSAAIET 78

Query: 324 LRSSCSYINIISRNHNQFHG-VPWFPRRIRELDRFANQILSYGSELDADHPGFTDPVYRA 382
           LR  CSY +IISRNH      VPWFPRRIR+LD+FANQILSYGSELD+DHPGFTDPVYRA
Sbjct: 79  LRQHCSYFSIISRNHKDNQDTVPWFPRRIRDLDKFANQILSYGSELDSDHPGFTDPVYRA 138

Query: 383 RRKYFADLAFNYKHS-----------------------ILLMPEH-----NHVFPLLIQN 414
           RRKYFAD+A+NYKH                        + L P H     NHVFPLLI+N
Sbjct: 139 RRKYFADIAYNYKHGEPLPRVDYTEEETKTWGTVFKELVKLYPTHACREYNHVFPLLIEN 198

Query: 415 CGYAEDNIPQLEDISKFLKDSTGFSLRPVAGLLSSRDFLAGLAFRVFHSTQYIRHPSKPL 474
           CGY EDNIPQLEDISKFLKDSTGF+LRPVAGLL+SRDFLAGLAFRVFHSTQYIRH S PL
Sbjct: 199 CGYREDNIPQLEDISKFLKDSTGFTLRPVAGLLASRDFLAGLAFRVFHSTQYIRHHSCPL 258

Query: 475 YTPEPDVCHELLGHVPLFADPSFAQFSQEIGLASLGAPDEYVERLATSNNFMIVPRLASL 534
           YTPEPDVCHELLGHVPLFADP+FAQFSQEIGLASLGAPD+YVE+LAT   F +   L S 
Sbjct: 259 YTPEPDVCHELLGHVPLFADPAFAQFSQEIGLASLGAPDDYVEKLATCYWFTVEFGLCSQ 318

Query: 535 SPDSTGFSLRPVAGLLSS 552
                 +     AGLLSS
Sbjct: 319 DGHLKAYG----AGLLSS 332




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|307168571|gb|EFN61629.1| Protein henna [Camponotus floridanus] Back     alignment and taxonomy information
>gi|66501322|ref|XP_623300.1| PREDICTED: protein henna-like isoform 2 [Apis mellifera] Back     alignment and taxonomy information
>gi|380013058|ref|XP_003690587.1| PREDICTED: protein henna-like [Apis florea] Back     alignment and taxonomy information
>gi|389885660|gb|AFL02790.1| phenylalanine hydroxylase [Polyrhachis vicina] Back     alignment and taxonomy information
>gi|340719082|ref|XP_003397986.1| PREDICTED: protein henna-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350423313|ref|XP_003493441.1| PREDICTED: protein henna-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|332021702|gb|EGI62058.1| Protein henna [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|156552627|ref|XP_001600555.1| PREDICTED: protein henna-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|383859706|ref|XP_003705333.1| PREDICTED: protein henna-like [Megachile rotundata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query655
UNIPROTKB|Q6PKI8446 PAH "Phenylalanine hydroxylase 0.221 0.325 0.754 4.9e-91
ZFIN|ZDB-GENE-031006-2449 pah "phenylalanine hydroxylase 0.222 0.325 0.726 4.4e-90
RGD|3248453 Pah "phenylalanine hydroxylase 0.221 0.320 0.715 1.5e-89
MGI|MGI:97473453 Pah "phenylalanine hydroxylase 0.221 0.320 0.715 1.9e-89
UNIPROTKB|J3KND8447 PAH "Phenylalanine-4-hydroxyla 0.222 0.326 0.7 9.1e-88
UNIPROTKB|P00439452 PAH "Phenylalanine-4-hydroxyla 0.222 0.323 0.7 9.1e-88
UNIPROTKB|E2R366451 PAH "Uncharacterized protein" 0.222 0.323 0.7 1.5e-87
UNIPROTKB|F6XY00581 PAH "Uncharacterized protein" 0.222 0.251 0.7 1.5e-87
WB|WBGene00000240457 pah-1 [Caenorhabditis elegans 0.262 0.376 0.601 2.2e-84
UNIPROTKB|P90925457 pah-1 "Probable phenylalanine- 0.262 0.376 0.601 2.2e-84
UNIPROTKB|Q6PKI8 PAH "Phenylalanine hydroxylase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 567 (204.7 bits), Expect = 4.9e-91, Sum P(2) = 4.9e-91
 Identities = 114/151 (75%), Positives = 125/151 (82%)

Query:   403 EHNHVFPLLIQNCGYAEDNIPQLEDISKFLKDSTGFSLRPVAGLLSSRDFLAGLAFRVFH 462
             EHNHVFPLL + CGY EDNIPQLED+SKFL+  TGF LRPVAGLLSSRDFLAGLAFRVFH
Sbjct:   199 EHNHVFPLLEKYCGYREDNIPQLEDVSKFLQTCTGFRLRPVAGLLSSRDFLAGLAFRVFH 258

Query:   463 STQYIRHPSKPLYTPEPDVCHELLGHVPLFADPSFAQFSQEIGLASLGAPDEYVERLATS 522
             STQYIRH SKP+YTPEPD+CHELLGHVPLFADPSFAQFSQEIGLASLGAPD+++E+LAT 
Sbjct:   259 STQYIRHASKPMYTPEPDICHELLGHVPLFADPSFAQFSQEIGLASLGAPDDFIEKLATV 318

Query:   523 NNFMIVPRLASLSPDSTGFSLRPV-AGLLSS 552
               F +   L        G SL+   AGLLSS
Sbjct:   319 YWFTVEFGLCK-----EGDSLKAYGAGLLSS 344


GO:0005506 "iron ion binding" evidence=IEA
GO:0006559 "L-phenylalanine catabolic process" evidence=IEA
GO:0016597 "amino acid binding" evidence=IEA
GO:0004505 "phenylalanine 4-monooxygenase activity" evidence=IEA
ZFIN|ZDB-GENE-031006-2 pah "phenylalanine hydroxylase" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|3248 Pah "phenylalanine hydroxylase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:97473 Pah "phenylalanine hydroxylase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|J3KND8 PAH "Phenylalanine-4-hydroxylase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P00439 PAH "Phenylalanine-4-hydroxylase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2R366 PAH "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F6XY00 PAH "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
WB|WBGene00000240 pah-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|P90925 pah-1 "Probable phenylalanine-4-hydroxylase 1" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q2KIH7PH4H_BOVIN1, ., 1, 4, ., 1, 6, ., 10.55410.42440.6164yesN/A
P16331PH4H_MOUSE1, ., 1, 4, ., 1, 6, ., 10.57320.42440.6136yesN/A
P04176PH4H_RAT1, ., 1, 4, ., 1, 6, ., 10.57320.42440.6136yesN/A
P00439PH4H_HUMAN1, ., 1, 4, ., 1, 6, ., 10.57000.42440.6150yesN/A
P90925PH4H_CAEEL1, ., 1, 4, ., 1, 6, ., 10.53770.42590.6105yesN/A
P17276PH4H_DROME1, ., 1, 4, ., 1, 6, ., 40.67260.37700.5464yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.14.160.766

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query655
TIGR01268436 TIGR01268, Phe4hydrox_tetr, phenylalanine-4-hydrox 1e-143
cd03347306 cd03347, eu_PheOH, Eukaryotic phenylalanine-4-hydr 1e-114
pfam00351306 pfam00351, Biopterin_H, Biopterin-dependent aromat 1e-105
TIGR01270464 TIGR01270, Trp_5_monoox, tryptophan 5-monooxygenas 1e-103
cd03346287 cd03346, eu_TrpOH, Eukaryotic tryptophan hydroxyla 2e-94
TIGR01269457 TIGR01269, Tyr_3_monoox, tyrosine 3-monooxygenase, 5e-83
cd03345298 cd03345, eu_TyrOH, Eukaryotic tyrosine hydroxylase 4e-82
cd03347306 cd03347, eu_PheOH, Eukaryotic phenylalanine-4-hydr 2e-69
TIGR01268436 TIGR01268, Phe4hydrox_tetr, phenylalanine-4-hydrox 1e-67
pfam00351306 pfam00351, Biopterin_H, Biopterin-dependent aromat 3e-65
cd03346287 cd03346, eu_TrpOH, Eukaryotic tryptophan hydroxyla 1e-59
cd00361221 cd00361, arom_aa_hydroxylase, Biopterin-dependent 4e-57
TIGR01270464 TIGR01270, Trp_5_monoox, tryptophan 5-monooxygenas 7e-56
cd03345298 cd03345, eu_TyrOH, Eukaryotic tyrosine hydroxylase 1e-54
cd03347306 cd03347, eu_PheOH, Eukaryotic phenylalanine-4-hydr 1e-50
cd00361221 cd00361, arom_aa_hydroxylase, Biopterin-dependent 4e-50
TIGR01268436 TIGR01268, Phe4hydrox_tetr, phenylalanine-4-hydrox 4e-49
TIGR01269457 TIGR01269, Tyr_3_monoox, tyrosine 3-monooxygenase, 8e-48
pfam00351306 pfam00351, Biopterin_H, Biopterin-dependent aromat 4e-47
cd03346287 cd03346, eu_TrpOH, Eukaryotic tryptophan hydroxyla 8e-45
cd00361221 cd00361, arom_aa_hydroxylase, Biopterin-dependent 2e-43
TIGR01270464 TIGR01270, Trp_5_monoox, tryptophan 5-monooxygenas 7e-43
cd03345298 cd03345, eu_TyrOH, Eukaryotic tyrosine hydroxylase 3e-42
TIGR01269457 TIGR01269, Tyr_3_monoox, tyrosine 3-monooxygenase, 9e-38
PRK11913275 PRK11913, phhA, phenylalanine 4-monooxygenase; Rev 4e-28
PRK11913275 PRK11913, phhA, phenylalanine 4-monooxygenase; Rev 3e-25
TIGR01268436 TIGR01268, Phe4hydrox_tetr, phenylalanine-4-hydrox 6e-24
cd0490474 cd04904, ACT_AAAH, ACT domain of the nonheme iron- 3e-23
cd03347306 cd03347, eu_PheOH, Eukaryotic phenylalanine-4-hydr 1e-22
PRK11913275 PRK11913, phhA, phenylalanine 4-monooxygenase; Rev 2e-22
cd03348228 cd03348, pro_PheOH, Prokaryotic phenylalanine-4-hy 2e-21
pfam00351306 pfam00351, Biopterin_H, Biopterin-dependent aromat 2e-20
COG3186291 COG3186, COG3186, Phenylalanine-4-hydroxylase [Ami 2e-17
cd03346287 cd03346, eu_TrpOH, Eukaryotic tryptophan hydroxyla 4e-17
cd03348228 cd03348, pro_PheOH, Prokaryotic phenylalanine-4-hy 4e-17
cd03348228 cd03348, pro_PheOH, Prokaryotic phenylalanine-4-hy 8e-17
TIGR01270464 TIGR01270, Trp_5_monoox, tryptophan 5-monooxygenas 1e-16
TIGR01267248 TIGR01267, Phe4hydrox_mono, phenylalanine-4-hydrox 8e-15
cd0488075 cd04880, ACT_AAAH-PDT-like, ACT domain of the nonh 4e-14
cd0493190 cd04931, ACT_PAH, ACT domain of the nonheme iron-d 7e-13
COG3186291 COG3186, COG3186, Phenylalanine-4-hydroxylase [Ami 4e-12
cd0492974 cd04929, ACT_TPH, ACT domain of the nonheme iron-d 6e-12
COG3186291 COG3186, COG3186, Phenylalanine-4-hydroxylase [Ami 1e-11
cd08266342 cd08266, Zn_ADH_like1, Alcohol dehydrogenases of t 4e-11
cd03345298 cd03345, eu_TyrOH, Eukaryotic tyrosine hydroxylase 6e-11
TIGR01267248 TIGR01267, Phe4hydrox_mono, phenylalanine-4-hydrox 1e-09
TIGR01267248 TIGR01267, Phe4hydrox_mono, phenylalanine-4-hydrox 2e-09
TIGR01269457 TIGR01269, Tyr_3_monoox, tyrosine 3-monooxygenase, 3e-09
cd08253325 cd08253, zeta_crystallin, Zeta-crystallin with NAD 8e-09
cd08241323 cd08241, QOR1, Quinone oxidoreductase (QOR) 5e-08
PRK14055362 PRK14055, PRK14055, aromatic amino acid hydroxylas 3e-07
cd05276323 cd05276, p53_inducible_oxidoreductase, PIG3 p53-in 4e-07
cd0211660 cd02116, ACT, ACT domains are commonly involved in 7e-07
PRK14056 578 PRK14056, PRK14056, phenylalanine 4-monooxygenase; 8e-07
COG0604326 COG0604, Qor, NADPH:quinone reductase and related 9e-07
pfam0184266 pfam01842, ACT, ACT domain 1e-06
cd04930115 cd04930, ACT_TH, ACT domain of the nonheme iron-de 2e-06
PRK14055362 PRK14055, PRK14055, aromatic amino acid hydroxylas 3e-06
TIGR02824325 TIGR02824, quinone_pig3, putative NAD(P)H quinone 1e-05
MTH00165 573 MTH00165, ND5, NADH dehydrogenase subunit 5; Provi 1e-05
cd0490580 cd04905, ACT_CM-PDT, C-terminal ACT domain of the 2e-05
cd05188271 cd05188, MDR, Medium chain reductase/dehydrogenase 3e-05
cd08259332 cd08259, Zn_ADH5, Alcohol dehydrogenases of the MD 4e-05
MTH00165 573 MTH00165, ND5, NADH dehydrogenase subunit 5; Provi 5e-05
cd08267319 cd08267, MDR1, Medium chain dehydrogenases/reducta 1e-04
MTH00212160 MTH00212, ND6, NADH dehydrogenase subunit 6; Provi 2e-04
PRK14056 578 PRK14056, PRK14056, phenylalanine 4-monooxygenase; 3e-04
MTH00163445 MTH00163, ND4, NADH dehydrogenase subunit 4; Provi 3e-04
PRK13771334 PRK13771, PRK13771, putative alcohol dehydrogenase 3e-04
cd08252336 cd08252, AL_MDR, Arginate lyase and other MDR fami 4e-04
cd08274350 cd08274, MDR9, Medium chain dehydrogenases/reducta 5e-04
TIGR02817336 TIGR02817, adh_fam_1, zinc-binding alcohol dehydro 6e-04
cd08243320 cd08243, quinone_oxidoreductase_like_1, Quinone ox 7e-04
cd08271325 cd08271, MDR5, Medium chain dehydrogenases/reducta 7e-04
MTH00097121 MTH00097, ND6, NADH dehydrogenase subunit 6; Provi 7e-04
COG0077279 COG0077, PheA, Prephenate dehydratase [Amino acid 8e-04
MTH00163445 MTH00163, ND4, NADH dehydrogenase subunit 4; Provi 9e-04
MTH00163445 MTH00163, ND4, NADH dehydrogenase subunit 4; Provi 0.001
MTH00166160 MTH00166, ND6, NADH dehydrogenase subunit 6; Provi 0.001
MTH00095527 MTH00095, ND5, NADH dehydrogenase subunit 5; Provi 0.001
cd05289309 cd05289, MDR_like_2, alcohol dehydrogenase and qui 0.002
smart00829287 smart00829, PKS_ER, Enoylreductase 0.002
MTH00094403 MTH00094, ND4, NADH dehydrogenase subunit 4; Provi 0.002
cd08268328 cd08268, MDR2, Medium chain dehydrogenases/reducta 0.002
MTH00087195 MTH00087, ATP6, ATP synthase F0 subunit 6; Provisi 0.002
MTH00163445 MTH00163, ND4, NADH dehydrogenase subunit 4; Provi 0.003
MTH00163445 MTH00163, ND4, NADH dehydrogenase subunit 4; Provi 0.003
pfam01529167 pfam01529, zf-DHHC, DHHC palmitoyltransferase 0.003
MTH00094403 MTH00094, ND4, NADH dehydrogenase subunit 4; Provi 0.004
MTH00205448 MTH00205, ND4, NADH dehydrogenase subunit 4; Provi 0.004
PRK11898283 PRK11898, PRK11898, prephenate dehydratase; Provis 0.004
cd08244324 cd08244, MDR_enoyl_red, Possible enoyl reductase 0.004
>gnl|CDD|130335 TIGR01268, Phe4hydrox_tetr, phenylalanine-4-hydroxylase, tetrameric form Back     alignment and domain information
 Score =  424 bits (1091), Expect = e-143
 Identities = 194/321 (60%), Positives = 224/321 (69%), Gaps = 37/321 (11%)

Query: 264 VIFSNHQDEVGALAKTLKLFKKHNVNLLHIESRSSTRIENNYEFMVECA--PGGDLSSVI 321
           +IFS  ++E GALA+TLKLF+ H+VNL HIESR S      YEF VE        L  VI
Sbjct: 19  LIFS-LKEEAGALAETLKLFQAHDVNLTHIESRPSKTHPGEYEFFVEFDEASDRKLEGVI 77

Query: 322 ESLRSSC-SYINIISRNHNQ-FHGVPWFPRRIRELDRFANQILSYGSELDADHPGFTDPV 379
           E LR      +NI+SR++ Q    VPWFPR+I ++DRFANQILSYG+ELDADHPGF DPV
Sbjct: 78  EHLRQKAEVTVNILSRDNKQNKDSVPWFPRKINDIDRFANQILSYGAELDADHPGFKDPV 137

Query: 380 YRARRKYFADLAFNYKH-----SILLMP-----------------------EHNHVFPLL 411
           YRARRK FAD+AFNYKH      +                           E+NH+FPLL
Sbjct: 138 YRARRKQFADIAFNYKHGQPIPRVEYTDEEIATWRTVFNNLTVLYPTHACQEYNHIFPLL 197

Query: 412 IQNCGYAEDNIPQLEDISKFLKDSTGFSLRPVAGLLSSRDFLAGLAFRVFHSTQYIRHPS 471
            QNCG+ EDNIPQLED+S+FL+D TGF+LRPVAGLLSSRDFLAGLAFRVFHSTQYIRH S
Sbjct: 198 QQNCGFREDNIPQLEDVSQFLQDCTGFTLRPVAGLLSSRDFLAGLAFRVFHSTQYIRHHS 257

Query: 472 KPLYTPEPDVCHELLGHVPLFADPSFAQFSQEIGLASLGAPDEYVERLATSNNFMIVPRL 531
           KP+YTPEPD+CHELLGHVPLFAD  FAQFSQEIGLASLGAPD+Y+E+LAT   F I   L
Sbjct: 258 KPMYTPEPDICHELLGHVPLFADVEFAQFSQEIGLASLGAPDDYIEKLATLYWFTIEFGL 317

Query: 532 ASLSPDSTGFSLRPVAGLLSS 552
                +   +     AGLLSS
Sbjct: 318 CKQDGEKKAYG----AGLLSS 334


This model describes the larger, tetrameric form of phenylalanine-4-hydroxylase, as found in metazoans. The enzyme irreversibly converts phenylalanine to tryosine and is known to be the rate-limiting step in phenylalanine catabolism in some systems. It is closely related to metazoan tyrosine 3-monooxygenase and tryptophan 5-monoxygenase, and more distantly to monomeric phenylalanine-4-hydroxylases of some Gram-negative bacteria. The member of this family from Drosophila has been described as having both phenylalanine-4-hydroxylase and tryptophan 5-monoxygenase activity (PMID:1371286). However, a Drosophila member of the tryptophan 5-monoxygenase clade has subsequently been discovered. Length = 436

>gnl|CDD|239463 cd03347, eu_PheOH, Eukaryotic phenylalanine-4-hydroxylase (eu_PheOH); a member of the biopterin-dependent aromatic amino acid hydroxylase family of non-heme, iron(II)-dependent enzymes that also includes prokaryotic phenylalanine-4-hydroxylase (pro_PheOH), eukaryotic tyrosine hydroxylase (TyrOH) and eukaryotic tryptophan hydroxylase (TrpOH) Back     alignment and domain information
>gnl|CDD|201173 pfam00351, Biopterin_H, Biopterin-dependent aromatic amino acid hydroxylase Back     alignment and domain information
>gnl|CDD|130337 TIGR01270, Trp_5_monoox, tryptophan 5-monooxygenase, tetrameric Back     alignment and domain information
>gnl|CDD|239462 cd03346, eu_TrpOH, Eukaryotic tryptophan hydroxylase (TrpOH); a member of the biopterin-dependent aromatic amino acid hydroxylase family of non-heme, iron(II)-dependent enzymes that also includes prokaryotic and eukaryotic phenylalanine-4-hydroxylase (PheOH) and eukaryotic tyrosine hydroxylase (TyrOH) Back     alignment and domain information
>gnl|CDD|130336 TIGR01269, Tyr_3_monoox, tyrosine 3-monooxygenase, tetrameric Back     alignment and domain information
>gnl|CDD|239461 cd03345, eu_TyrOH, Eukaryotic tyrosine hydroxylase (TyrOH); a member of the biopterin-dependent aromatic amino acid hydroxylase family of non-heme, iron(II)-dependent enzymes that also includes prokaryotic and eukaryotic phenylalanine-4-hydroxylase (PheOH) and eukaryotic tryptophan hydroxylase (TrpOH) Back     alignment and domain information
>gnl|CDD|239463 cd03347, eu_PheOH, Eukaryotic phenylalanine-4-hydroxylase (eu_PheOH); a member of the biopterin-dependent aromatic amino acid hydroxylase family of non-heme, iron(II)-dependent enzymes that also includes prokaryotic phenylalanine-4-hydroxylase (pro_PheOH), eukaryotic tyrosine hydroxylase (TyrOH) and eukaryotic tryptophan hydroxylase (TrpOH) Back     alignment and domain information
>gnl|CDD|130335 TIGR01268, Phe4hydrox_tetr, phenylalanine-4-hydroxylase, tetrameric form Back     alignment and domain information
>gnl|CDD|201173 pfam00351, Biopterin_H, Biopterin-dependent aromatic amino acid hydroxylase Back     alignment and domain information
>gnl|CDD|239462 cd03346, eu_TrpOH, Eukaryotic tryptophan hydroxylase (TrpOH); a member of the biopterin-dependent aromatic amino acid hydroxylase family of non-heme, iron(II)-dependent enzymes that also includes prokaryotic and eukaryotic phenylalanine-4-hydroxylase (PheOH) and eukaryotic tyrosine hydroxylase (TyrOH) Back     alignment and domain information
>gnl|CDD|238215 cd00361, arom_aa_hydroxylase, Biopterin-dependent aromatic amino acid hydroxylase; a family of non-heme, iron(II)-dependent enzymes that includes prokaryotic and eukaryotic phenylalanine-4-hydroxylase (PheOH), eukaryotic tyrosine hydroxylase (TyrOH) and eukaryotic tryptophan hydroxylase (TrpOH) Back     alignment and domain information
>gnl|CDD|130337 TIGR01270, Trp_5_monoox, tryptophan 5-monooxygenase, tetrameric Back     alignment and domain information
>gnl|CDD|239461 cd03345, eu_TyrOH, Eukaryotic tyrosine hydroxylase (TyrOH); a member of the biopterin-dependent aromatic amino acid hydroxylase family of non-heme, iron(II)-dependent enzymes that also includes prokaryotic and eukaryotic phenylalanine-4-hydroxylase (PheOH) and eukaryotic tryptophan hydroxylase (TrpOH) Back     alignment and domain information
>gnl|CDD|239463 cd03347, eu_PheOH, Eukaryotic phenylalanine-4-hydroxylase (eu_PheOH); a member of the biopterin-dependent aromatic amino acid hydroxylase family of non-heme, iron(II)-dependent enzymes that also includes prokaryotic phenylalanine-4-hydroxylase (pro_PheOH), eukaryotic tyrosine hydroxylase (TyrOH) and eukaryotic tryptophan hydroxylase (TrpOH) Back     alignment and domain information
>gnl|CDD|238215 cd00361, arom_aa_hydroxylase, Biopterin-dependent aromatic amino acid hydroxylase; a family of non-heme, iron(II)-dependent enzymes that includes prokaryotic and eukaryotic phenylalanine-4-hydroxylase (PheOH), eukaryotic tyrosine hydroxylase (TyrOH) and eukaryotic tryptophan hydroxylase (TrpOH) Back     alignment and domain information
>gnl|CDD|130335 TIGR01268, Phe4hydrox_tetr, phenylalanine-4-hydroxylase, tetrameric form Back     alignment and domain information
>gnl|CDD|130336 TIGR01269, Tyr_3_monoox, tyrosine 3-monooxygenase, tetrameric Back     alignment and domain information
>gnl|CDD|201173 pfam00351, Biopterin_H, Biopterin-dependent aromatic amino acid hydroxylase Back     alignment and domain information
>gnl|CDD|239462 cd03346, eu_TrpOH, Eukaryotic tryptophan hydroxylase (TrpOH); a member of the biopterin-dependent aromatic amino acid hydroxylase family of non-heme, iron(II)-dependent enzymes that also includes prokaryotic and eukaryotic phenylalanine-4-hydroxylase (PheOH) and eukaryotic tyrosine hydroxylase (TyrOH) Back     alignment and domain information
>gnl|CDD|238215 cd00361, arom_aa_hydroxylase, Biopterin-dependent aromatic amino acid hydroxylase; a family of non-heme, iron(II)-dependent enzymes that includes prokaryotic and eukaryotic phenylalanine-4-hydroxylase (PheOH), eukaryotic tyrosine hydroxylase (TyrOH) and eukaryotic tryptophan hydroxylase (TrpOH) Back     alignment and domain information
>gnl|CDD|130337 TIGR01270, Trp_5_monoox, tryptophan 5-monooxygenase, tetrameric Back     alignment and domain information
>gnl|CDD|239461 cd03345, eu_TyrOH, Eukaryotic tyrosine hydroxylase (TyrOH); a member of the biopterin-dependent aromatic amino acid hydroxylase family of non-heme, iron(II)-dependent enzymes that also includes prokaryotic and eukaryotic phenylalanine-4-hydroxylase (PheOH) and eukaryotic tryptophan hydroxylase (TrpOH) Back     alignment and domain information
>gnl|CDD|130336 TIGR01269, Tyr_3_monoox, tyrosine 3-monooxygenase, tetrameric Back     alignment and domain information
>gnl|CDD|237020 PRK11913, phhA, phenylalanine 4-monooxygenase; Reviewed Back     alignment and domain information
>gnl|CDD|237020 PRK11913, phhA, phenylalanine 4-monooxygenase; Reviewed Back     alignment and domain information
>gnl|CDD|130335 TIGR01268, Phe4hydrox_tetr, phenylalanine-4-hydroxylase, tetrameric form Back     alignment and domain information
>gnl|CDD|153176 cd04904, ACT_AAAH, ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) Back     alignment and domain information
>gnl|CDD|239463 cd03347, eu_PheOH, Eukaryotic phenylalanine-4-hydroxylase (eu_PheOH); a member of the biopterin-dependent aromatic amino acid hydroxylase family of non-heme, iron(II)-dependent enzymes that also includes prokaryotic phenylalanine-4-hydroxylase (pro_PheOH), eukaryotic tyrosine hydroxylase (TyrOH) and eukaryotic tryptophan hydroxylase (TrpOH) Back     alignment and domain information
>gnl|CDD|237020 PRK11913, phhA, phenylalanine 4-monooxygenase; Reviewed Back     alignment and domain information
>gnl|CDD|239464 cd03348, pro_PheOH, Prokaryotic phenylalanine-4-hydroxylase (pro_PheOH); a member of the biopterin-dependent aromatic amino acid hydroxylase family of non-heme, iron(II)-dependent enzymes that also includes the eukaryotic proteins, phenylalanine-4-hydroxylase (eu_PheOH), tyrosine hydroxylase (TyrOH) and tryptophan hydroxylase (TrpOH) Back     alignment and domain information
>gnl|CDD|201173 pfam00351, Biopterin_H, Biopterin-dependent aromatic amino acid hydroxylase Back     alignment and domain information
>gnl|CDD|225727 COG3186, COG3186, Phenylalanine-4-hydroxylase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|239462 cd03346, eu_TrpOH, Eukaryotic tryptophan hydroxylase (TrpOH); a member of the biopterin-dependent aromatic amino acid hydroxylase family of non-heme, iron(II)-dependent enzymes that also includes prokaryotic and eukaryotic phenylalanine-4-hydroxylase (PheOH) and eukaryotic tyrosine hydroxylase (TyrOH) Back     alignment and domain information
>gnl|CDD|239464 cd03348, pro_PheOH, Prokaryotic phenylalanine-4-hydroxylase (pro_PheOH); a member of the biopterin-dependent aromatic amino acid hydroxylase family of non-heme, iron(II)-dependent enzymes that also includes the eukaryotic proteins, phenylalanine-4-hydroxylase (eu_PheOH), tyrosine hydroxylase (TyrOH) and tryptophan hydroxylase (TrpOH) Back     alignment and domain information
>gnl|CDD|239464 cd03348, pro_PheOH, Prokaryotic phenylalanine-4-hydroxylase (pro_PheOH); a member of the biopterin-dependent aromatic amino acid hydroxylase family of non-heme, iron(II)-dependent enzymes that also includes the eukaryotic proteins, phenylalanine-4-hydroxylase (eu_PheOH), tyrosine hydroxylase (TyrOH) and tryptophan hydroxylase (TrpOH) Back     alignment and domain information
>gnl|CDD|130337 TIGR01270, Trp_5_monoox, tryptophan 5-monooxygenase, tetrameric Back     alignment and domain information
>gnl|CDD|130334 TIGR01267, Phe4hydrox_mono, phenylalanine-4-hydroxylase, monomeric form Back     alignment and domain information
>gnl|CDD|153152 cd04880, ACT_AAAH-PDT-like, ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) Back     alignment and domain information
>gnl|CDD|153203 cd04931, ACT_PAH, ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, phenylalanine hydroxylases (PAH) Back     alignment and domain information
>gnl|CDD|225727 COG3186, COG3186, Phenylalanine-4-hydroxylase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|153201 cd04929, ACT_TPH, ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, tryptophan hydroxylases (TPH), both peripheral (TPH1) and neuronal (TPH2) enzymes Back     alignment and domain information
>gnl|CDD|225727 COG3186, COG3186, Phenylalanine-4-hydroxylase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|176227 cd08266, Zn_ADH_like1, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|239461 cd03345, eu_TyrOH, Eukaryotic tyrosine hydroxylase (TyrOH); a member of the biopterin-dependent aromatic amino acid hydroxylase family of non-heme, iron(II)-dependent enzymes that also includes prokaryotic and eukaryotic phenylalanine-4-hydroxylase (PheOH) and eukaryotic tryptophan hydroxylase (TrpOH) Back     alignment and domain information
>gnl|CDD|130334 TIGR01267, Phe4hydrox_mono, phenylalanine-4-hydroxylase, monomeric form Back     alignment and domain information
>gnl|CDD|130334 TIGR01267, Phe4hydrox_mono, phenylalanine-4-hydroxylase, monomeric form Back     alignment and domain information
>gnl|CDD|130336 TIGR01269, Tyr_3_monoox, tyrosine 3-monooxygenase, tetrameric Back     alignment and domain information
>gnl|CDD|176215 cd08253, zeta_crystallin, Zeta-crystallin with NADP-dependent quinone reductase activity (QOR) Back     alignment and domain information
>gnl|CDD|176203 cd08241, QOR1, Quinone oxidoreductase (QOR) Back     alignment and domain information
>gnl|CDD|172547 PRK14055, PRK14055, aromatic amino acid hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|176180 cd05276, p53_inducible_oxidoreductase, PIG3 p53-inducible quinone oxidoreductase Back     alignment and domain information
>gnl|CDD|153139 cd02116, ACT, ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme Back     alignment and domain information
>gnl|CDD|237598 PRK14056, PRK14056, phenylalanine 4-monooxygenase; Provisional Back     alignment and domain information
>gnl|CDD|223677 COG0604, Qor, NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
>gnl|CDD|190133 pfam01842, ACT, ACT domain Back     alignment and domain information
>gnl|CDD|153202 cd04930, ACT_TH, ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, tyrosine hydroxylases (TH) Back     alignment and domain information
>gnl|CDD|172547 PRK14055, PRK14055, aromatic amino acid hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|234027 TIGR02824, quinone_pig3, putative NAD(P)H quinone oxidoreductase, PIG3 family Back     alignment and domain information
>gnl|CDD|214444 MTH00165, ND5, NADH dehydrogenase subunit 5; Provisional Back     alignment and domain information
>gnl|CDD|153177 cd04905, ACT_CM-PDT, C-terminal ACT domain of the bifunctional chorismate mutase-prephenate dehydratase (CM-PDT) enzyme and the prephenate dehydratase (PDT) enzyme Back     alignment and domain information
>gnl|CDD|176178 cd05188, MDR, Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176220 cd08259, Zn_ADH5, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|214444 MTH00165, ND5, NADH dehydrogenase subunit 5; Provisional Back     alignment and domain information
>gnl|CDD|176228 cd08267, MDR1, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|214460 MTH00212, ND6, NADH dehydrogenase subunit 6; Provisional Back     alignment and domain information
>gnl|CDD|237598 PRK14056, PRK14056, phenylalanine 4-monooxygenase; Provisional Back     alignment and domain information
>gnl|CDD|214443 MTH00163, ND4, NADH dehydrogenase subunit 4; Provisional Back     alignment and domain information
>gnl|CDD|184316 PRK13771, PRK13771, putative alcohol dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|176214 cd08252, AL_MDR, Arginate lyase and other MDR family members Back     alignment and domain information
>gnl|CDD|176235 cd08274, MDR9, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|234024 TIGR02817, adh_fam_1, zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>gnl|CDD|176205 cd08243, quinone_oxidoreductase_like_1, Quinone oxidoreductase (QOR) Back     alignment and domain information
>gnl|CDD|176232 cd08271, MDR5, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|177159 MTH00097, ND6, NADH dehydrogenase subunit 6; Provisional Back     alignment and domain information
>gnl|CDD|223155 COG0077, PheA, Prephenate dehydratase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|214443 MTH00163, ND4, NADH dehydrogenase subunit 4; Provisional Back     alignment and domain information
>gnl|CDD|214443 MTH00163, ND4, NADH dehydrogenase subunit 4; Provisional Back     alignment and domain information
>gnl|CDD|214445 MTH00166, ND6, NADH dehydrogenase subunit 6; Provisional Back     alignment and domain information
>gnl|CDD|177158 MTH00095, ND5, NADH dehydrogenase subunit 5; Provisional Back     alignment and domain information
>gnl|CDD|176191 cd05289, MDR_like_2, alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases Back     alignment and domain information
>gnl|CDD|214840 smart00829, PKS_ER, Enoylreductase Back     alignment and domain information
>gnl|CDD|177157 MTH00094, ND4, NADH dehydrogenase subunit 4; Provisional Back     alignment and domain information
>gnl|CDD|176229 cd08268, MDR2, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|177152 MTH00087, ATP6, ATP synthase F0 subunit 6; Provisional Back     alignment and domain information
>gnl|CDD|214443 MTH00163, ND4, NADH dehydrogenase subunit 4; Provisional Back     alignment and domain information
>gnl|CDD|214443 MTH00163, ND4, NADH dehydrogenase subunit 4; Provisional Back     alignment and domain information
>gnl|CDD|216554 pfam01529, zf-DHHC, DHHC palmitoyltransferase Back     alignment and domain information
>gnl|CDD|177157 MTH00094, ND4, NADH dehydrogenase subunit 4; Provisional Back     alignment and domain information
>gnl|CDD|214457 MTH00205, ND4, NADH dehydrogenase subunit 4; Provisional Back     alignment and domain information
>gnl|CDD|237013 PRK11898, PRK11898, prephenate dehydratase; Provisional Back     alignment and domain information
>gnl|CDD|176206 cd08244, MDR_enoyl_red, Possible enoyl reductase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 655
KOG3820|consensus461 100.0
TIGR01268436 Phe4hydrox_tetr phenylalanine-4-hydroxylase, tetra 100.0
TIGR01270464 Trp_5_monoox tryptophan 5-monooxygenase, tetrameri 100.0
TIGR01269457 Tyr_3_monoox tyrosine 3-monooxygenase, tetrameric. 100.0
PF00351332 Biopterin_H: Biopterin-dependent aromatic amino ac 100.0
cd03347306 eu_PheOH Eukaryotic phenylalanine-4-hydroxylase (e 100.0
cd03345298 eu_TyrOH Eukaryotic tyrosine hydroxylase (TyrOH); 100.0
cd03346287 eu_TrpOH Eukaryotic tryptophan hydroxylase (TrpOH) 100.0
PRK11913275 phhA phenylalanine 4-monooxygenase; Reviewed 100.0
cd03348228 pro_PheOH Prokaryotic phenylalanine-4-hydroxylase 100.0
cd00361221 arom_aa_hydroxylase Biopterin-dependent aromatic a 100.0
TIGR01267248 Phe4hydrox_mono phenylalanine-4-hydroxylase, monom 100.0
PRK14055362 aromatic amino acid hydroxylase; Provisional 100.0
PRK14056 578 phenylalanine 4-monooxygenase; Provisional 100.0
COG3186291 Phenylalanine-4-hydroxylase [Amino acid transport 100.0
cd03348228 pro_PheOH Prokaryotic phenylalanine-4-hydroxylase 99.97
TIGR01267248 Phe4hydrox_mono phenylalanine-4-hydroxylase, monom 99.97
cd00361221 arom_aa_hydroxylase Biopterin-dependent aromatic a 99.97
PRK11913275 phhA phenylalanine 4-monooxygenase; Reviewed 99.97
cd03346287 eu_TrpOH Eukaryotic tryptophan hydroxylase (TrpOH) 99.96
cd03347306 eu_PheOH Eukaryotic phenylalanine-4-hydroxylase (e 99.96
cd03345298 eu_TyrOH Eukaryotic tyrosine hydroxylase (TyrOH); 99.96
COG3186291 Phenylalanine-4-hydroxylase [Amino acid transport 99.96
TIGR01269457 Tyr_3_monoox tyrosine 3-monooxygenase, tetrameric. 99.95
TIGR01268436 Phe4hydrox_tetr phenylalanine-4-hydroxylase, tetra 99.95
TIGR01270464 Trp_5_monoox tryptophan 5-monooxygenase, tetrameri 99.95
PRK14055362 aromatic amino acid hydroxylase; Provisional 99.94
PRK14056 578 phenylalanine 4-monooxygenase; Provisional 99.94
PF00351332 Biopterin_H: Biopterin-dependent aromatic amino ac 99.94
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 99.92
COG0604326 Qor NADPH:quinone reductase and related Zn-depende 99.9
KOG3820|consensus 461 99.89
KOG1197|consensus336 99.86
KOG0023|consensus360 99.83
PRK09880343 L-idonate 5-dehydrogenase; Provisional 99.78
KOG0024|consensus354 99.78
COG2130340 Putative NADP-dependent oxidoreductases [General f 99.78
KOG1198|consensus347 99.77
COG1063350 Tdh Threonine dehydrogenase and related Zn-depende 99.77
cd08281371 liver_ADH_like1 Zinc-dependent alcohol dehydrogena 99.77
PLN02178375 cinnamyl-alcohol dehydrogenase 99.76
PLN02586360 probable cinnamyl alcohol dehydrogenase 99.76
TIGR03201349 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-Co 99.76
cd08239339 THR_DH_like L-threonine dehydrogenase (TDH)-like. 99.75
TIGR02818368 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydr 99.75
TIGR03366280 HpnZ_proposed putative phosphonate catabolism asso 99.75
TIGR02825325 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15 99.75
PLN03154348 putative allyl alcohol dehydrogenase; Provisional 99.74
PLN02740381 Alcohol dehydrogenase-like 99.74
PLN02827378 Alcohol dehydrogenase-like 99.73
COG0077279 PheA Prephenate dehydratase [Amino acid transport 99.72
TIGR03451358 mycoS_dep_FDH mycothiol-dependent formaldehyde deh 99.72
cd08277365 liver_alcohol_DH_like Liver alcohol dehydrogenase. 99.71
TIGR02822329 adh_fam_2 zinc-binding alcohol dehydrogenase famil 99.71
cd08295338 double_bond_reductase_like Arabidopsis alkenal dou 99.71
COG1062366 AdhC Zn-dependent alcohol dehydrogenases, class II 99.71
cd08294329 leukotriene_B4_DH_like 13-PGR is a bifunctional en 99.7
cd08301369 alcohol_DH_plants Plant alcohol dehydrogenase. NAD 99.7
PLN02514357 cinnamyl-alcohol dehydrogenase 99.69
cd08300368 alcohol_DH_class_III class III alcohol dehydrogena 99.69
PRK11899279 prephenate dehydratase; Provisional 99.69
cd08293345 PTGR2 Prostaglandin reductase. Prostaglandins and 99.68
PRK10309347 galactitol-1-phosphate dehydrogenase; Provisional 99.66
cd08296333 CAD_like Cinnamyl alcohol dehydrogenases (CAD). Ci 99.66
cd08231361 MDR_TM0436_like Hypothetical enzyme TM0436 resembl 99.65
cd08233351 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrog 99.65
cd08246393 crotonyl_coA_red crotonyl-CoA reductase. Crotonyl- 99.64
cd0490474 ACT_AAAH ACT domain of the nonheme iron-dependent, 99.64
PRK11898283 prephenate dehydratase; Provisional 99.64
cd08230355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 99.63
KOG1196|consensus343 99.62
KOG0022|consensus375 99.62
PRK10622386 pheA bifunctional chorismate mutase/prephenate deh 99.61
PLN02317382 arogenate dehydratase 99.61
cd08285351 NADP_ADH NADP(H)-dependent alcohol dehydrogenases. 99.61
TIGR02819393 fdhA_non_GSH formaldehyde dehydrogenase, glutathio 99.6
TIGR01751398 crot-CoA-red crotonyl-CoA reductase. The enzyme mo 99.6
KOG1202|consensus 2376 99.59
cd05278347 FDH_like Formaldehyde dehydrogenases. Formaldehyde 99.58
cd08299373 alcohol_DH_class_I_II_IV class I, II, IV alcohol d 99.57
cd08291324 ETR_like_1 2-enoyl thioester reductase (ETR) like 99.56
cd08292324 ETR_like_2 2-enoyl thioester reductase (ETR) like 99.56
cd08256350 Zn_ADH2 Alcohol dehydrogenases of the MDR family. 99.56
cd08243320 quinone_oxidoreductase_like_1 Quinone oxidoreducta 99.56
cd08265384 Zn_ADH3 Alcohol dehydrogenases of the MDR family. 99.56
PRK09422338 ethanol-active dehydrogenase/acetaldehyde-active r 99.55
cd04930115 ACT_TH ACT domain of the nonheme iron-dependent ar 99.55
TIGR02817336 adh_fam_1 zinc-binding alcohol dehydrogenase famil 99.55
cd08254338 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carbo 99.54
cd0492974 ACT_TPH ACT domain of the nonheme iron-dependent a 99.54
cd08240350 6_hydroxyhexanoate_dh_like 6-hydroxyhexanoate dehy 99.53
cd08283386 FDH_like_1 Glutathione-dependent formaldehyde dehy 99.53
cd08278365 benzyl_alcohol_DH Benzyl alcohol dehydrogenase. Be 99.52
cd0493190 ACT_PAH ACT domain of the nonheme iron-dependent a 99.52
cd05282323 ETR_like 2-enoyl thioester reductase-like. 2-enoyl 99.52
PRK13771334 putative alcohol dehydrogenase; Provisional 99.52
PRK10754327 quinone oxidoreductase, NADPH-dependent; Provision 99.52
cd05284340 arabinose_DH_like D-arabinose dehydrogenase. This 99.52
cd08289326 MDR_yhfp_like Yhfp putative quinone oxidoreductase 99.51
cd08284344 FDH_like_2 Glutathione-dependent formaldehyde dehy 99.51
cd08274350 MDR9 Medium chain dehydrogenases/reductase (MDR)/z 99.51
cd08260345 Zn_ADH6 Alcohol dehydrogenases of the MDR family. 99.51
PF00107130 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: 99.51
cd08297341 CAD3 Cinnamyl alcohol dehydrogenases (CAD). These 99.51
PTZ00354334 alcohol dehydrogenase; Provisional 99.5
cd05279365 Zn_ADH1 Liver alcohol dehydrogenase and related zi 99.5
cd05288329 PGDH Prostaglandin dehydrogenases. Prostaglandins 99.5
cd08263367 Zn_ADH10 Alcohol dehydrogenases of the MDR family. 99.5
cd08279363 Zn_ADH_class_III Class III alcohol dehydrogenase. 99.49
cd08264325 Zn_ADH_like2 Alcohol dehydrogenases of the MDR fam 99.49
cd05285343 sorbitol_DH Sorbitol dehydrogenase. Sorbitol and a 99.49
KOG0025|consensus354 99.49
PRK10083339 putative oxidoreductase; Provisional 99.49
cd08290341 ETR 2-enoyl thioester reductase (ETR). 2-enoyl thi 99.48
cd08259332 Zn_ADH5 Alcohol dehydrogenases of the MDR family. 99.48
cd08237341 ribitol-5-phosphate_DH ribitol-5-phosphate dehydro 99.48
cd08266342 Zn_ADH_like1 Alcohol dehydrogenases of the MDR fam 99.48
cd08244324 MDR_enoyl_red Possible enoyl reductase. Member ide 99.48
cd08238410 sorbose_phosphate_red L-sorbose-1-phosphate reduct 99.48
cd0488075 ACT_AAAH-PDT-like ACT domain of the nonheme iron-d 99.46
cd05286320 QOR2 Quinone oxidoreductase (QOR). Quinone oxidore 99.46
TIGR01202308 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl 99.46
cd08287345 FDH_like_ADH3 formaldehyde dehydrogenase (FDH)-lik 99.46
cd05188271 MDR Medium chain reductase/dehydrogenase (MDR)/zin 99.46
cd08261337 Zn_ADH7 Alcohol dehydrogenases of the MDR family. 99.45
cd05280325 MDR_yhdh_yhfp Yhdh and yhfp-like putative quinone 99.45
cd05283337 CAD1 Cinnamyl alcohol dehydrogenases (CAD). Cinnam 99.45
cd05195293 enoyl_red enoyl reductase of polyketide synthase. 99.44
cd08251303 polyketide_synthase polyketide synthase. Polyketid 99.44
smart00829288 PKS_ER Enoylreductase. Enoylreductase in Polyketid 99.43
cd08250329 Mgc45594_like Mgc45594 gene product and other MDR 99.43
cd08249339 enoyl_reductase_like enoyl_reductase_like. Member 99.43
TIGR02823323 oxido_YhdH putative quinone oxidoreductase, YhdH/Y 99.43
cd08252336 AL_MDR Arginate lyase and other MDR family members 99.42
cd08286345 FDH_like_ADH2 formaldehyde dehydrogenase (FDH)-lik 99.42
cd0490580 ACT_CM-PDT C-terminal ACT domain of the bifunction 99.41
cd08276336 MDR7 Medium chain dehydrogenases/reductase (MDR)/z 99.41
cd08298329 CAD2 Cinnamyl alcohol dehydrogenases (CAD). These 99.41
cd08282375 PFDH_like Pseudomonas putida aldehyde-dismutating 99.4
cd08270305 MDR4 Medium chain dehydrogenases/reductase (MDR)/z 99.39
cd08245330 CAD Cinnamyl alcohol dehydrogenases (CAD) and rela 99.39
cd08253325 zeta_crystallin Zeta-crystallin with NADP-dependen 99.39
cd08262341 Zn_ADH8 Alcohol dehydrogenases of the MDR family. 99.39
cd08235343 iditol_2_DH_like L-iditol 2-dehydrogenase. Putativ 99.38
PLN02702364 L-idonate 5-dehydrogenase 99.37
cd08258306 Zn_ADH4 Alcohol dehydrogenases of the MDR family. 99.37
cd08248350 RTN4I1 Human Reticulon 4 Interacting Protein 1. Hu 99.37
TIGR02824325 quinone_pig3 putative NAD(P)H quinone oxidoreducta 99.37
PRK05396341 tdh L-threonine 3-dehydrogenase; Validated 99.37
cd08288324 MDR_yhdh Yhdh putative quinone oxidoreductases. Yh 99.35
cd05276323 p53_inducible_oxidoreductase PIG3 p53-inducible qu 99.35
cd08241323 QOR1 Quinone oxidoreductase (QOR). QOR catalyzes t 99.32
cd08268328 MDR2 Medium chain dehydrogenases/reductase (MDR)/z 99.31
cd08236343 sugar_DH NAD(P)-dependent sugar dehydrogenases. Th 99.31
cd08273331 MDR8 Medium chain dehydrogenases/reductase (MDR)/z 99.31
cd08272326 MDR6 Medium chain dehydrogenases/reductase (MDR)/z 99.31
cd08269312 Zn_ADH9 Alcohol dehydrogenases of the MDR family. 99.31
cd08267319 MDR1 Medium chain dehydrogenases/reductase (MDR)/z 99.31
cd05289309 MDR_like_2 alcohol dehydrogenase and quinone reduc 99.31
cd08247352 AST1_like AST1 is a cytoplasmic protein associated 99.3
TIGR00692340 tdh L-threonine 3-dehydrogenase. E. coli His-90 mo 99.29
cd08271325 MDR5 Medium chain dehydrogenases/reductase (MDR)/z 99.29
cd08232339 idonate-5-DH L-idonate 5-dehydrogenase. L-idonate 99.29
cd08234334 threonine_DH_like L-threonine dehydrogenase. L-thr 99.28
cd05281341 TDH Threonine dehydrogenase. L-threonine dehydroge 99.26
cd08255277 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_ 99.24
cd08242319 MDR_like Medium chain dehydrogenases/reductase (MD 99.24
cd08275337 MDR3 Medium chain dehydrogenases/reductase (MDR)/z 99.22
KOG2797|consensus377 99.12
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 98.9
PRK09424509 pntA NAD(P) transhydrogenase subunit alpha; Provis 98.89
TIGR00561511 pntA NAD(P) transhydrogenase, alpha subunit. In so 98.15
TIGR00936406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 98.14
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 98.12
PLN02494477 adenosylhomocysteinase 98.02
PRK08306296 dipicolinate synthase subunit A; Reviewed 97.79
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.77
PRK05693274 short chain dehydrogenase; Provisional 97.74
PTZ00075476 Adenosylhomocysteinase; Provisional 97.68
PRK08818370 prephenate dehydrogenase; Provisional 97.63
PRK12742237 oxidoreductase; Provisional 97.61
PRK11873272 arsM arsenite S-adenosylmethyltransferase; Reviewe 97.6
PRK06182273 short chain dehydrogenase; Validated 97.59
PRK08324681 short chain dehydrogenase; Validated 97.52
COG4221246 Short-chain alcohol dehydrogenase of unknown speci 97.52
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 97.52
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 97.5
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 97.49
PRK05993277 short chain dehydrogenase; Provisional 97.36
PRK07109334 short chain dehydrogenase; Provisional 97.34
COG0300265 DltE Short-chain dehydrogenases of various substra 97.32
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism 97.31
PRK07806248 short chain dehydrogenase; Provisional 97.28
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 97.27
PRK11705383 cyclopropane fatty acyl phospholipid synthase; Pro 97.25
PLN03209576 translocon at the inner envelope of chloroplast su 97.25
COG3967245 DltE Short-chain dehydrogenase involved in D-alani 97.25
PRK12771564 putative glutamate synthase (NADPH) small subunit; 97.22
PRK06139330 short chain dehydrogenase; Provisional 97.22
PRK06500249 short chain dehydrogenase; Provisional 97.2
PRK07831262 short chain dehydrogenase; Provisional 97.17
PRK05872296 short chain dehydrogenase; Provisional 97.16
PRK08265261 short chain dehydrogenase; Provisional 97.16
PRK07060245 short chain dehydrogenase; Provisional 97.14
PRK07832272 short chain dehydrogenase; Provisional 97.13
PRK06079252 enoyl-(acyl carrier protein) reductase; Provisiona 97.12
PRK07576264 short chain dehydrogenase; Provisional 97.1
PRK12823260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat 97.1
cd0488673 ACT_ThrD-II-like C-terminal ACT domain of biodegra 97.09
PRK08261450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.08
PRK12829264 short chain dehydrogenase; Provisional 97.07
PRK08339263 short chain dehydrogenase; Provisional 97.04
PRK06057255 short chain dehydrogenase; Provisional 97.03
PRK08017256 oxidoreductase; Provisional 97.03
PRK12939250 short chain dehydrogenase; Provisional 97.03
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.01
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 96.99
PRK06200263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog 96.99
PRK06949258 short chain dehydrogenase; Provisional 96.99
PRK08267260 short chain dehydrogenase; Provisional 96.98
PRK00045423 hemA glutamyl-tRNA reductase; Reviewed 96.98
PF13602127 ADH_zinc_N_2: Zinc-binding dehydrogenase; PDB: 3TQ 96.97
PRK06841255 short chain dehydrogenase; Provisional 96.97
PRK06128300 oxidoreductase; Provisional 96.96
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 96.95
PF0184266 ACT: ACT domain; InterPro: IPR002912 The ACT domai 96.95
PRK12828239 short chain dehydrogenase; Provisional 96.94
PRK07814263 short chain dehydrogenase; Provisional 96.93
PRK09242257 tropinone reductase; Provisional 96.92
PRK06180277 short chain dehydrogenase; Provisional 96.9
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 96.87
PRK07825273 short chain dehydrogenase; Provisional 96.86
PRK08415274 enoyl-(acyl carrier protein) reductase; Provisiona 96.86
PRK06101240 short chain dehydrogenase; Provisional 96.85
PRK07326237 short chain dehydrogenase; Provisional 96.85
PRK07062265 short chain dehydrogenase; Provisional 96.82
PRK13943322 protein-L-isoaspartate O-methyltransferase; Provis 96.82
COG2518209 Pcm Protein-L-isoaspartate carboxylmethyltransfera 96.77
PRK07478254 short chain dehydrogenase; Provisional 96.77
PRK08177225 short chain dehydrogenase; Provisional 96.74
PRK05866293 short chain dehydrogenase; Provisional 96.73
PRK05854313 short chain dehydrogenase; Provisional 96.72
PRK06196315 oxidoreductase; Provisional 96.72
PRK07231251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 96.71
TIGR01035417 hemA glutamyl-tRNA reductase. This enzyme, togethe 96.67
PRK05876275 short chain dehydrogenase; Provisional 96.67
TIGR01832248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 96.66
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 96.66
PRK06194287 hypothetical protein; Provisional 96.65
PRK06198260 short chain dehydrogenase; Provisional 96.65
PF02353273 CMAS: Mycolic acid cyclopropane synthetase; InterP 96.65
PRK07890258 short chain dehydrogenase; Provisional 96.65
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 96.65
PRK07677252 short chain dehydrogenase; Provisional 96.64
PRK07774250 short chain dehydrogenase; Provisional 96.64
PRK09186256 flagellin modification protein A; Provisional 96.63
PRK09291257 short chain dehydrogenase; Provisional 96.61
PRK06483236 dihydromonapterin reductase; Provisional 96.61
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 96.61
PRK07523255 gluconate 5-dehydrogenase; Provisional 96.6
PRK12481251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 96.59
PRK06505271 enoyl-(acyl carrier protein) reductase; Provisiona 96.59
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 96.59
KOG1205|consensus282 96.58
PRK07063260 short chain dehydrogenase; Provisional 96.57
KOG1201|consensus300 96.55
PRK08589272 short chain dehydrogenase; Validated 96.54
PRK07453322 protochlorophyllide oxidoreductase; Validated 96.54
CHL00194317 ycf39 Ycf39; Provisional 96.53
PRK08862227 short chain dehydrogenase; Provisional 96.53
PRK07024257 short chain dehydrogenase; Provisional 96.53
PRK12937245 short chain dehydrogenase; Provisional 96.52
PRK08703239 short chain dehydrogenase; Provisional 96.51
PRK08261450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 96.51
PLN02780320 ketoreductase/ oxidoreductase 96.51
PRK07985294 oxidoreductase; Provisional 96.5
PRK06701290 short chain dehydrogenase; Provisional 96.5
PRK12367245 short chain dehydrogenase; Provisional 96.49
PRK07904253 short chain dehydrogenase; Provisional 96.49
PRK06125259 short chain dehydrogenase; Provisional 96.49
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 96.49
PRK05867253 short chain dehydrogenase; Provisional 96.49
COG2910211 Putative NADH-flavin reductase [General function p 96.48
PRK08264238 short chain dehydrogenase; Validated 96.47
PRK06172253 short chain dehydrogenase; Provisional 96.47
PRK08213259 gluconate 5-dehydrogenase; Provisional 96.45
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 96.44
PRK06953222 short chain dehydrogenase; Provisional 96.44
PRK07035252 short chain dehydrogenase; Provisional 96.43
PLN02253280 xanthoxin dehydrogenase 96.43
PRK06603260 enoyl-(acyl carrier protein) reductase; Provisiona 96.42
PRK05717255 oxidoreductase; Validated 96.42
PRK07856252 short chain dehydrogenase; Provisional 96.41
PRK08085254 gluconate 5-dehydrogenase; Provisional 96.4
PRK06484520 short chain dehydrogenase; Validated 96.4
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 96.4
PRK08226263 short chain dehydrogenase; Provisional 96.4
PRK06114254 short chain dehydrogenase; Provisional 96.39
PRK06181263 short chain dehydrogenase; Provisional 96.37
PRK06463255 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 96.37
PRK09072263 short chain dehydrogenase; Provisional 96.37
PRK05884223 short chain dehydrogenase; Provisional 96.36
PRK06179270 short chain dehydrogenase; Provisional 96.36
PRK08628258 short chain dehydrogenase; Provisional 96.36
PRK08643256 acetoin reductase; Validated 96.35
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 96.35
PRK08263275 short chain dehydrogenase; Provisional 96.35
PRK08251248 short chain dehydrogenase; Provisional 96.34
PRK06138252 short chain dehydrogenase; Provisional 96.33
PRK07454241 short chain dehydrogenase; Provisional 96.32
KOG0725|consensus270 96.32
PRK06077252 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 96.31
PRK08993253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 96.31
PRK05875276 short chain dehydrogenase; Provisional 96.29
PRK06482276 short chain dehydrogenase; Provisional 96.29
PRK08945247 putative oxoacyl-(acyl carrier protein) reductase; 96.28
PRK08340259 glucose-1-dehydrogenase; Provisional 96.28
PRK07067257 sorbitol dehydrogenase; Provisional 96.27
PRK06484520 short chain dehydrogenase; Validated 96.25
PRK12743256 oxidoreductase; Provisional 96.25
KOG1014|consensus312 96.23
PRK12938246 acetyacetyl-CoA reductase; Provisional 96.22
PRK06935258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 96.21
PRK07102243 short chain dehydrogenase; Provisional 96.21
PRK06523260 short chain dehydrogenase; Provisional 96.2
PRK08303305 short chain dehydrogenase; Provisional 96.19
PRK10538248 malonic semialdehyde reductase; Provisional 96.19
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 96.18
PRK06124256 gluconate 5-dehydrogenase; Provisional 96.18
PRK06398258 aldose dehydrogenase; Validated 96.16
PRK06720169 hypothetical protein; Provisional 96.15
PRK07533258 enoyl-(acyl carrier protein) reductase; Provisiona 96.15
PRK07097265 gluconate 5-dehydrogenase; Provisional 96.14
PRK08277278 D-mannonate oxidoreductase; Provisional 96.14
PRK06197306 short chain dehydrogenase; Provisional 96.11
PRK06914280 short chain dehydrogenase; Provisional 96.1
COG1748389 LYS9 Saccharopine dehydrogenase and related protei 96.09
PRK07791286 short chain dehydrogenase; Provisional 96.08
PF00106167 adh_short: short chain dehydrogenase alcohol dehyd 96.06
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 96.06
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 96.05
cd0488472 ACT_CBS C-terminal ACT domain of the cystathionine 96.04
PRK08278273 short chain dehydrogenase; Provisional 96.03
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 96.03
PRK07402196 precorrin-6B methylase; Provisional 96.02
TIGR01963255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 96.01
PRK12936245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; 95.99
PRK08690261 enoyl-(acyl carrier protein) reductase; Provisiona 95.98
PRK07775274 short chain dehydrogenase; Provisional 95.97
PRK12384259 sorbitol-6-phosphate dehydrogenase; Provisional 95.97
COG2230283 Cfa Cyclopropane fatty acid synthase and related m 95.94
PLN02657390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 95.94
PRK03369488 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.92
PRK00107187 gidB 16S rRNA methyltransferase GidB; Reviewed 95.9
PRK07666239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 95.89
PRK08063250 enoyl-(acyl carrier protein) reductase; Provisiona 95.89
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 95.89
PRK07424406 bifunctional sterol desaturase/short chain dehydro 95.86
TIGR01289314 LPOR light-dependent protochlorophyllide reductase 95.86
PRK07074257 short chain dehydrogenase; Provisional 95.83
PRK06113255 7-alpha-hydroxysteroid dehydrogenase; Validated 95.82
PRK05650270 short chain dehydrogenase; Provisional 95.81
PRK13942212 protein-L-isoaspartate O-methyltransferase; Provis 95.8
PRK09135249 pteridine reductase; Provisional 95.78
KOG1209|consensus289 95.78
PRK05557248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 95.78
PRK05855582 short chain dehydrogenase; Validated 95.77
PRK05599246 hypothetical protein; Provisional 95.76
PRK13656398 trans-2-enoyl-CoA reductase; Provisional 95.73
PRK07889256 enoyl-(acyl carrier protein) reductase; Provisiona 95.73
PRK07370258 enoyl-(acyl carrier protein) reductase; Validated 95.71
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 95.7
TIGR03840213 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d 95.7
PF01135209 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl 95.69
PRK09134258 short chain dehydrogenase; Provisional 95.68
PRK08416260 7-alpha-hydroxysteroid dehydrogenase; Provisional 95.68
PRK04148134 hypothetical protein; Provisional 95.66
TIGR00438188 rrmJ cell division protein FtsJ. 95.64
PRK08159272 enoyl-(acyl carrier protein) reductase; Provisiona 95.62
PRK07984262 enoyl-(acyl carrier protein) reductase; Provisiona 95.62
cd0488876 ACT_PheB-BS C-terminal ACT domain of a small (~147 95.56
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 95.56
TIGR01829242 AcAcCoA_reduct acetoacetyl-CoA reductase. (R)-3-hy 95.55
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 95.55
PRK07792306 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 95.54
PRK07069251 short chain dehydrogenase; Validated 95.52
TIGR00080215 pimt protein-L-isoaspartate(D-aspartate) O-methylt 95.52
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provis 95.52
PRK07577234 short chain dehydrogenase; Provisional 95.45
TIGR02415254 23BDH acetoin reductases. One member of this famil 95.45
TIGR02632676 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc 95.44
PF1371063 ACT_5: ACT domain; PDB: 2FGC_A 2PC6_A 2F1F_B. 95.44
PRK06171266 sorbitol-6-phosphate 2-dehydrogenase; Provisional 95.42
PRK08219227 short chain dehydrogenase; Provisional 95.42
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 95.41
PRK08594257 enoyl-(acyl carrier protein) reductase; Provisiona 95.41
PRK12745256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 95.41
PRK08936261 glucose-1-dehydrogenase; Provisional 95.4
cd0488265 ACT_Bt0572_2 C-terminal ACT domain of a novel prot 95.38
PRK08642253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 95.37
KOG1200|consensus256 95.37
PRK12935247 acetoacetyl-CoA reductase; Provisional 95.32
PRK11036255 putative S-adenosyl-L-methionine-dependent methylt 95.24
PRK12746254 short chain dehydrogenase; Provisional 95.2
PLN02730303 enoyl-[acyl-carrier-protein] reductase 95.17
PRK14967223 putative methyltransferase; Provisional 95.17
TIGR03649285 ergot_EASG ergot alkaloid biosynthesis protein, AF 95.16
PRK06997260 enoyl-(acyl carrier protein) reductase; Provisiona 95.12
TIGR00406288 prmA ribosomal protein L11 methyltransferase. Ribo 95.11
PLN02896353 cinnamyl-alcohol dehydrogenase 95.08
PRK08220252 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 95.06
PRK07201657 short chain dehydrogenase; Provisional 95.05
cd0487872 ACT_AHAS N-terminal ACT domain of the Escherichia 95.04
PRK12744257 short chain dehydrogenase; Provisional 95.01
PLN02986322 cinnamyl-alcohol dehydrogenase family protein 95.01
PRK13255218 thiopurine S-methyltransferase; Reviewed 95.0
PRK12859256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 94.96
PRK13940414 glutamyl-tRNA reductase; Provisional 94.92
TIGR02685267 pter_reduc_Leis pteridine reductase. Pteridine red 94.92
PRK09730247 putative NAD(P)-binding oxidoreductase; Provisiona 94.88
cd0487472 ACT_Af1403 N-terminal ACT domain of the yet unchar 94.87
PLN02989325 cinnamyl-alcohol dehydrogenase family protein 94.86
PRK08317241 hypothetical protein; Provisional 94.85
PRK12825249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 94.84
PRK0673776 acetolactate synthase 1 regulatory subunit; Valida 94.84
TIGR02622349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 94.84
KOG1210|consensus331 94.83
PRK11207197 tellurite resistance protein TehB; Provisional 94.81
cd0488568 ACT_ThrD-I Tandem C-terminal ACT domains of threon 94.79
PRK07502307 cyclohexadienyl dehydrogenase; Validated 94.77
PRK06947248 glucose-1-dehydrogenase; Provisional 94.74
PRK06123248 short chain dehydrogenase; Provisional 94.73
PRK06300299 enoyl-(acyl carrier protein) reductase; Provisiona 94.68
KOG1208|consensus314 94.68
PRK12747252 short chain dehydrogenase; Provisional 94.66
COG2519256 GCD14 tRNA(1-methyladenosine) methyltransferase an 94.66
PRK07041230 short chain dehydrogenase; Provisional 94.65
PLN00015308 protochlorophyllide reductase 94.64
COG4122219 Predicted O-methyltransferase [General function pr 94.64
PRK12824245 acetoacetyl-CoA reductase; Provisional 94.63
PLN00016378 RNA-binding protein; Provisional 94.63
TIGR01124499 ilvA_2Cterm threonine ammonia-lyase, biosynthetic, 94.6
PLN02686367 cinnamoyl-CoA reductase 94.6
PF08704247 GCD14: tRNA methyltransferase complex GCD14 subuni 94.59
PRK08198404 threonine dehydratase; Provisional 94.57
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone 94.52
TIGR01830239 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) re 94.49
cd0488774 ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-te 94.47
PRK12827249 short chain dehydrogenase; Provisional 94.47
PLN02653340 GDP-mannose 4,6-dehydratase 94.46
cd0488372 ACT_AcuB C-terminal ACT domain of the Bacillus sub 94.46
PRK07023243 short chain dehydrogenase; Provisional 94.45
COG0686371 Ald Alanine dehydrogenase [Amino acid transport an 94.44
PRK01581374 speE spermidine synthase; Validated 94.41
PRK06550235 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 94.36
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 94.34
PLN02781234 Probable caffeoyl-CoA O-methyltransferase 94.31
PF03435386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 94.31
PRK14103255 trans-aconitate 2-methyltransferase; Provisional 94.28
PLN02662322 cinnamyl-alcohol dehydrogenase family protein 94.28
PRK06718202 precorrin-2 dehydrogenase; Reviewed 94.25
COG1052324 LdhA Lactate dehydrogenase and related dehydrogena 94.25
PLN02476278 O-methyltransferase 94.22
PRK11790409 D-3-phosphoglycerate dehydrogenase; Provisional 94.19
COG4492150 PheB ACT domain-containing protein [General functi 94.18
TIGR03589324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 94.18
COG1028251 FabG Dehydrogenases with different specificities ( 94.17
TIGR03466328 HpnA hopanoid-associated sugar epimerase. The sequ 94.17
PRK04435147 hypothetical protein; Provisional 94.15
PRK12748256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 94.12
KOG1502|consensus327 94.07
PRK00811283 spermidine synthase; Provisional 94.06
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 94.06
TIGR00138181 gidB 16S rRNA methyltransferase GidB. GidB (glucos 94.06
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 93.98
PLN02427386 UDP-apiose/xylose synthase 93.97
PLN02244340 tocopherol O-methyltransferase 93.96
TIGR01127380 ilvA_1Cterm threonine dehydratase, medium form. A 93.96
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 93.91
cd0211660 ACT ACT domains are commonly involved in specifica 93.89
PRK12549284 shikimate 5-dehydrogenase; Reviewed 93.82
TIGR00477195 tehB tellurite resistance protein TehB. Part of a 93.81
PF1329180 ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A. 93.79
TIGR01777292 yfcH conserved hypothetical protein TIGR01777. Thi 93.76
PLN02583297 cinnamoyl-CoA reductase 93.75
PRK11895161 ilvH acetolactate synthase 3 regulatory subunit; R 93.7
PLN02214342 cinnamoyl-CoA reductase 93.7
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 93.67
PRK07334403 threonine dehydratase; Provisional 93.64
TIGR01472343 gmd GDP-mannose 4,6-dehydratase. Excluded from thi 93.61
PF01596205 Methyltransf_3: O-methyltransferase; InterPro: IPR 93.55
KOG1203|consensus411 93.54
PRK06382406 threonine dehydratase; Provisional 93.48
PRK07578199 short chain dehydrogenase; Provisional 93.48
PLN00203519 glutamyl-tRNA reductase 93.48
PRK08655437 prephenate dehydrogenase; Provisional 93.47
PLN00198338 anthocyanidin reductase; Provisional 93.47
PLN02366308 spermidine synthase 93.43
PRK05579399 bifunctional phosphopantothenoylcysteine decarboxy 93.39
PF13659117 Methyltransf_26: Methyltransferase domain; PDB: 3G 93.39
>KOG3820|consensus Back     alignment and domain information
Probab=100.00  E-value=5.5e-106  Score=832.36  Aligned_cols=355  Identities=54%  Similarity=0.835  Sum_probs=334.2

Q ss_pred             CeEEEEEEccCCCcchHHHHHHHHHhCCcceeeeecccCCCCCcceEEEEEecC-CchHHHHHHHHHccCCcEEEecCCC
Q psy14589        260 LFDFVIFSNHQDEVGALAKTLKLFKKHNVNLLHIESRSSTRIENNYEFMVECAP-GGDLSSVIESLRSSCSYINIISRNH  338 (655)
Q Consensus       260 ~ktsl~f~l~~d~~gaL~~iL~~f~~~~Inlt~IeSRP~~~~~~~Y~FfVd~eg-~~~v~~~l~~L~~~~~~v~iLGs~~  338 (655)
                      ..++++|++++ ++|+|+++|++|+..++|+.||||||++....+|++||++++ ..++.++++.|++.+..+....+.+
T Consensus        35 ~~~~~if~~r~-~~~~l~~~Lk~f~~~~vnl~HiEsR~s~~~~~~~evlv~~~~~~~~l~~~i~~lrq~~~~~~~~s~~~  113 (461)
T KOG3820|consen   35 ARISLIFSLRN-KVGALARALKAFEEFHVNLLHIESRPSERRSSGYEVLVELDATRGQLIQAIELLRQNHVALSYFSSFN  113 (461)
T ss_pred             ceEEEEEEecc-cchHHHHHHHHhhhcCceEEEeecccccccCCCceEEEeeccchhhHHHHHHHHHHhcccceecccch
Confidence            36789999999 899999999999999999999999999999999999999999 7899999999999986555554443


Q ss_pred             C-----CCCCCcCcccccchhhhhhhhhhhcCCCCCCCCCCCCCHHHHHHHHHHHHHHhccCCCCC--------------
Q psy14589        339 N-----QFHGVPWFPRRIRELDRFANQILSYGSELDADHPGFTDPVYRARRKYFADLAFNYKHSIL--------------  399 (655)
Q Consensus       339 ~-----~~~~vpWfPr~~~dLD~~~~~~l~~~~~l~~dhpgf~D~~y~~rR~~ia~ia~~~k~g~~--------------  399 (655)
                      .     .+.++|||||+|+|||+|+|+|+|||++||+|||||+|++||+||+++|+||.|||||||              
T Consensus       114 ~~~~~~~~~~vpWFPr~IsdLD~can~vl~Yg~eLDadHPGFkD~vYR~RRk~fadiA~nyKhGdpIP~veYT~eEikTW  193 (461)
T KOG3820|consen  114 RDLKDNKNTSVPWFPRKISDLDQCANRVLKYGPELDADHPGFKDPVYRQRRKFFADIAFNYKHGDPIPRVEYTEEEIKTW  193 (461)
T ss_pred             hhhhhccCCCCCccccchhHHHHHHHHHhhcCCCCCCCCCCCCCHHHHHHHHHHHHHHHhcccCCCCCccccCHHHHHHH
Confidence            2     247899999999999999999999999999999999999999999999999999999998              


Q ss_pred             --------------cchhHHhhhhHHHHhcCCCCCCCCChHHHHHhhhhccCceEEecCCCCChHHHHHhhhcCccceee
Q psy14589        400 --------------LMPEHNHVFPLLIQNCGYAEDNIPQLEDISKFLKDSTGFSLRPVAGLLSSRDFLAGLAFRVFHSTQ  465 (655)
Q Consensus       400 --------------Ac~ey~~g~~~l~~~~g~~~~~Ip~~~~~~~~l~~~tg~~~~~v~g~~~~~~f~~~la~r~f~~t~  465 (655)
                                    ||+||+++|++|+++|||.+|+||||+|||+|||++|||++|||+||+|+|||+++||||||+|||
T Consensus       194 g~Vf~~L~~Ly~~HAC~ey~~~f~lLe~~cg~~ednIPQLeDVs~FLk~~TGF~lRPvAGlLSaRDFLagLAFRVFhcTQ  273 (461)
T KOG3820|consen  194 GTVFRTLTDLYPTHACAEYLDNFPLLEKYCGYREDNIPQLEDVSKFLKKKTGFRLRPVAGLLSARDFLAGLAFRVFHCTQ  273 (461)
T ss_pred             HHHHHHHHHHhhhhhHHHHHHHHHHHHHhcCcCCCCcchHHHHHHHHHhccCceeecccccCcHHHHHhhhhhhheeeee
Confidence                          999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eccCCCCCCCCCCchhhhhhcCCCCccCChhHHHHHHHHhhhcCCCChHHHHHHHhhhhhhhhhhhccCCCCCCCCeEee
Q psy14589        466 YIRHPSKPLYTPEPDVCHELLGHVPLFADPSFAQFSQEIGLASLGAPDEYVERLATSNNFMIVPRLASLSPDSTGFSLRP  545 (655)
Q Consensus       466 ~ir~~~~~~y~~epd~~He~~gh~p~l~~~~~a~~~~~~Gl~~l~~~~~~i~~l~~l~w~tve~gl~~~~~~~tg~~~~~  545 (655)
                      ||||+++|+||||||+|||++||||||+||.||||+|+|||++||+|+|+|++|+++||||||||||++.     +++|+
T Consensus       274 YiRH~s~P~yTPEPD~cHELLGHvPLfADp~FAQFSQEIGLASLGAsDe~IEKLaTlywFtVEFGLCkq~-----g~~Ka  348 (461)
T KOG3820|consen  274 YIRHHSSPFYTPEPDTCHELLGHVPLFADPSFAQFSQEIGLASLGASDEDIEKLATLYWFTVEFGLCKQD-----GELKA  348 (461)
T ss_pred             eeecCCCCCCCCCCchHHHHhccchhccChhHHHHhHHhhhhhcCCCHHHHHHhheeeEEEEEEeeeccC-----Ceeee
Confidence            9999999999999999999999999999999999999999999999999999999999999999999999     99999


Q ss_pred             -cccccCCHHHHHhhhc-----ccc-----cccccccCCCCCCCCCCcchhhhhcCCcccccCchHHHHHHHHhhcccCC
Q psy14589        546 -VAGLLSSRDFLAGLAF-----RVF-----HSTQYIRHPSKPLYTPEPDVCHELLGHVPLFADPSFAQFSQEIGLASLGA  614 (655)
Q Consensus       546 -g~Gllss~~~~~~l~~-----~~f-----~~~~~ir~~~~~~y~~~pd~~hd~~ghvp~l~~p~f~~~~~~~g~~~~~a  614 (655)
                       |||||||.||+.|+..     +.|     +++.|+.+.+|+.|.. .|.|||....+.        .|...|     ++
T Consensus       349 yGAGLLSS~gEL~hals~~pei~~FdP~vt~vq~y~it~yQp~Yfv-aeSFedAk~KlR--------~fa~ti-----~R  414 (461)
T KOG3820|consen  349 YGAGLLSSYGELQHALSDKPEIKDFDPEVTAVQKYLITTYQPLYFV-AESFEDAKEKLR--------KFASTI-----KR  414 (461)
T ss_pred             echhhhhhHHHHHHHhcCCccccCCCccceeeeeccccccccceee-hhhHHHHHHHHH--------HHHHhC-----CC
Confidence             9999999999999975     455     6778999999999999 699999987776        555554     99


Q ss_pred             ceEEEeecccccCccccccCch
Q psy14589        615 PYLFYYVCHELLGHVPLFADPS  636 (655)
Q Consensus       615 ~~~~~~~~~~~~~~~~~~~~~~  636 (655)
                      ||.|+|  +|+|++|-|+|+..
T Consensus       415 PF~Vry--npyT~svEvLds~~  434 (461)
T KOG3820|consen  415 PFSVRY--NPYTQSVEVLDSSA  434 (461)
T ss_pred             Cceeee--ccccceehhhcCHH
Confidence            999999  99999999999863



>TIGR01268 Phe4hydrox_tetr phenylalanine-4-hydroxylase, tetrameric form Back     alignment and domain information
>TIGR01270 Trp_5_monoox tryptophan 5-monooxygenase, tetrameric Back     alignment and domain information
>TIGR01269 Tyr_3_monoox tyrosine 3-monooxygenase, tetrameric Back     alignment and domain information
>PF00351 Biopterin_H: Biopterin-dependent aromatic amino acid hydroxylase; InterPro: IPR019774 Phenylalanine, tyrosine and tryptophan hydroxylases constitute a family of tetrahydrobiopterin-dependent aromatic amino acid hydroxylases, all of which are rate-limiting catalysts for important metabolic pathways [] Back     alignment and domain information
>cd03347 eu_PheOH Eukaryotic phenylalanine-4-hydroxylase (eu_PheOH); a member of the biopterin-dependent aromatic amino acid hydroxylase family of non-heme, iron(II)-dependent enzymes that also includes prokaryotic phenylalanine-4-hydroxylase (pro_PheOH), eukaryotic tyrosine hydroxylase (TyrOH) and eukaryotic tryptophan hydroxylase (TrpOH) Back     alignment and domain information
>cd03345 eu_TyrOH Eukaryotic tyrosine hydroxylase (TyrOH); a member of the biopterin-dependent aromatic amino acid hydroxylase family of non-heme, iron(II)-dependent enzymes that also includes prokaryotic and eukaryotic phenylalanine-4-hydroxylase (PheOH) and eukaryotic tryptophan hydroxylase (TrpOH) Back     alignment and domain information
>cd03346 eu_TrpOH Eukaryotic tryptophan hydroxylase (TrpOH); a member of the biopterin-dependent aromatic amino acid hydroxylase family of non-heme, iron(II)-dependent enzymes that also includes prokaryotic and eukaryotic phenylalanine-4-hydroxylase (PheOH) and eukaryotic tyrosine hydroxylase (TyrOH) Back     alignment and domain information
>PRK11913 phhA phenylalanine 4-monooxygenase; Reviewed Back     alignment and domain information
>cd03348 pro_PheOH Prokaryotic phenylalanine-4-hydroxylase (pro_PheOH); a member of the biopterin-dependent aromatic amino acid hydroxylase family of non-heme, iron(II)-dependent enzymes that also includes the eukaryotic proteins, phenylalanine-4-hydroxylase (eu_PheOH), tyrosine hydroxylase (TyrOH) and tryptophan hydroxylase (TrpOH) Back     alignment and domain information
>cd00361 arom_aa_hydroxylase Biopterin-dependent aromatic amino acid hydroxylase; a family of non-heme, iron(II)-dependent enzymes that includes prokaryotic and eukaryotic phenylalanine-4-hydroxylase (PheOH), eukaryotic tyrosine hydroxylase (TyrOH) and eukaryotic tryptophan hydroxylase (TrpOH) Back     alignment and domain information
>TIGR01267 Phe4hydrox_mono phenylalanine-4-hydroxylase, monomeric form Back     alignment and domain information
>PRK14055 aromatic amino acid hydroxylase; Provisional Back     alignment and domain information
>PRK14056 phenylalanine 4-monooxygenase; Provisional Back     alignment and domain information
>COG3186 Phenylalanine-4-hydroxylase [Amino acid transport and metabolism] Back     alignment and domain information
>cd03348 pro_PheOH Prokaryotic phenylalanine-4-hydroxylase (pro_PheOH); a member of the biopterin-dependent aromatic amino acid hydroxylase family of non-heme, iron(II)-dependent enzymes that also includes the eukaryotic proteins, phenylalanine-4-hydroxylase (eu_PheOH), tyrosine hydroxylase (TyrOH) and tryptophan hydroxylase (TrpOH) Back     alignment and domain information
>TIGR01267 Phe4hydrox_mono phenylalanine-4-hydroxylase, monomeric form Back     alignment and domain information
>cd00361 arom_aa_hydroxylase Biopterin-dependent aromatic amino acid hydroxylase; a family of non-heme, iron(II)-dependent enzymes that includes prokaryotic and eukaryotic phenylalanine-4-hydroxylase (PheOH), eukaryotic tyrosine hydroxylase (TyrOH) and eukaryotic tryptophan hydroxylase (TrpOH) Back     alignment and domain information
>PRK11913 phhA phenylalanine 4-monooxygenase; Reviewed Back     alignment and domain information
>cd03346 eu_TrpOH Eukaryotic tryptophan hydroxylase (TrpOH); a member of the biopterin-dependent aromatic amino acid hydroxylase family of non-heme, iron(II)-dependent enzymes that also includes prokaryotic and eukaryotic phenylalanine-4-hydroxylase (PheOH) and eukaryotic tyrosine hydroxylase (TyrOH) Back     alignment and domain information
>cd03347 eu_PheOH Eukaryotic phenylalanine-4-hydroxylase (eu_PheOH); a member of the biopterin-dependent aromatic amino acid hydroxylase family of non-heme, iron(II)-dependent enzymes that also includes prokaryotic phenylalanine-4-hydroxylase (pro_PheOH), eukaryotic tyrosine hydroxylase (TyrOH) and eukaryotic tryptophan hydroxylase (TrpOH) Back     alignment and domain information
>cd03345 eu_TyrOH Eukaryotic tyrosine hydroxylase (TyrOH); a member of the biopterin-dependent aromatic amino acid hydroxylase family of non-heme, iron(II)-dependent enzymes that also includes prokaryotic and eukaryotic phenylalanine-4-hydroxylase (PheOH) and eukaryotic tryptophan hydroxylase (TrpOH) Back     alignment and domain information
>COG3186 Phenylalanine-4-hydroxylase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01269 Tyr_3_monoox tyrosine 3-monooxygenase, tetrameric Back     alignment and domain information
>TIGR01268 Phe4hydrox_tetr phenylalanine-4-hydroxylase, tetrameric form Back     alignment and domain information
>TIGR01270 Trp_5_monoox tryptophan 5-monooxygenase, tetrameric Back     alignment and domain information
>PRK14055 aromatic amino acid hydroxylase; Provisional Back     alignment and domain information
>PRK14056 phenylalanine 4-monooxygenase; Provisional Back     alignment and domain information
>PF00351 Biopterin_H: Biopterin-dependent aromatic amino acid hydroxylase; InterPro: IPR019774 Phenylalanine, tyrosine and tryptophan hydroxylases constitute a family of tetrahydrobiopterin-dependent aromatic amino acid hydroxylases, all of which are rate-limiting catalysts for important metabolic pathways [] Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
>KOG3820|consensus Back     alignment and domain information
>KOG1197|consensus Back     alignment and domain information
>KOG0023|consensus Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>KOG0024|consensus Back     alignment and domain information
>COG2130 Putative NADP-dependent oxidoreductases [General function prediction only] Back     alignment and domain information
>KOG1198|consensus Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) Back     alignment and domain information
>PLN02178 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PLN02586 probable cinnamyl alcohol dehydrogenase Back     alignment and domain information
>TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase Back     alignment and domain information
>cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like Back     alignment and domain information
>TIGR02818 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase Back     alignment and domain information
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>TIGR02825 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase Back     alignment and domain information
>PLN03154 putative allyl alcohol dehydrogenase; Provisional Back     alignment and domain information
>PLN02740 Alcohol dehydrogenase-like Back     alignment and domain information
>PLN02827 Alcohol dehydrogenase-like Back     alignment and domain information
>COG0077 PheA Prephenate dehydratase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase Back     alignment and domain information
>cd08277 liver_alcohol_DH_like Liver alcohol dehydrogenase Back     alignment and domain information
>TIGR02822 adh_fam_2 zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>cd08295 double_bond_reductase_like Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase Back     alignment and domain information
>COG1062 AdhC Zn-dependent alcohol dehydrogenases, class III [Energy production and conversion] Back     alignment and domain information
>cd08294 leukotriene_B4_DH_like 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity Back     alignment and domain information
>cd08301 alcohol_DH_plants Plant alcohol dehydrogenase Back     alignment and domain information
>PLN02514 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>cd08300 alcohol_DH_class_III class III alcohol dehydrogenases Back     alignment and domain information
>PRK11899 prephenate dehydratase; Provisional Back     alignment and domain information
>cd08293 PTGR2 Prostaglandin reductase Back     alignment and domain information
>PRK10309 galactitol-1-phosphate dehydrogenase; Provisional Back     alignment and domain information
>cd08296 CAD_like Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>cd08231 MDR_TM0436_like Hypothetical enzyme TM0436 resembles the zinc-dependent alcohol dehydrogenases (ADH) Back     alignment and domain information
>cd08233 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrogenase Back     alignment and domain information
>cd08246 crotonyl_coA_red crotonyl-CoA reductase Back     alignment and domain information
>cd04904 ACT_AAAH ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) Back     alignment and domain information
>PRK11898 prephenate dehydratase; Provisional Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>KOG1196|consensus Back     alignment and domain information
>KOG0022|consensus Back     alignment and domain information
>PRK10622 pheA bifunctional chorismate mutase/prephenate dehydratase; Provisional Back     alignment and domain information
>PLN02317 arogenate dehydratase Back     alignment and domain information
>cd08285 NADP_ADH NADP(H)-dependent alcohol dehydrogenases Back     alignment and domain information
>TIGR02819 fdhA_non_GSH formaldehyde dehydrogenase, glutathione-independent Back     alignment and domain information
>TIGR01751 crot-CoA-red crotonyl-CoA reductase Back     alignment and domain information
>KOG1202|consensus Back     alignment and domain information
>cd05278 FDH_like Formaldehyde dehydrogenases Back     alignment and domain information
>cd08299 alcohol_DH_class_I_II_IV class I, II, IV alcohol dehydrogenases Back     alignment and domain information
>cd08291 ETR_like_1 2-enoyl thioester reductase (ETR) like proteins, child 1 Back     alignment and domain information
>cd08292 ETR_like_2 2-enoyl thioester reductase (ETR) like proteins, child 2 Back     alignment and domain information
>cd08256 Zn_ADH2 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08243 quinone_oxidoreductase_like_1 Quinone oxidoreductase (QOR) Back     alignment and domain information
>cd08265 Zn_ADH3 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>PRK09422 ethanol-active dehydrogenase/acetaldehyde-active reductase; Provisional Back     alignment and domain information
>cd04930 ACT_TH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, tyrosine hydroxylases (TH) Back     alignment and domain information
>TIGR02817 adh_fam_1 zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>cd08254 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase, N-benzyl-3-pyrrolidinol dehydrogenase, and other MDR family members Back     alignment and domain information
>cd04929 ACT_TPH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, tryptophan hydroxylases (TPH), both peripheral (TPH1) and neuronal (TPH2) enzymes Back     alignment and domain information
>cd08240 6_hydroxyhexanoate_dh_like 6-hydroxyhexanoate dehydrogenase Back     alignment and domain information
>cd08283 FDH_like_1 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 1 Back     alignment and domain information
>cd08278 benzyl_alcohol_DH Benzyl alcohol dehydrogenase Back     alignment and domain information
>cd04931 ACT_PAH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, phenylalanine hydroxylases (PAH) Back     alignment and domain information
>cd05282 ETR_like 2-enoyl thioester reductase-like Back     alignment and domain information
>PRK13771 putative alcohol dehydrogenase; Provisional Back     alignment and domain information
>PRK10754 quinone oxidoreductase, NADPH-dependent; Provisional Back     alignment and domain information
>cd05284 arabinose_DH_like D-arabinose dehydrogenase Back     alignment and domain information
>cd08289 MDR_yhfp_like Yhfp putative quinone oxidoreductases Back     alignment and domain information
>cd08284 FDH_like_2 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 2 Back     alignment and domain information
>cd08274 MDR9 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08260 Zn_ADH6 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>PF00107 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: IPR013149 Alcohol dehydrogenase (1 Back     alignment and domain information
>cd08297 CAD3 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>PTZ00354 alcohol dehydrogenase; Provisional Back     alignment and domain information
>cd05279 Zn_ADH1 Liver alcohol dehydrogenase and related zinc-dependent alcohol dehydrogenases Back     alignment and domain information
>cd05288 PGDH Prostaglandin dehydrogenases Back     alignment and domain information
>cd08263 Zn_ADH10 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08279 Zn_ADH_class_III Class III alcohol dehydrogenase Back     alignment and domain information
>cd08264 Zn_ADH_like2 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd05285 sorbitol_DH Sorbitol dehydrogenase Back     alignment and domain information
>KOG0025|consensus Back     alignment and domain information
>PRK10083 putative oxidoreductase; Provisional Back     alignment and domain information
>cd08290 ETR 2-enoyl thioester reductase (ETR) Back     alignment and domain information
>cd08259 Zn_ADH5 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08237 ribitol-5-phosphate_DH ribitol-5-phosphate dehydrogenase Back     alignment and domain information
>cd08266 Zn_ADH_like1 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08244 MDR_enoyl_red Possible enoyl reductase Back     alignment and domain information
>cd08238 sorbose_phosphate_red L-sorbose-1-phosphate reductase Back     alignment and domain information
>cd04880 ACT_AAAH-PDT-like ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) Back     alignment and domain information
>cd05286 QOR2 Quinone oxidoreductase (QOR) Back     alignment and domain information
>TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase Back     alignment and domain information
>cd08287 FDH_like_ADH3 formaldehyde dehydrogenase (FDH)-like Back     alignment and domain information
>cd05188 MDR Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08261 Zn_ADH7 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd05280 MDR_yhdh_yhfp Yhdh and yhfp-like putative quinone oxidoreductases Back     alignment and domain information
>cd05283 CAD1 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>cd05195 enoyl_red enoyl reductase of polyketide synthase Back     alignment and domain information
>cd08251 polyketide_synthase polyketide synthase Back     alignment and domain information
>smart00829 PKS_ER Enoylreductase Back     alignment and domain information
>cd08250 Mgc45594_like Mgc45594 gene product and other MDR family members Back     alignment and domain information
>cd08249 enoyl_reductase_like enoyl_reductase_like Back     alignment and domain information
>TIGR02823 oxido_YhdH putative quinone oxidoreductase, YhdH/YhfP family Back     alignment and domain information
>cd08252 AL_MDR Arginate lyase and other MDR family members Back     alignment and domain information
>cd08286 FDH_like_ADH2 formaldehyde dehydrogenase (FDH)-like Back     alignment and domain information
>cd04905 ACT_CM-PDT C-terminal ACT domain of the bifunctional chorismate mutase-prephenate dehydratase (CM-PDT) enzyme and the prephenate dehydratase (PDT) enzyme Back     alignment and domain information
>cd08276 MDR7 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08298 CAD2 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>cd08282 PFDH_like Pseudomonas putida aldehyde-dismutating formaldehyde dehydrogenase (PFDH) Back     alignment and domain information
>cd08270 MDR4 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08245 CAD Cinnamyl alcohol dehydrogenases (CAD) and related proteins Back     alignment and domain information
>cd08253 zeta_crystallin Zeta-crystallin with NADP-dependent quinone reductase activity (QOR) Back     alignment and domain information
>cd08262 Zn_ADH8 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08235 iditol_2_DH_like L-iditol 2-dehydrogenase Back     alignment and domain information
>PLN02702 L-idonate 5-dehydrogenase Back     alignment and domain information
>cd08258 Zn_ADH4 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08248 RTN4I1 Human Reticulon 4 Interacting Protein 1 Back     alignment and domain information
>TIGR02824 quinone_pig3 putative NAD(P)H quinone oxidoreductase, PIG3 family Back     alignment and domain information
>PRK05396 tdh L-threonine 3-dehydrogenase; Validated Back     alignment and domain information
>cd08288 MDR_yhdh Yhdh putative quinone oxidoreductases Back     alignment and domain information
>cd05276 p53_inducible_oxidoreductase PIG3 p53-inducible quinone oxidoreductase Back     alignment and domain information
>cd08241 QOR1 Quinone oxidoreductase (QOR) Back     alignment and domain information
>cd08268 MDR2 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08236 sugar_DH NAD(P)-dependent sugar dehydrogenases Back     alignment and domain information
>cd08273 MDR8 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08272 MDR6 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08269 Zn_ADH9 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08267 MDR1 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd05289 MDR_like_2 alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases Back     alignment and domain information
>cd08247 AST1_like AST1 is a cytoplasmic protein associated with the periplasmic membrane in yeast Back     alignment and domain information
>TIGR00692 tdh L-threonine 3-dehydrogenase Back     alignment and domain information
>cd08271 MDR5 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08232 idonate-5-DH L-idonate 5-dehydrogenase Back     alignment and domain information
>cd08234 threonine_DH_like L-threonine dehydrogenase Back     alignment and domain information
>cd05281 TDH Threonine dehydrogenase Back     alignment and domain information
>cd08255 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_like 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide and other MDR family members Back     alignment and domain information
>cd08242 MDR_like Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08275 MDR3 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>KOG2797|consensus Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>PRK08818 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>COG3967 DltE Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07832 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>cd04886 ACT_ThrD-II-like C-terminal ACT domain of biodegradative (catabolic) threonine dehydratase II (ThrD-II) and other related ACT domains Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>PF13602 ADH_zinc_N_2: Zinc-binding dehydrogenase; PDB: 3TQH_A 2VN8_A 3GOH_A 4A27_A Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06128 oxidoreductase; Provisional Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>PF01842 ACT: ACT domain; InterPro: IPR002912 The ACT domain is found in a variety of contexts and is proposed to be a conserved regulatory binding fold Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06101 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PRK06198 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06483 dihydromonapterin reductase; Provisional Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>KOG1205|consensus Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1201|consensus Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07453 protochlorophyllide oxidoreductase; Validated Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>PRK08862 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12937 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PLN02780 ketoreductase/ oxidoreductase Back     alignment and domain information
>PRK07985 oxidoreductase; Provisional Back     alignment and domain information
>PRK06701 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07904 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>PRK06953 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>PRK07856 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06114 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05884 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG0725|consensus Back     alignment and domain information
>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08340 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK12743 oxidoreductase; Provisional Back     alignment and domain information
>KOG1014|consensus Back     alignment and domain information
>PRK12938 acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06523 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08303 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06398 aldose dehydrogenase; Validated Back     alignment and domain information
>PRK06720 hypothetical protein; Provisional Back     alignment and domain information
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07097 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07791 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>cd04884 ACT_CBS C-terminal ACT domain of the cystathionine beta-synthase (CBS) domain protein found in Thermotoga maritima, Tm0935, and delta proteobacteria Back     alignment and domain information
>PRK08278 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>PRK08690 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07775 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated Back     alignment and domain information
>TIGR01289 LPOR light-dependent protochlorophyllide reductase Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>PRK05650 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>KOG1209|consensus Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK05599 hypothetical protein; Provisional Back     alignment and domain information
>PRK13656 trans-2-enoyl-CoA reductase; Provisional Back     alignment and domain information
>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07370 enoyl-(acyl carrier protein) reductase; Validated Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family Back     alignment and domain information
>PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 Back     alignment and domain information
>PRK09134 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>PRK08159 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>cd04888 ACT_PheB-BS C-terminal ACT domain of a small (~147 a Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07069 short chain dehydrogenase; Validated Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK07577 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02415 23BDH acetoin reductases Back     alignment and domain information
>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>PF13710 ACT_5: ACT domain; PDB: 2FGC_A 2PC6_A 2F1F_B Back     alignment and domain information
>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>PRK08219 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08936 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>cd04882 ACT_Bt0572_2 C-terminal ACT domain of a novel protein composed of just two ACT domains Back     alignment and domain information
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>KOG1200|consensus Back     alignment and domain information
>PRK12935 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK12746 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02730 enoyl-[acyl-carrier-protein] reductase Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>PRK06997 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd04878 ACT_AHAS N-terminal ACT domain of the Escherichia coli IlvH-like regulatory subunit of acetohydroxyacid synthase (AHAS) Back     alignment and domain information
>PRK12744 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02986 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PRK13255 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>TIGR02685 pter_reduc_Leis pteridine reductase Back     alignment and domain information
>PRK09730 putative NAD(P)-binding oxidoreductase; Provisional Back     alignment and domain information
>cd04874 ACT_Af1403 N-terminal ACT domain of the yet uncharacterized, small (~133 a Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06737 acetolactate synthase 1 regulatory subunit; Validated Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>KOG1210|consensus Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>cd04885 ACT_ThrD-I Tandem C-terminal ACT domains of threonine dehydratase I (ThrD-I; L-threonine hydrolyase) Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>PRK06947 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK06123 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06300 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>KOG1208|consensus Back     alignment and domain information
>PRK12747 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK07041 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN00015 protochlorophyllide reductase Back     alignment and domain information
>COG4122 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PRK12824 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>TIGR01124 ilvA_2Cterm threonine ammonia-lyase, biosynthetic, long form Back     alignment and domain information
>PLN02686 cinnamoyl-CoA reductase Back     alignment and domain information
>PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [] Back     alignment and domain information
>PRK08198 threonine dehydratase; Provisional Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase Back     alignment and domain information
>cd04887 ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-terminal ACT domain of putative NAD-dependent malic enzyme 1, Bacillus subtilis YqkI and related domains Back     alignment and domain information
>PRK12827 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02653 GDP-mannose 4,6-dehydratase Back     alignment and domain information
>cd04883 ACT_AcuB C-terminal ACT domain of the Bacillus subtilis acetoin utilization protein, AcuB Back     alignment and domain information
>PRK07023 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PLN02781 Probable caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>PRK14103 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>PLN02476 O-methyltransferase Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>COG4492 PheB ACT domain-containing protein [General function prediction only] Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>COG1028 FabG Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>PRK04435 hypothetical protein; Provisional Back     alignment and domain information
>PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>KOG1502|consensus Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>TIGR00138 gidB 16S rRNA methyltransferase GidB Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>TIGR01127 ilvA_1Cterm threonine dehydratase, medium form Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>cd02116 ACT ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB Back     alignment and domain information
>PF13291 ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A Back     alignment and domain information
>TIGR01777 yfcH conserved hypothetical protein TIGR01777 Back     alignment and domain information
>PLN02583 cinnamoyl-CoA reductase Back     alignment and domain information
>PRK11895 ilvH acetolactate synthase 3 regulatory subunit; Reviewed Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>PRK07334 threonine dehydratase; Provisional Back     alignment and domain information
>TIGR01472 gmd GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PF01596 Methyltransf_3: O-methyltransferase; InterPro: IPR002935 Members of this family are O-methyltransferases Back     alignment and domain information
>KOG1203|consensus Back     alignment and domain information
>PRK06382 threonine dehydratase; Provisional Back     alignment and domain information
>PRK07578 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>PRK08655 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PLN00198 anthocyanidin reductase; Provisional Back     alignment and domain information
>PLN02366 spermidine synthase Back     alignment and domain information
>PRK05579 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated Back     alignment and domain information
>PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query655
1phz_A429 Structure Of Phosphorylated Phenylalanine Hydroxyla 2e-93
1phz_A429 Structure Of Phosphorylated Phenylalanine Hydroxyla 6e-36
4anp_A324 Crystal Structure Of Human Phenylalanine Hydroxylas 5e-80
4anp_A324 Crystal Structure Of Human Phenylalanine Hydroxylas 1e-35
1j8t_A325 Catalytic Domain Of Human Phenylalanine Hydroxylase 5e-80
1j8t_A325 Catalytic Domain Of Human Phenylalanine Hydroxylase 1e-35
2pah_A335 Tetrameric Human Phenylalanine Hydroxylase Length = 5e-80
2pah_A335 Tetrameric Human Phenylalanine Hydroxylase Length = 1e-35
1dmw_A307 Crystal Structure Of Double Truncated Human Phenyla 9e-80
1dmw_A307 Crystal Structure Of Double Truncated Human Phenyla 2e-35
1pah_A308 Human Phenylalanine Hydroxylase Dimer, Residues 117 1e-79
1pah_A308 Human Phenylalanine Hydroxylase Dimer, Residues 117 2e-35
1tdw_A308 Crystal Structure Of Double Truncated Human Phenyla 3e-79
1tdw_A308 Crystal Structure Of Double Truncated Human Phenyla 5e-35
3e2t_A314 The Catalytic Domain Of Chicken Tryptophan Hydroxyl 6e-71
1mlw_A301 Crystal Structure Of Human Tryptophan Hydroxylase W 7e-70
3hf6_A290 Crystal Structure Of Human Tryptophan Hydroxylase T 8e-70
1toh_A343 Tyrosine Hydroxylase Catalytic And Tetramerization 1e-61
1toh_A343 Tyrosine Hydroxylase Catalytic And Tetramerization 7e-31
2xsn_A343 Crystal Structure Of Human Tyrosine Hydroxylase Cat 4e-61
2xsn_A 343 Crystal Structure Of Human Tyrosine Hydroxylase Cat 3e-31
2toh_A343 Tyrosine Hydroxylase Catalytic And Tetramerization 7e-61
2toh_A343 Tyrosine Hydroxylase Catalytic And Tetramerization 5e-30
2v28_A267 Apo Structure Of The Cold Active Phenylalanine Hydr 5e-13
2v28_A267 Apo Structure Of The Cold Active Phenylalanine Hydr 4e-09
2v27_A275 Structure Of The Cold Active Phenylalanine Hydroxyl 6e-13
2v27_A275 Structure Of The Cold Active Phenylalanine Hydroxyl 4e-09
3tk2_A302 Crystallographic Structure Of Phenylalanine Hydroxy 2e-10
3tk2_A 302 Crystallographic Structure Of Phenylalanine Hydroxy 5e-09
1ltu_A297 Crystal Structure Of Chromobacterium Violaceum, Apo 2e-10
1ltu_A 297 Crystal Structure Of Chromobacterium Violaceum, Apo 4e-09
3tcy_A302 Crystallographic Structure Of Phenylalanine Hydroxy 2e-10
3tcy_A 302 Crystallographic Structure Of Phenylalanine Hydroxy 5e-09
>pdb|1PHZ|A Chain A, Structure Of Phosphorylated Phenylalanine Hydroxylase Length = 429 Back     alignment and structure

Iteration: 1

Score = 340 bits (871), Expect = 2e-93, Method: Compositional matrix adjust. Identities = 183/320 (57%), Positives = 225/320 (70%), Gaps = 37/320 (11%) Query: 264 VIFSNHQDEVGALAKTLKLFKKHNVNLLHIESRSSTRIENNYEFM--VECAPGGDLSSVI 321 +IFS ++EVGALAK L+LF+++++NL HIESR S ++ YEF ++ L S+I Sbjct: 37 LIFS-LKEEVGALAKVLRLFEENDINLTHIESRPSRLNKDEYEFFTYLDKRTKPVLGSII 95 Query: 322 ESLRSSC-SYINIISRNHNQFHGVPWFPRRIRELDRFANQILSYGSELDADHPGFTDPVY 380 +SLR+ + ++ +SR+ + + VPWFPR I+ELDRFANQILSYG+ELDADHPGF DPVY Sbjct: 96 KSLRNDIGATVHELSRDKEK-NTVPWFPRTIQELDRFANQILSYGAELDADHPGFKDPVY 154 Query: 381 RARRKYFADLAFNYKHSILL----------------------------MPEHNHVFPLLI 412 RARRK FAD+A+NY+H + EHNH+FPLL Sbjct: 155 RARRKQFADIAYNYRHGQPIPRVEYTEEEKQTWGTVFRTLKALYKTHACYEHNHIFPLLE 214 Query: 413 QNCGYAEDNIPQLEDISKFLKDSTGFSLRPVAGLLSSRDFLAGLAFRVFHSTQYIRHPSK 472 + CG+ EDNIPQLED+S+FL+ TGF LRPVAGLLSSRDFL GLAFRVFH TQYIRH SK Sbjct: 215 KYCGFREDNIPQLEDVSQFLQTCTGFRLRPVAGLLSSRDFLGGLAFRVFHCTQYIRHGSK 274 Query: 473 PLYTPEPDVCHELLGHVPLFADPSFAQFSQEIGLASLGAPDEYVERLATSNNFMIVPRLA 532 P+YTPEPD+CHELLGHVPLF+D SFAQFSQEIGLASLGAPDEY+E+LAT F + L Sbjct: 275 PMYTPEPDICHELLGHVPLFSDRSFAQFSQEIGLASLGAPDEYIEKLATIYWFTVEFGLC 334 Query: 533 SLSPDSTGFSLRPVAGLLSS 552 + AGLLSS Sbjct: 335 KEGDSIKAYG----AGLLSS 350
>pdb|1PHZ|A Chain A, Structure Of Phosphorylated Phenylalanine Hydroxylase Length = 429 Back     alignment and structure
>pdb|4ANP|A Chain A, Crystal Structure Of Human Phenylalanine Hydroxylase In Complex With A Pharmacological Chaperone Length = 324 Back     alignment and structure
>pdb|4ANP|A Chain A, Crystal Structure Of Human Phenylalanine Hydroxylase In Complex With A Pharmacological Chaperone Length = 324 Back     alignment and structure
>pdb|1J8T|A Chain A, Catalytic Domain Of Human Phenylalanine Hydroxylase Fe(Ii) Length = 325 Back     alignment and structure
>pdb|1J8T|A Chain A, Catalytic Domain Of Human Phenylalanine Hydroxylase Fe(Ii) Length = 325 Back     alignment and structure
>pdb|2PAH|A Chain A, Tetrameric Human Phenylalanine Hydroxylase Length = 335 Back     alignment and structure
>pdb|2PAH|A Chain A, Tetrameric Human Phenylalanine Hydroxylase Length = 335 Back     alignment and structure
>pdb|1DMW|A Chain A, Crystal Structure Of Double Truncated Human Phenylalanine Hydroxylase With Bound 7,8-Dihydro-L-Biopterin Length = 307 Back     alignment and structure
>pdb|1DMW|A Chain A, Crystal Structure Of Double Truncated Human Phenylalanine Hydroxylase With Bound 7,8-Dihydro-L-Biopterin Length = 307 Back     alignment and structure
>pdb|1PAH|A Chain A, Human Phenylalanine Hydroxylase Dimer, Residues 117-424 Length = 308 Back     alignment and structure
>pdb|1PAH|A Chain A, Human Phenylalanine Hydroxylase Dimer, Residues 117-424 Length = 308 Back     alignment and structure
>pdb|1TDW|A Chain A, Crystal Structure Of Double Truncated Human Phenylalanine Hydroxylase Bh4-Responsive Pku Mutant A313t. Length = 308 Back     alignment and structure
>pdb|1TDW|A Chain A, Crystal Structure Of Double Truncated Human Phenylalanine Hydroxylase Bh4-Responsive Pku Mutant A313t. Length = 308 Back     alignment and structure
>pdb|3E2T|A Chain A, The Catalytic Domain Of Chicken Tryptophan Hydroxylase 1 With Bound Tryptophan Length = 314 Back     alignment and structure
>pdb|1MLW|A Chain A, Crystal Structure Of Human Tryptophan Hydroxylase With Bound 7,8-Dihydro-L-Biopterin Cofactor And Fe(Iii) Length = 301 Back     alignment and structure
>pdb|3HF6|A Chain A, Crystal Structure Of Human Tryptophan Hydroxylase Type 1 With Bound Lp-521834 And Fe Length = 290 Back     alignment and structure
>pdb|1TOH|A Chain A, Tyrosine Hydroxylase Catalytic And Tetramerization Domains From Rat Length = 343 Back     alignment and structure
>pdb|1TOH|A Chain A, Tyrosine Hydroxylase Catalytic And Tetramerization Domains From Rat Length = 343 Back     alignment and structure
>pdb|2XSN|A Chain A, Crystal Structure Of Human Tyrosine Hydroxylase Catalytic Domain Length = 343 Back     alignment and structure
>pdb|2XSN|A Chain A, Crystal Structure Of Human Tyrosine Hydroxylase Catalytic Domain Length = 343 Back     alignment and structure
>pdb|2TOH|A Chain A, Tyrosine Hydroxylase Catalytic And Tetramerization Domains From Rat Length = 343 Back     alignment and structure
>pdb|2TOH|A Chain A, Tyrosine Hydroxylase Catalytic And Tetramerization Domains From Rat Length = 343 Back     alignment and structure
>pdb|2V28|A Chain A, Apo Structure Of The Cold Active Phenylalanine Hydroxylase From Colwellia Psychrerythraea 34h Length = 267 Back     alignment and structure
>pdb|2V28|A Chain A, Apo Structure Of The Cold Active Phenylalanine Hydroxylase From Colwellia Psychrerythraea 34h Length = 267 Back     alignment and structure
>pdb|2V27|A Chain A, Structure Of The Cold Active Phenylalanine Hydroxylase From Colwellia Psychrerythraea 34h Length = 275 Back     alignment and structure
>pdb|2V27|A Chain A, Structure Of The Cold Active Phenylalanine Hydroxylase From Colwellia Psychrerythraea 34h Length = 275 Back     alignment and structure
>pdb|3TK2|A Chain A, Crystallographic Structure Of Phenylalanine Hydroxylase From Chromobacterium Violaceum Cocrystallized With Phenylalanine In A Site Distal To The Active Site Length = 302 Back     alignment and structure
>pdb|3TK2|A Chain A, Crystallographic Structure Of Phenylalanine Hydroxylase From Chromobacterium Violaceum Cocrystallized With Phenylalanine In A Site Distal To The Active Site Length = 302 Back     alignment and structure
>pdb|1LTU|A Chain A, Crystal Structure Of Chromobacterium Violaceum, Apo (No Iron Bound) Structure Length = 297 Back     alignment and structure
>pdb|1LTU|A Chain A, Crystal Structure Of Chromobacterium Violaceum, Apo (No Iron Bound) Structure Length = 297 Back     alignment and structure
>pdb|3TCY|A Chain A, Crystallographic Structure Of Phenylalanine Hydroxylase From Chromobacterium Violaceum (Cpah) Bound To Phenylalanine In A Site Distal To The Active Site Length = 302 Back     alignment and structure
>pdb|3TCY|A Chain A, Crystallographic Structure Of Phenylalanine Hydroxylase From Chromobacterium Violaceum (Cpah) Bound To Phenylalanine In A Site Distal To The Active Site Length = 302 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query655
1phz_A429 Protein (phenylalanine hydroxylase); aromatic amin 1e-76
1phz_A429 Protein (phenylalanine hydroxylase); aromatic amin 3e-37
1phz_A429 Protein (phenylalanine hydroxylase); aromatic amin 2e-26
1phz_A429 Protein (phenylalanine hydroxylase); aromatic amin 6e-09
1j8u_A325 Phenylalanine-4-hydroxylase; ferrous iron, 2-His-1 1e-63
1j8u_A325 Phenylalanine-4-hydroxylase; ferrous iron, 2-His-1 5e-37
1j8u_A325 Phenylalanine-4-hydroxylase; ferrous iron, 2-His-1 1e-25
1j8u_A325 Phenylalanine-4-hydroxylase; ferrous iron, 2-His-1 2e-10
1toh_A343 Tyroh, tyrosine hydroxylase; neurotransmitter bios 8e-63
1toh_A343 Tyroh, tyrosine hydroxylase; neurotransmitter bios 6e-37
1toh_A343 Tyroh, tyrosine hydroxylase; neurotransmitter bios 2e-24
1toh_A343 Tyroh, tyrosine hydroxylase; neurotransmitter bios 2e-11
1mlw_A301 Tryptophan 5-monooxygenase; aromatic amino acid hy 1e-59
1mlw_A301 Tryptophan 5-monooxygenase; aromatic amino acid hy 1e-37
1mlw_A301 Tryptophan 5-monooxygenase; aromatic amino acid hy 4e-25
1mlw_A301 Tryptophan 5-monooxygenase; aromatic amino acid hy 2e-09
1ltz_A297 Phenylalanine-4-hydroxylase; oxidoreductase, dihyd 3e-46
1ltz_A297 Phenylalanine-4-hydroxylase; oxidoreductase, dihyd 2e-35
1ltz_A297 Phenylalanine-4-hydroxylase; oxidoreductase, dihyd 3e-27
1ltz_A297 Phenylalanine-4-hydroxylase; oxidoreductase, dihyd 5e-06
2v27_A275 Phenylalanine hydroxylase; cold adaptation, tetrah 8e-35
2v27_A275 Phenylalanine hydroxylase; cold adaptation, tetrah 4e-33
2v27_A275 Phenylalanine hydroxylase; cold adaptation, tetrah 7e-26
1yb5_A351 Quinone oxidoreductase; medium-chain dehydrogenase 1e-08
4eye_A342 Probable oxidoreductase; structural genomics, niai 1e-08
1iz0_A302 Quinone oxidoreductase; APO-enzyme, riken structur 3e-08
3pi7_A349 NADH oxidoreductase; groes-like fold, NAD(P)-bindi 6e-08
2eih_A343 Alcohol dehydrogenase; zinc ION binding protein, s 6e-08
3fbg_A346 Putative arginate lyase; structural genomics, unkn 7e-08
3gms_A340 Putative NADPH:quinone reductase; structural genom 1e-07
1gu7_A364 Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s 1e-07
2qmw_A267 PDT, prephenate dehydratase; APC85812, prephenate 3e-07
4a0s_A447 Octenoyl-COA reductase/carboxylase; oxidoreductase 3e-07
1zsy_A357 Mitochondrial 2-enoyl thioester reductase; medium- 3e-07
3krt_A456 Crotonyl COA reductase; structural genomics, prote 5e-07
2c0c_A362 Zinc binding alcohol dehydrogenase, domain contain 1e-06
4dup_A353 Quinone oxidoreductase; PSI-biology, structural ge 1e-06
3mwb_A313 Prephenate dehydratase; L-Phe, PSI, MCSG, structur 1e-06
4dvj_A363 Putative zinc-dependent alcohol dehydrogenase Pro; 2e-06
2j8z_A354 Quinone oxidoreductase; medium-chain dehydrogenase 2e-06
3uog_A363 Alcohol dehydrogenase; structural genomics, protei 7e-06
2vn8_A375 Reticulon-4-interacting protein 1; mitochondrion, 7e-06
3gqv_A371 Enoyl reductase; medium-chain reductase (MDR super 8e-06
3luy_A329 Probable chorismate mutase; structural genomics, A 2e-05
3iup_A379 Putative NADPH:quinone oxidoreductase; YP_296108.1 2e-05
3tqh_A321 Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella 3e-05
2qmx_A283 Prephenate dehydratase; APC86053, L-Phe inhibition 6e-05
3gaz_A343 Alcohol dehydrogenase superfamily protein; oxidore 2e-04
3goh_A315 Alcohol dehydrogenase, zinc-containing; NP_718042. 2e-04
3slk_A795 Polyketide synthase extender module 2; rossmann fo 3e-04
1wly_A333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 3e-04
1qor_A327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 4e-04
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 5e-04
3qwb_A334 Probable quinone oxidoreductase; rossmann fold, qu 6e-04
1jvb_A347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 7e-04
3jyn_A325 Quinone oxidoreductase; rossmann fold, protein-NAD 8e-04
>1phz_A Protein (phenylalanine hydroxylase); aromatic amino acid hydroxylase, phosphorylation, intrasteric regulation, allosteric regulation; 2.20A {Rattus norvegicus} SCOP: d.58.18.3 d.178.1.1 PDB: 2phm_A Length = 429 Back     alignment and structure
 Score =  250 bits (640), Expect = 1e-76
 Identities = 174/294 (59%), Positives = 208/294 (70%), Gaps = 31/294 (10%)

Query: 264 VIFSNHQDEVGALAKTLKLFKKHNVNLLHIESRSSTRIENNYEFMV--ECAPGGDLSSVI 321
           +IFS   +EVGALAK L+LF+++++NL HIESR S   ++ YEF    +      L S+I
Sbjct: 37  LIFSLK-EEVGALAKVLRLFEENDINLTHIESRPSRLNKDEYEFFTYLDKRTKPVLGSII 95

Query: 322 ESLRSSCSYINIISRNHNQFHGVPWFPRRIRELDRFANQILSYGSELDADHPGFTDPVYR 381
           +SLR+             + + VPWFPR I+ELDRFANQILSYG+ELDADHPGF DPVYR
Sbjct: 96  KSLRNDIGATVHELSRDKEKNTVPWFPRTIQELDRFANQILSYGAELDADHPGFKDPVYR 155

Query: 382 ARRKYFADLAFNYKHSI----------------LLM------------PEHNHVFPLLIQ 413
           ARRK FAD+A+NY+H                   +              EHNH+FPLL +
Sbjct: 156 ARRKQFADIAYNYRHGQPIPRVEYTEEEKQTWGTVFRTLKALYKTHACYEHNHIFPLLEK 215

Query: 414 NCGYAEDNIPQLEDISKFLKDSTGFSLRPVAGLLSSRDFLAGLAFRVFHSTQYIRHPSKP 473
            CG+ EDNIPQLED+S+FL+  TGF LRPVAGLLSSRDFL GLAFRVFH TQYIRH SKP
Sbjct: 216 YCGFREDNIPQLEDVSQFLQTCTGFRLRPVAGLLSSRDFLGGLAFRVFHCTQYIRHGSKP 275

Query: 474 LYTPEPDVCHELLGHVPLFADPSFAQFSQEIGLASLGAPDEYVERLATSNNFMI 527
           +YTPEPD+CHELLGHVPLF+D SFAQFSQEIGLASLGAPDEY+E+LAT   F +
Sbjct: 276 MYTPEPDICHELLGHVPLFSDRSFAQFSQEIGLASLGAPDEYIEKLATIYWFTV 329


>1phz_A Protein (phenylalanine hydroxylase); aromatic amino acid hydroxylase, phosphorylation, intrasteric regulation, allosteric regulation; 2.20A {Rattus norvegicus} SCOP: d.58.18.3 d.178.1.1 PDB: 2phm_A Length = 429 Back     alignment and structure
>1phz_A Protein (phenylalanine hydroxylase); aromatic amino acid hydroxylase, phosphorylation, intrasteric regulation, allosteric regulation; 2.20A {Rattus norvegicus} SCOP: d.58.18.3 d.178.1.1 PDB: 2phm_A Length = 429 Back     alignment and structure
>1phz_A Protein (phenylalanine hydroxylase); aromatic amino acid hydroxylase, phosphorylation, intrasteric regulation, allosteric regulation; 2.20A {Rattus norvegicus} SCOP: d.58.18.3 d.178.1.1 PDB: 2phm_A Length = 429 Back     alignment and structure
>1j8u_A Phenylalanine-4-hydroxylase; ferrous iron, 2-His-1-carboxylate facial triad, tetrahydrobiopterin, oxidoreductase; HET: H4B; 1.50A {Homo sapiens} SCOP: d.178.1.1 PDB: 1j8t_A* 1kw0_A* 1lrm_A* 1mmk_A* 1mmt_A* 4anp_A* 2pah_A 1pah_A 3pah_A* 4pah_A* 5pah_A* 6pah_A* 1tdw_A 1tg2_A* 1dmw_A* Length = 325 Back     alignment and structure
>1j8u_A Phenylalanine-4-hydroxylase; ferrous iron, 2-His-1-carboxylate facial triad, tetrahydrobiopterin, oxidoreductase; HET: H4B; 1.50A {Homo sapiens} SCOP: d.178.1.1 PDB: 1j8t_A* 1kw0_A* 1lrm_A* 1mmk_A* 1mmt_A* 4anp_A* 2pah_A 1pah_A 3pah_A* 4pah_A* 5pah_A* 6pah_A* 1tdw_A 1tg2_A* 1dmw_A* Length = 325 Back     alignment and structure
>1j8u_A Phenylalanine-4-hydroxylase; ferrous iron, 2-His-1-carboxylate facial triad, tetrahydrobiopterin, oxidoreductase; HET: H4B; 1.50A {Homo sapiens} SCOP: d.178.1.1 PDB: 1j8t_A* 1kw0_A* 1lrm_A* 1mmk_A* 1mmt_A* 4anp_A* 2pah_A 1pah_A 3pah_A* 4pah_A* 5pah_A* 6pah_A* 1tdw_A 1tg2_A* 1dmw_A* Length = 325 Back     alignment and structure
>1j8u_A Phenylalanine-4-hydroxylase; ferrous iron, 2-His-1-carboxylate facial triad, tetrahydrobiopterin, oxidoreductase; HET: H4B; 1.50A {Homo sapiens} SCOP: d.178.1.1 PDB: 1j8t_A* 1kw0_A* 1lrm_A* 1mmk_A* 1mmt_A* 4anp_A* 2pah_A 1pah_A 3pah_A* 4pah_A* 5pah_A* 6pah_A* 1tdw_A 1tg2_A* 1dmw_A* Length = 325 Back     alignment and structure
>1toh_A Tyroh, tyrosine hydroxylase; neurotransmitter biosynthesis, non-heme iron, P substrate; 2.30A {Rattus norvegicus} SCOP: d.178.1.1 PDB: 2toh_A* 2xsn_A Length = 343 Back     alignment and structure
>1toh_A Tyroh, tyrosine hydroxylase; neurotransmitter biosynthesis, non-heme iron, P substrate; 2.30A {Rattus norvegicus} SCOP: d.178.1.1 PDB: 2toh_A* 2xsn_A Length = 343 Back     alignment and structure
>1toh_A Tyroh, tyrosine hydroxylase; neurotransmitter biosynthesis, non-heme iron, P substrate; 2.30A {Rattus norvegicus} SCOP: d.178.1.1 PDB: 2toh_A* 2xsn_A Length = 343 Back     alignment and structure
>1toh_A Tyroh, tyrosine hydroxylase; neurotransmitter biosynthesis, non-heme iron, P substrate; 2.30A {Rattus norvegicus} SCOP: d.178.1.1 PDB: 2toh_A* 2xsn_A Length = 343 Back     alignment and structure
>1mlw_A Tryptophan 5-monooxygenase; aromatic amino acid hydroxylase catalytic domain fold, oxidoreductase; HET: HBI; 1.71A {Homo sapiens} SCOP: d.178.1.1 PDB: 3hf6_A* 3hf8_A* 3hfb_A* 3e2t_A* Length = 301 Back     alignment and structure
>1mlw_A Tryptophan 5-monooxygenase; aromatic amino acid hydroxylase catalytic domain fold, oxidoreductase; HET: HBI; 1.71A {Homo sapiens} SCOP: d.178.1.1 PDB: 3hf6_A* 3hf8_A* 3hfb_A* 3e2t_A* Length = 301 Back     alignment and structure
>1mlw_A Tryptophan 5-monooxygenase; aromatic amino acid hydroxylase catalytic domain fold, oxidoreductase; HET: HBI; 1.71A {Homo sapiens} SCOP: d.178.1.1 PDB: 3hf6_A* 3hf8_A* 3hfb_A* 3e2t_A* Length = 301 Back     alignment and structure
>1mlw_A Tryptophan 5-monooxygenase; aromatic amino acid hydroxylase catalytic domain fold, oxidoreductase; HET: HBI; 1.71A {Homo sapiens} SCOP: d.178.1.1 PDB: 3hf6_A* 3hf8_A* 3hfb_A* 3e2t_A* Length = 301 Back     alignment and structure
>1ltz_A Phenylalanine-4-hydroxylase; oxidoreductase, dihydrobiopterin, bacterial enzyme; HET: HBI; 1.40A {Chromobacterium violaceum} SCOP: d.178.1.1 PDB: 1ltv_A 1ltu_A* Length = 297 Back     alignment and structure
>1ltz_A Phenylalanine-4-hydroxylase; oxidoreductase, dihydrobiopterin, bacterial enzyme; HET: HBI; 1.40A {Chromobacterium violaceum} SCOP: d.178.1.1 PDB: 1ltv_A 1ltu_A* Length = 297 Back     alignment and structure
>1ltz_A Phenylalanine-4-hydroxylase; oxidoreductase, dihydrobiopterin, bacterial enzyme; HET: HBI; 1.40A {Chromobacterium violaceum} SCOP: d.178.1.1 PDB: 1ltv_A 1ltu_A* Length = 297 Back     alignment and structure
>1ltz_A Phenylalanine-4-hydroxylase; oxidoreductase, dihydrobiopterin, bacterial enzyme; HET: HBI; 1.40A {Chromobacterium violaceum} SCOP: d.178.1.1 PDB: 1ltv_A 1ltu_A* Length = 297 Back     alignment and structure
>2v27_A Phenylalanine hydroxylase; cold adaptation, tetrahydrobiopterin, stability, flexibility, alkaptonuria, oxidoreductase; 1.50A {Colwellia psychrerythraea 34H} PDB: 2v28_A Length = 275 Back     alignment and structure
>2v27_A Phenylalanine hydroxylase; cold adaptation, tetrahydrobiopterin, stability, flexibility, alkaptonuria, oxidoreductase; 1.50A {Colwellia psychrerythraea 34H} PDB: 2v28_A Length = 275 Back     alignment and structure
>2v27_A Phenylalanine hydroxylase; cold adaptation, tetrahydrobiopterin, stability, flexibility, alkaptonuria, oxidoreductase; 1.50A {Colwellia psychrerythraea 34H} PDB: 2v28_A Length = 275 Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Length = 351 Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Length = 342 Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Length = 302 Back     alignment and structure
>3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} Length = 349 Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Length = 343 Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Length = 346 Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Length = 340 Back     alignment and structure
>1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A Length = 364 Back     alignment and structure
>2qmw_A PDT, prephenate dehydratase; APC85812, prephenate dehydratase (PDT), staphylococcus aureu aureus MU50, structural genomics, PSI-2; 2.30A {Staphylococcus aureus subsp} SCOP: c.94.1.1 d.58.18.3 Length = 267 Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Length = 447 Back     alignment and structure
>1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A Length = 357 Back     alignment and structure
>3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Length = 456 Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Length = 362 Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Length = 353 Back     alignment and structure
>3mwb_A Prephenate dehydratase; L-Phe, PSI, MCSG, structural genomics, midwest center for ST genomics, protein structure initiative, lyase; HET: MSE PHE; 2.00A {Arthrobacter aurescens} Length = 313 Back     alignment and structure
>4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} Length = 363 Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Length = 354 Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Length = 363 Back     alignment and structure
>2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Length = 375 Back     alignment and structure
>3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* Length = 371 Back     alignment and structure
>3luy_A Probable chorismate mutase; structural genomics, APC38059, 3-phenylp PSI-2, protein structure initiative; HET: PPY; 2.00A {Bifidobacterium adolescentis} Length = 329 Back     alignment and structure
>3iup_A Putative NADPH:quinone oxidoreductase; YP_296108.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE NDP; 1.70A {Ralstonia eutropha} Length = 379 Back     alignment and structure
>3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Length = 321 Back     alignment and structure
>2qmx_A Prephenate dehydratase; APC86053, L-Phe inhibition, PDT, CHL tepidum TLS, structural genomics, PSI-2, protein structure initiative; HET: PHE; 2.30A {Chlorobium tepidum tls} Length = 283 Back     alignment and structure
>3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Length = 343 Back     alignment and structure
>3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Length = 315 Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Length = 795 Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Length = 333 Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Length = 327 Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Length = 334 Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Length = 347 Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Length = 325 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query655
1phz_A429 Protein (phenylalanine hydroxylase); aromatic amin 100.0
1j8u_A325 Phenylalanine-4-hydroxylase; ferrous iron, 2-His-1 100.0
1toh_A343 Tyroh, tyrosine hydroxylase; neurotransmitter bios 100.0
1mlw_A301 Tryptophan 5-monooxygenase; aromatic amino acid hy 100.0
2v27_A275 Phenylalanine hydroxylase; cold adaptation, tetrah 100.0
3tk2_A302 Phenylalanine-4-hydroxylase; protein-substate comp 100.0
2v27_A275 Phenylalanine hydroxylase; cold adaptation, tetrah 99.96
1mlw_A301 Tryptophan 5-monooxygenase; aromatic amino acid hy 99.96
1j8u_A325 Phenylalanine-4-hydroxylase; ferrous iron, 2-His-1 99.95
1toh_A343 Tyroh, tyrosine hydroxylase; neurotransmitter bios 99.95
3tk2_A302 Phenylalanine-4-hydroxylase; protein-substate comp 99.95
1phz_A429 Protein (phenylalanine hydroxylase); aromatic amin 99.94
3s2e_A340 Zinc-containing alcohol dehydrogenase superfamily; 99.87
3jv7_A345 ADH-A; dehydrogenase, nucleotide binding, rossmann 99.87
3fpc_A352 NADP-dependent alcohol dehydrogenase; oxydoreducta 99.86
2eih_A343 Alcohol dehydrogenase; zinc ION binding protein, s 99.86
4dup_A353 Quinone oxidoreductase; PSI-biology, structural ge 99.85
3ip1_A404 Alcohol dehydrogenase, zinc-containing; structural 99.85
3uko_A378 Alcohol dehydrogenase class-3; alcohol dehydrogena 99.85
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 99.84
4eye_A342 Probable oxidoreductase; structural genomics, niai 99.84
1h2b_A359 Alcohol dehydrogenase; oxidoreductase, archaea, hy 99.84
1uuf_A369 YAHK, zinc-type alcohol dehydrogenase-like protein 99.84
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 99.84
3uog_A363 Alcohol dehydrogenase; structural genomics, protei 99.84
1piw_A360 Hypothetical zinc-type alcohol dehydrogenase- like 99.84
2h6e_A344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 99.84
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 99.84
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 99.84
1vj0_A380 Alcohol dehydrogenase, zinc-containing; TM0436, st 99.83
3qwb_A334 Probable quinone oxidoreductase; rossmann fold, qu 99.83
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 99.83
3mwb_A313 Prephenate dehydratase; L-Phe, PSI, MCSG, structur 99.83
4eez_A348 Alcohol dehydrogenase 1; site-saturation mutagenes 99.83
1e3i_A376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 99.82
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 99.82
3jyn_A325 Quinone oxidoreductase; rossmann fold, protein-NAD 99.82
2cf5_A357 Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign 99.82
1f8f_A371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 99.82
1p0f_A373 NADP-dependent alcohol dehydrogenase; ADH topology 99.82
3tqh_A321 Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella 99.82
3m6i_A363 L-arabinitol 4-dehydrogenase; medium chain dehydro 99.82
2fzw_A373 Alcohol dehydrogenase class III CHI chain; S-nitro 99.82
2jhf_A374 Alcohol dehydrogenase E chain; oxidoreductase, met 99.82
2dq4_A343 L-threonine 3-dehydrogenase; NAD-dependent, oxidor 99.81
4dvj_A363 Putative zinc-dependent alcohol dehydrogenase Pro; 99.81
3fbg_A346 Putative arginate lyase; structural genomics, unkn 99.81
1jvb_A347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 99.81
1cdo_A374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 99.81
3krt_A456 Crotonyl COA reductase; structural genomics, prote 99.81
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 99.81
1yqd_A366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 99.8
3gms_A340 Putative NADPH:quinone reductase; structural genom 99.8
1kol_A398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 99.8
4b7c_A336 Probable oxidoreductase; NADP cofactor, rossmann f 99.8
3slk_A795 Polyketide synthase extender module 2; rossmann fo 99.8
1gu7_A364 Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s 99.8
2b5w_A357 Glucose dehydrogenase; nucleotide binding motif, o 99.79
2j8z_A354 Quinone oxidoreductase; medium-chain dehydrogenase 99.79
2dph_A398 Formaldehyde dismutase; dismutation of aldehydes, 99.79
1yb5_A351 Quinone oxidoreductase; medium-chain dehydrogenase 99.79
4a0s_A447 Octenoyl-COA reductase/carboxylase; oxidoreductase 99.79
1qor_A327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 99.78
3gaz_A343 Alcohol dehydrogenase superfamily protein; oxidore 99.77
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 99.76
3gqv_A371 Enoyl reductase; medium-chain reductase (MDR super 99.76
4a27_A349 Synaptic vesicle membrane protein VAT-1 homolog-L; 99.76
2vn8_A375 Reticulon-4-interacting protein 1; mitochondrion, 99.75
1wly_A333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 99.75
1iz0_A302 Quinone oxidoreductase; APO-enzyme, riken structur 99.75
2c0c_A362 Zinc binding alcohol dehydrogenase, domain contain 99.75
4a2c_A346 Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc 99.74
3goh_A315 Alcohol dehydrogenase, zinc-containing; NP_718042. 99.74
1zsy_A357 Mitochondrial 2-enoyl thioester reductase; medium- 99.74
1v3u_A333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 99.74
2zb4_A357 Prostaglandin reductase 2; rossmann fold, alternat 99.74
1xa0_A328 Putative NADPH dependent oxidoreductases; structur 99.73
3nx4_A324 Putative oxidoreductase; csgid, structural genomic 99.72
2cdc_A366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 99.72
3pi7_A349 NADH oxidoreductase; groes-like fold, NAD(P)-bindi 99.71
3luy_A329 Probable chorismate mutase; structural genomics, A 99.7
2qmx_A283 Prephenate dehydratase; APC86053, L-Phe inhibition 99.7
2j3h_A345 NADP-dependent oxidoreductase P1; double bond redu 99.69
1tt7_A330 YHFP; alcohol dehydrogenase, Zn-dependent, NAD, st 99.68
3iup_A379 Putative NADPH:quinone oxidoreductase; YP_296108.1 99.65
2qmw_A267 PDT, prephenate dehydratase; APC85812, prephenate 99.65
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 99.6
3ce6_A494 Adenosylhomocysteinase; protein-substrate complex, 98.43
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 98.41
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 98.33
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 98.32
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 98.24
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 98.17
1gpj_A404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 98.15
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 97.9
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 97.78
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 97.72
3gvp_A435 Adenosylhomocysteinase 3; protein CO-factor comple 97.7
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 97.69
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 97.65
3c85_A183 Putative glutathione-regulated potassium-efflux S 97.61
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 97.61
1g0o_A283 Trihydroxynaphthalene reductase; protein-NADPH-act 97.58
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 97.58
3n58_A464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 97.56
3ioy_A319 Short-chain dehydrogenase/reductase SDR; structura 97.54
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 97.54
4eso_A255 Putative oxidoreductase; NADP, structural genomics 97.51
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 97.5
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 97.48
3tjr_A301 Short chain dehydrogenase; structural genomics, se 97.47
3o26_A311 Salutaridine reductase; short chain dehydrogenase/ 97.47
1zmo_A244 Halohydrin dehalogenase; haloalcohol dehalogenase, 97.47
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 97.45
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 97.44
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 97.43
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 97.41
3ged_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 97.4
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 97.4
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 97.39
3is3_A270 17BETA-hydroxysteroid dehydrogenase; short chain d 97.38
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 97.38
3edm_A259 Short chain dehydrogenase; structural genomics, ox 97.38
2a4k_A263 3-oxoacyl-[acyl carrier protein] reductase; reduct 97.37
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 97.37
3u5t_A267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 97.36
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 97.36
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 97.35
2rir_A300 Dipicolinate synthase, A chain; structural genomic 97.35
1wma_A276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 97.35
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 97.35
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 97.33
1zmt_A254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 97.33
3ksu_A262 3-oxoacyl-acyl carrier protein reductase; structur 97.32
1uls_A245 Putative 3-oxoacyl-acyl carrier protein reductase; 97.31
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 97.29
3grk_A293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 97.29
3kvo_A346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 97.29
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 97.28
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 97.28
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 97.28
4dqx_A277 Probable oxidoreductase protein; structural genomi 97.28
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 97.28
3sx2_A278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 97.28
2h7i_A269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 97.28
3p19_A266 BFPVVD8, putative blue fluorescent protein; rossma 97.27
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 97.26
3uce_A223 Dehydrogenase; rossmann fold, oxidoreductase; HET: 97.26
2pd4_A275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 97.26
2wyu_A261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 97.25
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 97.25
3gem_A260 Short chain dehydrogenase; structural genomics, AP 97.25
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 97.25
3k31_A296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 97.24
3rd5_A291 Mypaa.01249.C; ssgcid, structural genomics, seattl 97.23
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 97.23
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 97.23
4b79_A242 PA4098, probable short-chain dehydrogenase; oxidor 97.23
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 97.23
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 97.23
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 97.22
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 97.22
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 97.22
2ekp_A239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 97.22
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 97.21
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 97.21
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 97.2
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 97.2
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 97.2
2ew8_A249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 97.19
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 97.19
1dhr_A241 Dihydropteridine reductase; oxidoreductase(acting 97.19
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 97.19
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 97.18
2ag5_A246 DHRS6, dehydrogenase/reductase (SDR family) member 97.18
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 97.17
2qq5_A260 DHRS1, dehydrogenase/reductase SDR family member 1 97.17
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 97.16
2x9g_A288 PTR1, pteridine reductase; short chain dehydrogena 97.16
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 97.15
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 97.15
3r3s_A294 Oxidoreductase; structural genomics, csgid, center 97.15
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 97.15
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 97.15
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 97.14
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 97.14
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 97.14
4fs3_A256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 97.14
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 97.13
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 97.13
3zv4_A281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 97.13
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 97.13
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 97.12
1ooe_A236 Dihydropteridine reductase; structural genomics, P 97.12
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 97.12
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 97.11
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 97.11
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 97.11
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 97.11
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 97.1
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 97.1
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 97.1
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 97.09
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 97.09
1xu9_A286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 97.09
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 97.09
3e48_A289 Putative nucleoside-diphosphate-sugar epimerase; a 97.08
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 97.08
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 97.07
2d1y_A256 Hypothetical protein TT0321; strucrtural genomics, 97.07
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 97.07
4ibo_A271 Gluconate dehydrogenase; enzyme function initiativ 97.06
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 97.06
1geg_A256 Acetoin reductase; SDR family, oxidoreductase; HET 97.05
3s55_A281 Putative short-chain dehydrogenase/reductase; stru 97.05
2p91_A285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 97.05
3cxt_A291 Dehydrogenase with different specificities; rossma 97.04
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 97.04
1uzm_A247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 97.04
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 97.04
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 97.03
1c1d_A355 L-phenylalanine dehydrogenase; amino acid dehydrog 97.02
3imf_A257 Short chain dehydrogenase; structural genomics, in 97.02
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 97.01
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 97.01
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 97.01
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 97.0
1nff_A260 Putative oxidoreductase RV2002; directed evolution 97.0
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 97.0
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 97.0
1x1t_A260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 96.99
1mxh_A276 Pteridine reductase 2; SDR topology, protein-subst 96.99
1p91_A269 Ribosomal RNA large subunit methyltransferase A; R 96.99
3ek2_A271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 96.99
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 96.99
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 96.98
3m1a_A281 Putative dehydrogenase; short, PSI, MCSG, structur 96.98
3tox_A280 Short chain dehydrogenase; structural genomics, PS 96.98
1xkq_A280 Short-chain reductase family member (5D234); parra 96.98
1yde_A270 Retinal dehydrogenase/reductase 3; oxidoreductase, 96.97
3t7c_A299 Carveol dehydrogenase; structural genomics, seattl 96.96
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 96.95
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 96.95
4gkb_A258 3-oxoacyl-[acyl-carrier protein] reductase; putati 96.95
1hxh_A253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 96.95
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 96.94
3oid_A258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 96.92
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 96.92
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 96.91
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 96.91
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 96.91
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 96.91
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 96.91
3a28_C258 L-2.3-butanediol dehydrogenase; chiral substrate r 96.89
4imr_A275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 96.89
1fjh_A257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 96.89
1xhl_A297 Short-chain dehydrogenase/reductase family member 96.89
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 96.89
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 96.89
3uve_A286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 96.88
3sc4_A285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 96.88
3rih_A293 Short chain dehydrogenase or reductase; structural 96.88
1yxm_A303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 96.87
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 96.87
3oec_A317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 96.87
1spx_A278 Short-chain reductase family member (5L265); paral 96.87
1gz6_A319 Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF 96.87
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 96.86
2fk8_A318 Methoxy mycolic acid synthase 4; S-adenosylmethion 96.86
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 96.85
4dmm_A269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 96.84
3e03_A274 Short chain dehydrogenase; structural genomics, PS 96.84
2ph3_A245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 96.84
4iin_A271 3-ketoacyl-acyl carrier protein reductase (FABG); 96.83
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 96.82
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 96.82
3h9u_A436 Adenosylhomocysteinase; NAD CO-factor complex, str 96.81
3vtz_A269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 96.8
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 96.8
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 96.8
1qsg_A265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 96.79
4hp8_A247 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi 96.78
3s8m_A422 Enoyl-ACP reductase; rossmann fold, oxidoreductase 96.78
3u9l_A324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 96.78
3qlj_A322 Short chain dehydrogenase; structural genomics, se 96.77
4h15_A261 Short chain alcohol dehydrogenase-related dehydro; 96.76
1o5i_A249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 96.76
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 96.76
2hnk_A239 SAM-dependent O-methyltransferase; modified rossma 96.75
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 96.75
3tsc_A277 Putative oxidoreductase; structural genomics, seat 96.75
3asu_A248 Short-chain dehydrogenase/reductase SDR; SDR famil 96.75
1e7w_A291 Pteridine reductase; dihydrofolate reductase, shor 96.75
2fwm_X250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 96.75
1xq6_A253 Unknown protein; structural genomics, protein stru 96.74
3tl3_A257 Short-chain type dehydrogenase/reductase; ssgcid, 96.72
2gpy_A233 O-methyltransferase; structural genomics, PSI, pro 96.72
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 96.69
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 96.68
1lss_A140 TRK system potassium uptake protein TRKA homolog; 96.68
2zcu_A286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 96.66
2dtx_A264 Glucose 1-dehydrogenase related protein; rossmann 96.66
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 96.65
1xq1_A266 Putative tropinone reducatse; structural genomics, 96.64
3hem_A302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 96.63
2qhx_A328 Pteridine reductase 1; oxidoreductase, short-chain 96.63
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 96.62
1oaa_A259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 96.62
2nwq_A272 Probable short-chain dehydrogenase; oxidoreductase 96.62
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 96.61
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 96.61
1h5q_A265 NADP-dependent mannitol dehydrogenase; oxidoreduct 96.61
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 96.6
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 96.6
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 96.59
4e3z_A272 Putative oxidoreductase protein; PSI-biology, stru 96.59
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 96.59
1edo_A244 Beta-keto acyl carrier protein reductase; nucleoti 96.59
3rku_A287 Oxidoreductase YMR226C; substrate fingerprint, sho 96.58
3nrc_A280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 96.57
3zu3_A405 Putative reductase YPO4104/Y4119/YP_4011; oxidored 96.57
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 96.56
2jl1_A287 Triphenylmethane reductase; oxidoreductase, biorem 96.56
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 96.55
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 96.55
2nm0_A253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 96.54
3uxy_A266 Short-chain dehydrogenase/reductase SDR; structura 96.54
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 96.54
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 96.53
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 96.52
3cbg_A232 O-methyltransferase; cyanobacterium; HET: SAH FER 96.52
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 96.51
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 96.51
3c1o_A321 Eugenol synthase; phenylpropene, PIP reductase, sh 96.5
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 96.48
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 96.48
3kzv_A254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 96.47
3ezl_A256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 96.47
3un1_A260 Probable oxidoreductase; structural genomics, PSI- 96.42
3ctm_A279 Carbonyl reductase; alcohol dehydrogenase, short-c 96.41
4e4y_A244 Short chain dehydrogenase family protein; structur 96.4
2r6j_A318 Eugenol synthase 1; phenylpropene, PIP reductase, 96.39
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 96.38
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 96.38
2nyu_A196 Putative ribosomal RNA methyltransferase 2; SAM, s 96.38
1y1p_A342 ARII, aldehyde reductase II; rossmann fold, short 96.38
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 96.37
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 96.37
1leh_A364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 96.36
1qyd_A313 Pinoresinol-lariciresinol reductase; NADPH-depende 96.35
3i4f_A264 3-oxoacyl-[acyl-carrier protein] reductase; struct 96.34
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 96.34
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 96.33
3gk3_A269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 96.33
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 96.32
2gn4_A344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 96.31
3oml_A613 GH14720P, peroxisomal multifunctional enzyme type 96.3
3tfw_A248 Putative O-methyltransferase; PSI-biology, nysgrc, 96.3
2avd_A229 Catechol-O-methyltransferase; structural genomics, 96.3
3e9n_A245 Putative short-chain dehydrogenase/reductase; stru 96.29
2et6_A604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 96.29
4eue_A418 Putative reductase CA_C0462; TER, biofuel, synthet 96.27
1i9g_A280 Hypothetical protein RV2118C; mtase, adoMet, cryst 96.23
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 96.22
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 96.21
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 96.18
1xgk_A352 Nitrogen metabolite repression regulator NMRA; ros 96.17
2z1m_A345 GDP-D-mannose dehydratase; short-chain dehydrogena 96.17
2wm3_A299 NMRA-like family domain containing protein 1; unkn 96.15
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural g 96.14
1kpg_A287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 96.14
1d7o_A297 Enoyl-[acyl-carrier protein] reductase (NADH) PRE; 96.12
3tr6_A225 O-methyltransferase; cellular processes; HET: SAH; 96.08
3c3y_A237 Pfomt, O-methyltransferase; plant secondary metabo 96.08
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 96.07
3gdg_A267 Probable NADP-dependent mannitol dehydrogenase; ro 96.06
3enk_A341 UDP-glucose 4-epimerase; seattle structural genomi 96.06
1sui_A247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 96.04
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 96.04
2pk3_A321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 96.02
3l9w_A413 Glutathione-regulated potassium-efflux system Pro 96.01
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 96.01
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 95.98
1uay_A242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 95.98
3nzo_A399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 95.95
3d64_A494 Adenosylhomocysteinase; structural genomics, ssgci 95.95
4ggo_A401 Trans-2-enoyl-COA reductase; rossmann fold, oxidor 95.93
3orh_A236 Guanidinoacetate N-methyltransferase; structura ge 95.93
1rpn_A335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 95.93
3duw_A223 OMT, O-methyltransferase, putative; alternating of 95.92
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 95.92
3sxp_A362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 95.92
3slg_A372 PBGP3 protein; structural genomics, seattle struct 95.92
1yb2_A275 Hypothetical protein TA0852; structural genomics, 95.91
1dl5_A317 Protein-L-isoaspartate O-methyltransferase; isoasp 95.87
4iiu_A267 3-oxoacyl-[acyl-carrier protein] reductase; struct 95.86
1rkx_A357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 95.86
3u0b_A454 Oxidoreductase, short chain dehydrogenase/reducta 95.83
1v8b_A479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 95.83
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 95.82
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 95.8
3lt0_A329 Enoyl-ACP reductase; triclosan, triclosan variant, 95.8
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 95.78
1ek6_A348 UDP-galactose 4-epimerase; short-chain dehydrogena 95.66
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 95.63
3icc_A255 Putative 3-oxoacyl-(acyl carrier protein) reducta; 95.62
2c29_D337 Dihydroflavonol 4-reductase; flavonoids, short deh 95.62
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 95.61
1id1_A153 Putative potassium channel protein; RCK domain, E. 95.6
3ius_A286 Uncharacterized conserved protein; APC63810, silic 95.6
2z5l_A511 Tylkr1, tylactone synthase starter module and modu 95.59
2et6_A604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 95.58
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 95.57
2ekl_A313 D-3-phosphoglycerate dehydrogenase; structural gen 95.56
1jtv_A327 17 beta-hydroxysteroid dehydrogenase type 1; stero 95.56
3vc1_A312 Geranyl diphosphate 2-C-methyltransferase; rossman 95.55
2q1w_A333 Putative nucleotide sugar epimerase/ dehydratase; 95.54
1nkv_A256 Hypothetical protein YJHP; structural genomics, PS 95.53
1gy8_A397 UDP-galactose 4-epimerase; oxidoreductase; HET: NA 95.52
1u7z_A226 Coenzyme A biosynthesis bifunctional protein coabc 95.47
2g76_A335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 95.47
2b25_A336 Hypothetical protein; structural genomics, methyl 95.47
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA 95.46
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 95.44
1orr_A347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 95.42
2o2s_A315 Enoyl-acyl carrier reductase; enoyl reductase, tri 95.41
1db3_A372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 95.41
3abi_A365 Putative uncharacterized protein PH1688; L-lysine 95.38
1sb8_A352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 95.37
2p4h_X322 Vestitone reductase; NADPH-dependent reductase, is 95.36
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research 95.34
2hun_A336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 95.34
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 95.33
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 95.3
2gb4_A252 Thiopurine S-methyltransferase; 18204406, thiopuri 95.29
2ydy_A315 Methionine adenosyltransferase 2 subunit beta; oxi 95.29
3c3p_A210 Methyltransferase; NP_951602.1, structural genomic 95.26
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 95.25
2bll_A345 Protein YFBG; decarboxylase, short chain dehydroge 95.25
2fr1_A486 Erythromycin synthase, eryai; short chain dehydrog 95.24
2c5a_A379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 95.24
4dmg_A393 Putative uncharacterized protein TTHA1493; rRNA, m 95.23
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal R 95.23
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 95.21
2axq_A467 Saccharopine dehydrogenase; rossmann fold variant, 95.21
3k5p_A416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, 95.2
3f4k_A257 Putative methyltransferase; structural genomics, P 95.18
3r3h_A242 O-methyltransferase, SAM-dependent; structural gen 95.17
4e2x_A416 TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s 95.14
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural gen 95.13
3mje_A496 AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1. 95.12
1p9l_A245 Dihydrodipicolinate reductase; oxidoreductase, lys 95.11
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 95.07
3ntv_A232 MW1564 protein; rossmann fold, putative methyltran 95.06
1pjz_A203 Thiopurine S-methyltransferase; polymorphism, S-ad 95.04
2ptg_A319 Enoyl-acyl carrier reductase; apicomplexa, enoyl ( 95.02
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 95.0
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NA 94.97
3vps_A321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 94.97
2g5c_A281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 94.96
3a27_A272 TYW2, uncharacterized protein MJ1557; wybutosine m 94.95
2j6i_A364 Formate dehydrogenase; oxidoreductase, D-specific- 94.95
3sc6_A287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 94.95
4dqv_A478 Probable peptide synthetase NRP (peptide synthase; 94.9
2ggs_A273 273AA long hypothetical DTDP-4-dehydrorhamnose red 94.9
3u81_A221 Catechol O-methyltransferase; neurotransmitter deg 94.84
2gk4_A232 Conserved hypothetical protein; alpha-beta-alpha s 94.82
2yy7_A312 L-threonine dehydrogenase; thermolabIle, flavobact 94.81
1oc2_A348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 94.81
2z2v_A365 Hypothetical protein PH1688; L-lysine dehydrogenas 94.81
3m33_A226 Uncharacterized protein; structural genomics, PSI- 94.8
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 94.78
3jtm_A351 Formate dehydrogenase, mitochondrial; mitochondrio 94.78
3qp9_A525 Type I polyketide synthase pikaii; rossmann fold, 94.78
2ko1_A88 CTR148A, GTP pyrophosphokinase; homodimer, alpha+b 94.77
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 94.76
3sm3_A235 SAM-dependent methyltransferases; NESG, structural 94.72
3lpm_A259 Putative methyltransferase; structural genomics, p 94.72
3g89_A249 Ribosomal RNA small subunit methyltransferase G; 1 94.71
1ff9_A450 Saccharopine reductase; lysine biosynthesis, alpha 94.71
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 94.71
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; H 94.69
1vl0_A292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 94.68
3m4x_A456 NOL1/NOP2/SUN family protein; mtase domain, PUA do 94.64
3gg9_A352 D-3-phosphoglycerate dehydrogenase oxidoreductase; 94.62
2q1s_A377 Putative nucleotide sugar epimerase/ dehydratase; 94.62
2ipx_A233 RRNA 2'-O-methyltransferase fibrillarin; FBL, stru 94.6
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 94.59
3id6_C232 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 94.59
1gdh_A320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D) 94.59
4e5n_A330 Thermostable phosphite dehydrogenase; D-2-hydroxya 94.58
1n7h_A381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 94.58
2w2k_A348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 94.53
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 94.52
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 94.52
1iy9_A275 Spermidine synthase; rossmann fold, structural gen 94.51
3bkw_A243 MLL3908 protein, S-adenosylmethionine dependent me 94.49
1mjf_A281 Spermidine synthase; spermidine synthetase, struct 94.48
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 94.47
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 94.47
>1phz_A Protein (phenylalanine hydroxylase); aromatic amino acid hydroxylase, phosphorylation, intrasteric regulation, allosteric regulation; 2.20A {Rattus norvegicus} SCOP: d.58.18.3 d.178.1.1 PDB: 2phm_A Back     alignment and structure
Probab=100.00  E-value=4.9e-102  Score=834.25  Aligned_cols=358  Identities=53%  Similarity=0.827  Sum_probs=319.8

Q ss_pred             CCeEEEEEEccCCCcchHHHHHHHHHhCCcceeeeecccCCCCCcceEEEEEecC--CchHHHHHHHHHcc-CCcEEEec
Q psy14589        259 SLFDFVIFSNHQDEVGALAKTLKLFKKHNVNLLHIESRSSTRIENNYEFMVECAP--GGDLSSVIESLRSS-CSYINIIS  335 (655)
Q Consensus       259 ~~ktsl~f~l~~d~~gaL~~iL~~f~~~~Inlt~IeSRP~~~~~~~Y~FfVd~eg--~~~v~~~l~~L~~~-~~~v~iLG  335 (655)
                      .+|||++|+++| +||+|+++|+.|+.+|||||+|||||++...|+|.|||||+.  ++.+++++++|++. +..+++||
T Consensus        32 ~dKTSLiFsl~n-~pGAL~~~L~~Fa~~gINLTkIESRPsk~~~~eY~FfVD~eh~~d~~v~~AL~eL~~~~~~~vkiLG  110 (429)
T 1phz_A           32 NGAISLIFSLKE-EVGALAKVLRLFEENDINLTHIESRPSRLNKDEYEFFTYLDKRTKPVLGSIIKSLRNDIGATVHELS  110 (429)
T ss_dssp             SCCEEEEEEEEC-CTTHHHHHHHHHHTTTCCTTSEEEEECSSCTTEEEEEECBCGGGHHHHHHHHHHHHHTTCCCEEEEE
T ss_pred             CCeEEEEEEeCC-CccHHHHHHHHHHHcCCceEEEEeeecCCCCccEEEEEEEeeCCCHHHHHHHHHHHhhccceEEECC
Confidence            459999999998 899999999999999999999999999999999999999996  56799999999999 99999999


Q ss_pred             CCCCCCCCCcCcccccchhhhhhhhhhhcCCCCCCCCCCCCCHHHHHHHHHHHHHHhccCCCCC----------------
Q psy14589        336 RNHNQFHGVPWFPRRIRELDRFANQILSYGSELDADHPGFTDPVYRARRKYFADLAFNYKHSIL----------------  399 (655)
Q Consensus       336 s~~~~~~~vpWfPr~~~dLD~~~~~~l~~~~~l~~dhpgf~D~~y~~rR~~ia~ia~~~k~g~~----------------  399 (655)
                      ++ +..+++|||||+|+|||+|+|++|+||++|++|||||+|++||+||+|||+||.+||+|++                
T Consensus       111 s~-~~~~~vPWFPR~IsDLDkc~~~vl~yg~~l~~dhpGf~D~~Yr~RR~~ia~ia~~~~~g~~~~~v~Yt~~e~~~W~~  189 (429)
T 1phz_A          111 RD-KEKNTVPWFPRTIQELDRFANQILSYGAELDADHPGFKDPVYRARRKQFADIAYNYRHGQPIPRVEYTEEEKQTWGT  189 (429)
T ss_dssp             TT-CCTTCEECCCSBGGGGGTTTTCCC------CTTSTTTTCHHHHHHHHHHHHHHHTCCTTSCCCCCCCCHHHHHHHHH
T ss_pred             Cc-CccccCCCCCccccchhhhhhhheeccccccccCCCCCCHHHHHHHHHHHHHHHhCcCCCCCCcccCCHHHHHHHHH
Confidence            95 3457799999999999999999999999999999999999999999999999999999998                


Q ss_pred             ------------cchhHHhhhhHHHHhcCCCCCCCCChHHHHHhhhhccCceEEecCCCCChHHHHHhhhcCccceeeec
Q psy14589        400 ------------LMPEHNHVFPLLIQNCGYAEDNIPQLEDISKFLKDSTGFSLRPVAGLLSSRDFLAGLAFRVFHSTQYI  467 (655)
Q Consensus       400 ------------Ac~ey~~g~~~l~~~~g~~~~~Ip~~~~~~~~l~~~tg~~~~~v~g~~~~~~f~~~la~r~f~~t~~i  467 (655)
                                  ||++|++|+++|+++||+++|+||||+|||++|+++|||+++||+||||+++||++||+|+|||||||
T Consensus       190 l~~~~~~l~~~~Ac~eyl~gl~~L~~~~g~~~d~IPql~~vs~~L~~~TGw~~~pV~gli~~~~F~~~LA~r~F~~t~~i  269 (429)
T 1phz_A          190 VFRTLKALYKTHACYEHNHIFPLLEKYCGFREDNIPQLEDVSQFLQTCTGFRLRPVAGLLSSRDFLGGLAFRVFHCTQYI  269 (429)
T ss_dssp             HHHHHHHHHHHHBCHHHHHHHHHHHHHSCCBTTBCCCHHHHHHHHHHHHSCEEEECSSCCCHHHHHHHHTTTEEEECCCC
T ss_pred             HHHHHHHHhhhhHHHHHHHHHHHHHHhcCCCccCCCCHHHHHHHHHhccCCEEEeccccCCHHHHHHHHhccccceeeee
Confidence                        99999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCCCCCCCCCchhhhhhcCCCCccCChhHHHHHHHHhhhcCCCChHHHHHHHhhhhhhhhhhhccCCCCCCCCeEee-c
Q psy14589        468 RHPSKPLYTPEPDVCHELLGHVPLFADPSFAQFSQEIGLASLGAPDEYVERLATSNNFMIVPRLASLSPDSTGFSLRP-V  546 (655)
Q Consensus       468 r~~~~~~y~~epd~~He~~gh~p~l~~~~~a~~~~~~Gl~~l~~~~~~i~~l~~l~w~tve~gl~~~~~~~tg~~~~~-g  546 (655)
                      ||+++|+||||||||||++||+|||+||+||+|+|++|++++|+++++|.+|+||||||||||||+++     +++|+ |
T Consensus       270 R~~~~~~YtpEPDi~He~~GH~PlL~~p~fA~f~q~~G~~~l~a~~~~i~~LarlyWfTVEFGLi~~~-----~~lk~YG  344 (429)
T 1phz_A          270 RHGSKPMYTPEPDICHELLGHVPLFSDRSFAQFSQEIGLASLGAPDEYIEKLATIYWFTVEFGLCKEG-----DSIKAYG  344 (429)
T ss_dssp             CCTTCTTCCSSCCHHHHHHHTHHHHTSHHHHHHHHHHHHHHTTCCHHHHHHHHHHHHTTTTTCEEEET-----TEEEECC
T ss_pred             cCccccccCCCcchhHHHhcccccccCHHHHHHHHHHHHHhcCCCHHHHHHHhhhheeeeeeceeccC-----Cceeeec
Confidence            99999999999999999999999999999999999999999999999999999999999999999999     99999 9


Q ss_pred             ccccCCHHHHHhhhc-----ccccccccccCCCCCCCCCCcchhhhhcCCcccccCchHHHHHHHHh--hcccCCceEEE
Q psy14589        547 AGLLSSRDFLAGLAF-----RVFHSTQYIRHPSKPLYTPEPDVCHELLGHVPLFADPSFAQFSQEIG--LASLGAPYLFY  619 (655)
Q Consensus       547 ~Gllss~~~~~~l~~-----~~f~~~~~ir~~~~~~y~~~pd~~hd~~ghvp~l~~p~f~~~~~~~g--~~~~~a~~~~~  619 (655)
                      ||||||.+|++|...     +.|-...-+|+++.++-.+.           -++.-++|.+..+.+.  ...++.||.+.
T Consensus       345 AGlLSS~gE~~~~ls~~p~~~pfd~~~~~~~~y~i~~~Qp-----------~yFv~~sf~~l~~~~~~f~~~~~~pf~~~  413 (429)
T 1phz_A          345 AGLLSSFGELQYCLSDKPKLLPLELEKTACQEYSVTEFQP-----------LYYVAESFSDAKEKVRTFAATIPRPFSVR  413 (429)
T ss_dssp             HHHHTCHHHHHHHTSSSSEEEECCHHHHTTCCCCSSSSCS-----------EEEEESCHHHHHHHHHHHHTTSCCSSEEE
T ss_pred             cccccChhHHHHhcCCCCeeccCCHHHHcCCCCCCCCccc-----------ceEEeCCHHHHHHHHHHHHHhCCCCccee
Confidence            999999999999953     35544445555555433331           1333444444444433  24579999999


Q ss_pred             eecccccCccccccCch
Q psy14589        620 YVCHELLGHVPLFADPS  636 (655)
Q Consensus       620 ~~~~~~~~~~~~~~~~~  636 (655)
                      |  +++|++|-|+|++.
T Consensus       414 y--~~~t~~~~~~~~~~  428 (429)
T 1phz_A          414 Y--DPYTQRVEVLDNTQ  428 (429)
T ss_dssp             E--ETTTTEEEEECCC-
T ss_pred             e--CCCccEEEecCCCC
Confidence            9  99999999999874



>1j8u_A Phenylalanine-4-hydroxylase; ferrous iron, 2-His-1-carboxylate facial triad, tetrahydrobiopterin, oxidoreductase; HET: H4B; 1.50A {Homo sapiens} SCOP: d.178.1.1 PDB: 1j8t_A* 1kw0_A* 1lrm_A* 1mmk_A* 1mmt_A* 4anp_A* 2pah_A 1pah_A 3pah_A* 4pah_A* 5pah_A* 6pah_A* 1tdw_A 1tg2_A* 1dmw_A* Back     alignment and structure
>1toh_A Tyroh, tyrosine hydroxylase; neurotransmitter biosynthesis, non-heme iron, P substrate; 2.30A {Rattus norvegicus} SCOP: d.178.1.1 PDB: 2toh_A* 2xsn_A Back     alignment and structure
>1mlw_A Tryptophan 5-monooxygenase; aromatic amino acid hydroxylase catalytic domain fold, oxidoreductase; HET: HBI; 1.71A {Homo sapiens} SCOP: d.178.1.1 PDB: 3hf6_A* 3hf8_A* 3hfb_A* 3e2t_A* Back     alignment and structure
>2v27_A Phenylalanine hydroxylase; cold adaptation, tetrahydrobiopterin, stability, flexibility, alkaptonuria, oxidoreductase; 1.50A {Colwellia psychrerythraea 34H} PDB: 2v28_A Back     alignment and structure
>3tk2_A Phenylalanine-4-hydroxylase; protein-substate complex, mixed alpha, beta, tetrahydrobiopterin, iron (II), molecular OX hydroxylation; HET: PHE; 1.35A {Chromobacterium violaceum} PDB: 3tk4_A 3tcy_A* 1ltz_A* 1ltv_A 1ltu_A* Back     alignment and structure
>2v27_A Phenylalanine hydroxylase; cold adaptation, tetrahydrobiopterin, stability, flexibility, alkaptonuria, oxidoreductase; 1.50A {Colwellia psychrerythraea 34H} PDB: 2v28_A Back     alignment and structure
>1mlw_A Tryptophan 5-monooxygenase; aromatic amino acid hydroxylase catalytic domain fold, oxidoreductase; HET: HBI; 1.71A {Homo sapiens} SCOP: d.178.1.1 PDB: 3hf6_A* 3hf8_A* 3hfb_A* 3e2t_A* Back     alignment and structure
>1j8u_A Phenylalanine-4-hydroxylase; ferrous iron, 2-His-1-carboxylate facial triad, tetrahydrobiopterin, oxidoreductase; HET: H4B; 1.50A {Homo sapiens} SCOP: d.178.1.1 PDB: 1j8t_A* 1kw0_A* 1lrm_A* 1mmk_A* 1mmt_A* 4anp_A* 2pah_A 1pah_A 3pah_A* 4pah_A* 5pah_A* 6pah_A* 1tdw_A 1tg2_A* 1dmw_A* Back     alignment and structure
>1toh_A Tyroh, tyrosine hydroxylase; neurotransmitter biosynthesis, non-heme iron, P substrate; 2.30A {Rattus norvegicus} SCOP: d.178.1.1 PDB: 2toh_A* 2xsn_A Back     alignment and structure
>3tk2_A Phenylalanine-4-hydroxylase; protein-substate complex, mixed alpha, beta, tetrahydrobiopterin, iron (II), molecular OX hydroxylation; HET: PHE; 1.35A {Chromobacterium violaceum} PDB: 3tk4_A 3tcy_A* 1ltz_A* 1ltv_A 1ltu_A* Back     alignment and structure
>1phz_A Protein (phenylalanine hydroxylase); aromatic amino acid hydroxylase, phosphorylation, intrasteric regulation, allosteric regulation; 2.20A {Rattus norvegicus} SCOP: d.58.18.3 d.178.1.1 PDB: 2phm_A Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Back     alignment and structure
>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Back     alignment and structure
>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>3mwb_A Prephenate dehydratase; L-Phe, PSI, MCSG, structural genomics, midwest center for ST genomics, protein structure initiative, lyase; HET: MSE PHE; 2.00A {Arthrobacter aurescens} Back     alignment and structure
>4eez_A Alcohol dehydrogenase 1; site-saturation mutagenesis, directed evolution, isobutyraldehyde, biofuel, oxidoreductase; HET: PG4; 1.90A {Lactococcus lactis subsp} PDB: 4eex_A* Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Back     alignment and structure
>2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Back     alignment and structure
>3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Back     alignment and structure
>2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* Back     alignment and structure
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Back     alignment and structure
>2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* Back     alignment and structure
>4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Back     alignment and structure
>1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A Back     alignment and structure
>2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* Back     alignment and structure
>4a27_A Synaptic vesicle membrane protein VAT-1 homolog-L; oxidoreductase; 2.10A {Homo sapiens} Back     alignment and structure
>2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Back     alignment and structure
>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Back     alignment and structure
>3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Back     alignment and structure
>1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* Back     alignment and structure
>1xa0_A Putative NADPH dependent oxidoreductases; structural genomics, protein structure initiative, MCSG; HET: DTY; 2.80A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3nx4_A Putative oxidoreductase; csgid, structural genomics, center for struc genomics of infectious diseases, PSI, protein structure INI; HET: MSE NAP; 1.90A {Salmonella enterica subsp} PDB: 1o89_A 1o8c_A* Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Back     alignment and structure
>3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} Back     alignment and structure
>3luy_A Probable chorismate mutase; structural genomics, APC38059, 3-phenylp PSI-2, protein structure initiative; HET: PPY; 2.00A {Bifidobacterium adolescentis} Back     alignment and structure
>2qmx_A Prephenate dehydratase; APC86053, L-Phe inhibition, PDT, CHL tepidum TLS, structural genomics, PSI-2, protein structure initiative; HET: PHE; 2.30A {Chlorobium tepidum tls} Back     alignment and structure
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Back     alignment and structure
>1tt7_A YHFP; alcohol dehydrogenase, Zn-dependent, NAD, structural genomics, protein structure initiative, PSI; 2.70A {Bacillus subtilis} SCOP: b.35.1.2 c.2.1.1 PDB: 1y9e_A* Back     alignment and structure
>3iup_A Putative NADPH:quinone oxidoreductase; YP_296108.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE NDP; 1.70A {Ralstonia eutropha} Back     alignment and structure
>2qmw_A PDT, prephenate dehydratase; APC85812, prephenate dehydratase (PDT), staphylococcus aureu aureus MU50, structural genomics, PSI-2; 2.30A {Staphylococcus aureus subsp} SCOP: c.94.1.1 d.58.18.3 Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} Back     alignment and structure
>3s8m_A Enoyl-ACP reductase; rossmann fold, oxidoreductase, NADH binding, fatty acid SYNT enoyl-ACP; 1.60A {Xanthomonas oryzae PV} Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure
>4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>3zu3_A Putative reductase YPO4104/Y4119/YP_4011; oxidoreductase, fatty acid biosynthesis II, short-chain dehydrogenase reductase superfamily; HET: NAI; 1.80A {Yersinia pestis} PDB: 3zu4_A* 3zu5_A* 3zu2_A* Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>4eue_A Putative reductase CA_C0462; TER, biofuel, synthetic biology, catalytic mechan substrate specificity, oxidoreductase; HET: NAI; 2.00A {Clostridium acetobutylicum} PDB: 4euf_A* 4euh_A* Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>1d7o_A Enoyl-[acyl-carrier protein] reductase (NADH) PRE; triclosan, enoyl reductase, oxidoreductase; HET: NAD TCL; 1.90A {Brassica napus} SCOP: c.2.1.2 PDB: 1eno_A* 1enp_A* 1cwu_A* Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Back     alignment and structure
>4ggo_A Trans-2-enoyl-COA reductase; rossmann fold, oxidoreductase; 2.00A {Treponema denticola atcc 35405} PDB: 4ggp_A Back     alignment and structure
>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3v1t_C 3v1u_A* 4fw8_A* 3q6i_A* 3m1l_A Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>3lt0_A Enoyl-ACP reductase; triclosan, triclosan variant, oxidoredu P.falciparum; HET: NAD FT1; 1.96A {Plasmodium falciparum} SCOP: c.2.1.2 PDB: 1v35_A* 3lsy_A* 1uh5_A* 3lt1_A* 3lt2_A* 3lt4_A* 3am4_A* 3am3_A* 3am5_A* 2o2y_A* 2oos_A* 2ol4_A* 2op0_A* 2op1_A* 1vrw_A* 1zsn_A* 1zw1_A* 1zxb_A* 1zxl_A* 2foi_A* ... Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Back     alignment and structure
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>2z5l_A Tylkr1, tylactone synthase starter module and modules 1 & 2; short-chain dehydrogenase/reductase, rossman fold; 1.95A {Streptomyces fradiae} Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Back     alignment and structure
>1u7z_A Coenzyme A biosynthesis bifunctional protein coabc; ligase; HET: PMT; 2.30A {Escherichia coli} SCOP: c.72.3.1 PDB: 1u7w_A* 1u7u_A* 1u80_A* Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>2o2s_A Enoyl-acyl carrier reductase; enoyl reductase, triclosan, rossmann fold, oxidoreductase; HET: NAD TCL; 2.60A {Toxoplasma gondii} PDB: 2o50_A 3nj8_A* Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A* Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} Back     alignment and structure
>4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure
>3mje_A AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1.36A {Streptomyces nodosus} PDB: 3mjc_A* 3mjs_A* 3mjv_A* 3mjt_A* Back     alignment and structure
>1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} Back     alignment and structure
>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 Back     alignment and structure
>2ptg_A Enoyl-acyl carrier reductase; apicomplexa, enoyl (acyl-carrier-P reductase, oxidoreductase; 2.60A {Eimeria tenella} Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} Back     alignment and structure
>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... Back     alignment and structure
>2gk4_A Conserved hypothetical protein; alpha-beta-alpha sandwich, flavoprotein, structural genomics protein structure initiative; 1.83A {Streptococcus pneumoniae} Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>3qp9_A Type I polyketide synthase pikaii; rossmann fold, ketoreductase, epimerization, oxidoreductase; 1.88A {Streptomyces venezuelae} Back     alignment and structure
>2ko1_A CTR148A, GTP pyrophosphokinase; homodimer, alpha+beta, transferase, structural genomics, PSI-2, protein structure initiative; NMR {Chlorobaculum tepidum} PDB: 3ibw_A Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Back     alignment and structure
>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Back     alignment and structure
>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 655
d1j8ua_307 d.178.1.1 (A:) Phenylalanine hydroxylase, PAH {Hum 1e-80
d1j8ua_307 d.178.1.1 (A:) Phenylalanine hydroxylase, PAH {Hum 8e-46
d1j8ua_307 d.178.1.1 (A:) Phenylalanine hydroxylase, PAH {Hum 4e-31
d1j8ua_307 d.178.1.1 (A:) Phenylalanine hydroxylase, PAH {Hum 5e-21
d1toha_336 d.178.1.1 (A:) Tyrosine hydroxylase {Rat (Rattus n 4e-78
d1toha_336 d.178.1.1 (A:) Tyrosine hydroxylase {Rat (Rattus n 3e-44
d1toha_336 d.178.1.1 (A:) Tyrosine hydroxylase {Rat (Rattus n 2e-29
d1toha_336 d.178.1.1 (A:) Tyrosine hydroxylase {Rat (Rattus n 3e-21
d1mlwa_290 d.178.1.1 (A:) Tryptophan hydroxylase {Human (Homo 1e-76
d1mlwa_290 d.178.1.1 (A:) Tryptophan hydroxylase {Human (Homo 5e-43
d1mlwa_290 d.178.1.1 (A:) Tryptophan hydroxylase {Human (Homo 5e-28
d1mlwa_290 d.178.1.1 (A:) Tryptophan hydroxylase {Human (Homo 3e-21
d1ltza_277 d.178.1.1 (A:) Phenylalanine hydroxylase, PAH {Chr 4e-38
d1ltza_277 d.178.1.1 (A:) Phenylalanine hydroxylase, PAH {Chr 9e-38
d1ltza_277 d.178.1.1 (A:) Phenylalanine hydroxylase, PAH {Chr 1e-28
d1phza197 d.58.18.3 (A:19-115) Phenylalanine hydroxylase N-t 2e-14
d2qmwa280 d.58.18.3 (A:185-264) Prephenate dehydratase C-ter 4e-11
d1y7pa277 d.58.18.12 (A:2-78) Hypothetical protein AF1403, N 5e-06
d1mtyb_384 a.25.1.2 (B:) Methane monooxygenase hydrolase beta 0.004
>d1j8ua_ d.178.1.1 (A:) Phenylalanine hydroxylase, PAH {Human (Homo sapiens) [TaxId: 9606]} Length = 307 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains
superfamily: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains
family: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains
domain: Phenylalanine hydroxylase, PAH
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  255 bits (654), Expect = 1e-80
 Identities = 143/206 (69%), Positives = 160/206 (77%), Gaps = 28/206 (13%)

Query: 344 VPWFPRRIRELDRFANQILSYGSELDADHPGFTDPVYRARRKYFADLAFNYKH------- 396
           VPWFPR I+ELDRFANQILSYG+ELDADHPGF DPVYRARRK FAD+A+NY+H       
Sbjct: 1   VPWFPRTIQELDRFANQILSYGAELDADHPGFKDPVYRARRKQFADIAYNYRHGQPIPRV 60

Query: 397 ----------------SILLMP-----EHNHVFPLLIQNCGYAEDNIPQLEDISKFLKDS 435
                              L       E+NH+FPLL + CG+ EDNIPQLED+S+FL+  
Sbjct: 61  EYMEEEKKTWGTVFKTLKSLYKTHACYEYNHIFPLLEKYCGFHEDNIPQLEDVSQFLQTC 120

Query: 436 TGFSLRPVAGLLSSRDFLAGLAFRVFHSTQYIRHPSKPLYTPEPDVCHELLGHVPLFADP 495
           TGF LRPVAGLLSSRDFL GLAFRVFH TQYIRH SKP+YTPEPD+CHELLGHVPLF+D 
Sbjct: 121 TGFRLRPVAGLLSSRDFLGGLAFRVFHCTQYIRHGSKPMYTPEPDICHELLGHVPLFSDR 180

Query: 496 SFAQFSQEIGLASLGAPDEYVERLAT 521
           SFAQFSQEIGLASLGAPDEY+E+LAT
Sbjct: 181 SFAQFSQEIGLASLGAPDEYIEKLAT 206


>d1j8ua_ d.178.1.1 (A:) Phenylalanine hydroxylase, PAH {Human (Homo sapiens) [TaxId: 9606]} Length = 307 Back     information, alignment and structure
>d1j8ua_ d.178.1.1 (A:) Phenylalanine hydroxylase, PAH {Human (Homo sapiens) [TaxId: 9606]} Length = 307 Back     information, alignment and structure
>d1j8ua_ d.178.1.1 (A:) Phenylalanine hydroxylase, PAH {Human (Homo sapiens) [TaxId: 9606]} Length = 307 Back     information, alignment and structure
>d1toha_ d.178.1.1 (A:) Tyrosine hydroxylase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 336 Back     information, alignment and structure
>d1toha_ d.178.1.1 (A:) Tyrosine hydroxylase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 336 Back     information, alignment and structure
>d1toha_ d.178.1.1 (A:) Tyrosine hydroxylase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 336 Back     information, alignment and structure
>d1toha_ d.178.1.1 (A:) Tyrosine hydroxylase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 336 Back     information, alignment and structure
>d1mlwa_ d.178.1.1 (A:) Tryptophan hydroxylase {Human (Homo sapiens) [TaxId: 9606]} Length = 290 Back     information, alignment and structure
>d1mlwa_ d.178.1.1 (A:) Tryptophan hydroxylase {Human (Homo sapiens) [TaxId: 9606]} Length = 290 Back     information, alignment and structure
>d1mlwa_ d.178.1.1 (A:) Tryptophan hydroxylase {Human (Homo sapiens) [TaxId: 9606]} Length = 290 Back     information, alignment and structure
>d1mlwa_ d.178.1.1 (A:) Tryptophan hydroxylase {Human (Homo sapiens) [TaxId: 9606]} Length = 290 Back     information, alignment and structure
>d1ltza_ d.178.1.1 (A:) Phenylalanine hydroxylase, PAH {Chromobacterium violaceum [TaxId: 536]} Length = 277 Back     information, alignment and structure
>d1ltza_ d.178.1.1 (A:) Phenylalanine hydroxylase, PAH {Chromobacterium violaceum [TaxId: 536]} Length = 277 Back     information, alignment and structure
>d1ltza_ d.178.1.1 (A:) Phenylalanine hydroxylase, PAH {Chromobacterium violaceum [TaxId: 536]} Length = 277 Back     information, alignment and structure
>d1phza1 d.58.18.3 (A:19-115) Phenylalanine hydroxylase N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 97 Back     information, alignment and structure
>d2qmwa2 d.58.18.3 (A:185-264) Prephenate dehydratase C-terminal domain {Staphylococcus aureus [TaxId: 1280]} Length = 80 Back     information, alignment and structure
>d1y7pa2 d.58.18.12 (A:2-78) Hypothetical protein AF1403, N-terminal domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 77 Back     information, alignment and structure
>d1mtyb_ a.25.1.2 (B:) Methane monooxygenase hydrolase beta subunit {Methylococcus capsulatus [TaxId: 414]} Length = 384 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query655
d1toha_336 Tyrosine hydroxylase {Rat (Rattus norvegicus) [Tax 100.0
d1j8ua_307 Phenylalanine hydroxylase, PAH {Human (Homo sapien 100.0
d1mlwa_290 Tryptophan hydroxylase {Human (Homo sapiens) [TaxI 100.0
d1ltza_277 Phenylalanine hydroxylase, PAH {Chromobacterium vi 100.0
d1mlwa_290 Tryptophan hydroxylase {Human (Homo sapiens) [TaxI 99.95
d1ltza_277 Phenylalanine hydroxylase, PAH {Chromobacterium vi 99.95
d1toha_336 Tyrosine hydroxylase {Rat (Rattus norvegicus) [Tax 99.95
d1j8ua_307 Phenylalanine hydroxylase, PAH {Human (Homo sapien 99.94
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 99.91
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 99.91
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 99.9
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 99.89
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 99.87
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 99.87
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 99.87
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 99.87
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 99.86
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 99.86
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 99.85
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 99.85
d1gu7a2189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 99.85
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 99.84
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 99.84
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 99.84
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 99.83
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 99.83
d1o89a2177 Hypothetical protein YhdH {Escherichia coli [TaxId 99.83
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 99.83
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 99.83
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 99.82
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 99.81
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 99.8
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 99.79
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 99.78
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 99.78
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 99.77
d2qmwa280 Prephenate dehydratase C-terminal domain {Staphylo 99.7
d1phza197 Phenylalanine hydroxylase N-terminal domain {Rat ( 99.64
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 99.55
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 97.79
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 97.74
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 97.69
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 97.67
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 97.66
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 97.65
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 97.61
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 97.6
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 97.56
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 97.54
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 97.53
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 97.52
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 97.51
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 97.5
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 97.5
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 97.48
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 97.47
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 97.47
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 97.46
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 97.46
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 97.44
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 97.43
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 97.41
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 97.41
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 97.41
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 97.39
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 97.39
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 97.38
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 97.38
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 97.37
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 97.36
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 97.36
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 97.34
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 97.33
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 97.33
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 97.3
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 97.29
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 97.28
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 97.27
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 97.25
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 97.23
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 97.2
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 97.18
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 97.15
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 97.12
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 97.11
d1gz6a_302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 97.08
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 97.04
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 97.04
d1yo6a1250 Putative carbonyl reductase sniffer {Caenorhabditi 97.03
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 97.02
d1kpga_285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 96.98
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 96.93
d1jg1a_215 Protein-L-isoaspartyl O-methyltransferase {Archaeo 96.91
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 96.88
d1kpia_291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 96.81
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 96.8
d1zmta1252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 96.79
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 96.77
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 96.71
d2fk8a1280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 96.68
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 96.62
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 96.61
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 96.59
d2b25a1324 Hypothetical protein FLJ20628 {Human (Homo sapiens 96.59
d1dhra_236 Dihydropteridin reductase (pteridine reductase) {R 96.58
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 96.57
d2avna1246 Hypothetical methyltransferase TM1389 {Thermotoga 96.5
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 96.48
d1snya_248 Carbonyl reductase sniffer {Fruit fly (Drosophila 96.43
d1i1na_224 Protein-L-isoaspartyl O-methyltransferase {Human ( 96.4
d1nkva_245 Hypothetical Protein YjhP {Escherichia coli [TaxId 96.4
d1i9ga_264 Probable methyltransferase Rv2118c {Mycobacterium 96.37
d1vbfa_224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 96.37
d2fr1a1259 Erythromycin synthase, eryAI, 1st ketoreductase mo 96.36
d1r18a_223 Protein-L-isoaspartyl O-methyltransferase {Fruit f 96.34
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 96.29
d1edoa_244 beta-keto acyl carrier protein reductase {Oil seed 96.29
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 96.26
d1ooea_235 Dihydropteridin reductase (pteridine reductase) {N 96.24
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 96.22
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 96.21
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 96.04
d1oaaa_259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 96.03
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 96.03
d2o57a1282 Putative sarcosine dimethylglycine methyltransfera 96.0
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 95.98
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 95.96
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 95.96
d1mxha_266 Dihydropteridin reductase (pteridine reductase) {T 95.87
d1zx0a1229 Guanidinoacetate methyltransferase {Human (Homo sa 95.84
d1e3ja1178 Ketose reductase (sorbitol dehydrogenase) {Silverl 95.82
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 95.79
d1cdoa1199 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 95.66
d1y7pa277 Hypothetical protein AF1403, N-terminal domain {Ar 95.66
d1nt2a_209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 95.57
d1d7oa_297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 95.5
d1vl5a_231 Hypothetical protein BH2331 {Bacillus halodurans [ 95.49
d1g8sa_230 Fibrillarin homologue {Archaeon Methanococcus jann 95.48
d1xxla_234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 95.47
d1h2ba1171 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 95.44
d1f8fa1194 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 95.43
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 95.42
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 95.4
d1y1pa1342 Aldehyde reductase II {Sporobolomyces salmonicolor 95.38
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 95.29
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 95.28
d1kola1201 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 95.28
d1e7wa_284 Dihydropteridin reductase (pteridine reductase) {L 95.27
d1u2za_406 Catalytic, N-terminal domain of histone methyltran 95.17
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 95.15
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 95.09
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 95.06
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 95.04
d1uh5a_329 Enoyl-ACP reductase {Malaria parasite (Plasmodium 95.01
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 94.9
d1nw3a_328 Catalytic, N-terminal domain of histone methyltran 94.83
d2f1fa176 Acetolactate synthase small subunit, IlvH {Escheri 94.8
d1wxxa2318 Hypothetical protein TTHA1280, middle and C-termin 94.76
d2as0a2324 Hypothetical protein PH1915, middle and C-terminal 94.67
d1orra_338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 94.6
d2fgca278 Acetolactate synthase small subunit, IlvH {Thermot 94.46
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 94.31
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 94.3
d1jtva_285 Human estrogenic 17beta-hydroxysteroid dehydrogena 94.27
d1yb5a1150 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 94.22
d1p91a_268 rRNA methyltransferase RlmA {Escherichia coli [Tax 94.19
d2pc6a277 Acetolactate synthase small subunit, IlvH {Nitroso 94.15
d1xvaa_292 Glycine N-methyltransferase {Rat (Rattus norvegicu 94.1
d1uaya_241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 94.07
d1leha1230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 94.05
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 94.03
d1iz0a1131 Quinone oxidoreductase {Thermus thermophilus [TaxI 93.97
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 93.95
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 93.88
d2frna1260 Hypothetical protein PH0793 {Pyrococcus horikoshii 93.85
d1v9la1242 Glutamate dehydrogenase {Pyrobaculum islandicum [T 93.82
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 93.79
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 93.79
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 93.79
d1qora1147 Quinone oxidoreductase {Escherichia coli [TaxId: 5 93.74
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 93.7
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 93.67
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 93.57
d1gu7a1175 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 93.54
d1b26a1234 Glutamate dehydrogenase {Thermotoga maritima [TaxI 93.4
d1xgka_350 Negative transcriptional regulator NmrA {Aspergill 93.32
d1fjha_257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 93.19
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 93.16
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 92.98
d1ri5a_252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 92.64
d1sc6a384 Phosphoglycerate dehydrogenase, regulatory (C-term 92.62
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 92.61
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 92.6
d1susa1227 Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag 92.56
d1hwxa1293 Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 92.41
d1im8a_225 Hypothetical protein HI0319 (YecO) {Haemophilus in 92.21
d1rkxa_356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 92.19
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 92.07
d1r0ka2150 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Z 92.03
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 92.02
d1ws6a1171 Methyltransferase TTHA0928 {Thermus thermophilus [ 91.79
d1n7ha_339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 91.71
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 91.63
d1nvmb1157 Acetaldehyde dehydrogenase (acylating) {Pseudomona 91.57
d1bgva1255 Glutamate dehydrogenase {Clostridium symbiosum [Ta 91.42
d2czca2172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 91.3
d1udca_338 Uridine diphosphogalactose-4-epimerase (UDP-galact 91.3
d1i24a_393 Sulfolipid biosynthesis protein SQD1 {Thale cress 91.29
d2bhsa1292 O-acetylserine sulfhydrylase (Cysteine synthase) { 91.26
d1oria_316 Protein arginine N-methyltransferase 1, PRMT1 {Rat 91.12
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 91.07
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 91.07
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 91.07
d1llua1175 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 90.91
d1db3a_357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 90.89
d2a35a1212 Hypothetical protein PA4017 {Pseudomonas aeruginos 90.84
d2blla1342 Polymyxin resistance protein ArnA (PrmI) {Escheric 90.75
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 90.53
d1tw3a2253 Carminomycin 4-O-methyltransferase {Streptomyces p 90.41
d2b78a2317 Hypothetical protein SMu776, middle and C-terminal 90.38
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 90.36
d2avda1219 COMT domain-containing protein 1, COMTD1 {Human (H 90.19
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 90.18
d1id1a_153 Rck domain from putative potassium channel Kch {Es 90.08
d1xa0a1152 B. subtilis YhfP homologue {Bacillus stearothermop 89.99
d1z45a2347 Uridine diphosphogalactose-4-epimerase (UDP-galact 89.99
d2f06a171 Hypothetical protein BT0572 {Bacteroides thetaiota 89.8
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 89.67
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 89.66
d2fyta1311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 89.49
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 89.45
d2igta1309 Putative methyltransferase Atu0340 {Agrobacterium 89.45
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 89.45
d2cl5a1214 Catechol O-methyltransferase, COMT {Rat (Rattus no 89.36
d1ygya378 Phosphoglycerate dehydrogenase, regulatory (C-term 89.28
d2f06a270 Hypothetical protein BT0572 {Bacteroides thetaiota 89.22
d2dula1375 N(2),N(2)-dimethylguanosine tRNA methyltransferase 89.18
d1rpna_321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 89.17
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 88.92
d1piwa1192 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 88.91
d2gh1a1281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 88.79
d1pl8a1185 Ketose reductase (sorbitol dehydrogenase) {Human ( 88.71
d2ex4a1222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 88.66
d2b69a1312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 88.57
d1jbqa_355 Cystathionine beta-synthase {Human (Homo sapiens) 88.38
d1uira_312 Spermidine synthase {Thermus thermophilus [TaxId: 88.31
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 88.28
d1xtpa_254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 88.23
d1iy9a_274 Spermidine synthase {Bacillus subtilis [TaxId: 142 88.15
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 88.04
d1gtma1239 Glutamate dehydrogenase {Archaeon Pyrococcus furio 87.69
d1cf2o1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 87.43
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 87.31
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 87.13
d2esra1152 Putative methyltransferase SPy1538 {Streptococcus 87.05
d2b2ca1312 Spermidine synthase {Caenorhabditis elegans [TaxId 87.04
d2i76a2153 Hypothetical protein TM1727 {Thermotoga maritima [ 87.03
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 86.97
d2o07a1285 Spermidine synthase {Human (Homo sapiens) [TaxId: 86.8
d2fcaa1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 86.78
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 86.51
d1q0qa2151 1-deoxy-D-xylulose-5-phosphate reductoisomerase {E 86.44
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 86.41
d1ne2a_197 Hypothetical protein Ta1320 {Archaeon Thermoplasma 86.35
d2fhpa1182 Putative methylase EF2452 {Enterococcus faecalis [ 86.3
d1jqea_280 Histamine methyltransferase {Human (Homo sapiens) 86.23
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 86.2
d1inla_295 Spermidine synthase {Thermotoga maritima [TaxId: 2 86.11
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 86.01
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 85.7
d1sb8a_341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 85.66
d1ydwa1184 Probable oxidoreductase At4g09670 {Thale cress (Ar 85.62
d1xj5a_290 Spermidine synthase {Thale cress (Arabidopsis thal 85.52
d1ek6a_346 Uridine diphosphogalactose-4-epimerase (UDP-galact 85.42
d1vlma_208 Possible histamine N-methyltransferase TM1293 {The 85.14
d2p7ia1225 Hypothetical protein ECA1738 {Erwinia carotovora [ 85.0
d2fzwa1197 Alcohol dehydrogenase {Human (Homo sapiens), diffe 84.9
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 84.68
d1b7go1178 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 84.51
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 84.33
d1mjfa_276 Putative spermidine synthetase PF0127 (SpeE) {Arch 84.21
d2g82a1168 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 84.07
d1t2aa_347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 84.01
d1qzza2256 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 83.81
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 83.8
d1e3ia1202 Alcohol dehydrogenase {Mouse (Mus musculus), class 83.78
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 83.26
d1tt7a1162 Hypothetical protein YhfP {Bacillus subtilis [TaxI 83.1
d2a14a1257 Indolethylamine N-methyltransferase, INMT {Human ( 82.94
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 82.91
d1gy8a_383 Uridine diphosphogalactose-4-epimerase (UDP-galact 82.49
d1m6ya2192 TM0872, methyltransferase domain {Thermotoga marit 82.43
d1u7za_223 Coenzyme A biosynthesis bifunctional protein CoaBC 82.33
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 82.24
d1diha1162 Dihydrodipicolinate reductase {Escherichia coli [T 82.04
d1jvba1177 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 81.88
d1t4ba1146 Aspartate beta-semialdehyde dehydrogenase {Escheri 81.87
d1g6q1_328 Arginine methyltransferase, HMT1 {Baker's yeast (S 81.78
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 81.72
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 81.63
d1tdja1331 Threonine deaminase {Escherichia coli [TaxId: 562] 81.6
d1wg8a2182 TM0872, methyltransferase domain {Thermus thermoph 81.41
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 81.37
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 81.24
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 81.16
d1xeaa1167 Putative oxidoreductase VCA1048 {Vibrio cholerae [ 80.29
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 80.27
>d1toha_ d.178.1.1 (A:) Tyrosine hydroxylase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains
superfamily: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains
family: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains
domain: Tyrosine hydroxylase
species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=100.00  E-value=1.5e-87  Score=691.93  Aligned_cols=276  Identities=48%  Similarity=0.788  Sum_probs=241.0

Q ss_pred             CCcCcccccchhhhhhhhhhhcCCCCCCCCCCCCCHHHHHHHHHHHHHHhccCCCCC-----------------------
Q psy14589        343 GVPWFPRRIRELDRFANQILSYGSELDADHPGFTDPVYRARRKYFADLAFNYKHSIL-----------------------  399 (655)
Q Consensus       343 ~vpWfPr~~~dLD~~~~~~l~~~~~l~~dhpgf~D~~y~~rR~~ia~ia~~~k~g~~-----------------------  399 (655)
                      +||||||+|+|||+|+|++|+||+||++|||||+|++||+||++||++|++||+|++                       
T Consensus         1 ~vpwfp~~i~dld~~~~~~~~~~~~l~~dhpgf~D~~Yr~RR~~~a~~a~~~~~g~piP~v~YT~eE~~tW~~l~~rl~~   80 (336)
T d1toha_           1 KVPWFPRKVSELDKCHHLVTKFDPDLDLDHPGFSDQVYRQRRKLIAEIAFQYKHGEPIPHVEYTAEEIATWKEVYVTLKG   80 (336)
T ss_dssp             CCCCCCSBGGGGGGC-----------CTTSTTTTCHHHHHHHHHHHHHHHHCCTTSCCCCCCCCHHHHHHHHHHHHHHHH
T ss_pred             CCCCCCCCHHHHHHHhchhhccCcccCCCCCCCCCHHHHHHHHHHHHHHHhccCCCCCCCcCcCHHHHHHHHHHHHHHHH
Confidence            589999999999999999999999999999999999999999999999999999998                       


Q ss_pred             -----cchhHHhhhhHHHHhcCCCCCCCCChHHHHHhhhhccCceEEecCCCCChHHHHHhhhcCccceeeeccCCCCCC
Q psy14589        400 -----LMPEHNHVFPLLIQNCGYAEDNIPQLEDISKFLKDSTGFSLRPVAGLLSSRDFLAGLAFRVFHSTQYIRHPSKPL  474 (655)
Q Consensus       400 -----Ac~ey~~g~~~l~~~~g~~~~~Ip~~~~~~~~l~~~tg~~~~~v~g~~~~~~f~~~la~r~f~~t~~ir~~~~~~  474 (655)
                           ||++|++|+++|++.||+++|+||||+|||++|+++|||+++||+||||+++||++||+|+|||||||||+++|+
T Consensus        81 l~~~~Ac~eyl~gl~~L~~~~g~~~d~IPql~dvs~~L~~~TGw~l~pV~Gli~~r~F~~~LA~RvFp~TqyIR~~~~~~  160 (336)
T d1toha_          81 LYATHACREHLEGFQLLERYCGYREDSIPQLEDVSRFLKERTGFQLRPVAGLLSARDFLASLAFRVFQCTQYIRHASSPM  160 (336)
T ss_dssp             HHHHHBCHHHHHHHHHHHHHSCCBTTBCCCHHHHHHHHHHHTSCEEEECSSCCCHHHHHHHHTTTEEEECCCCCCTTCTT
T ss_pred             HHhccccHHHHHHHHHHHHhcCCCcCCCCCHHHHHHHHHHhhCCEEEecCCcCCHHHHHHHHhcCccceeeeeccccccc
Confidence                 999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCchhhhhhcCCCCccCChhHHHHHHHHhhhcCCCChHHHHHHHhhhhhhhhhhhccCCCCCCCCeEee-cccccCCH
Q psy14589        475 YTPEPDVCHELLGHVPLFADPSFAQFSQEIGLASLGAPDEYVERLATSNNFMIVPRLASLSPDSTGFSLRP-VAGLLSSR  553 (655)
Q Consensus       475 y~~epd~~He~~gh~p~l~~~~~a~~~~~~Gl~~l~~~~~~i~~l~~l~w~tve~gl~~~~~~~tg~~~~~-g~Gllss~  553 (655)
                      ||||||||||++||+|||+||+||+|+|++|++++++++++|.+|+|+||||||||||+++     +++|+ |||||||.
T Consensus       161 YtpEPDi~HEl~GHvPlLadp~fA~f~q~~G~~sl~a~de~i~~LarlYWfTVEFGLi~e~-----g~lKaYGAGLLSS~  235 (336)
T d1toha_         161 HSPEPDCCHELLGHVPMLADRTFAQFSQDIGLASLGASDEEIEKLSTVYWFTVEFGLCKQN-----GELKAYGAGLLSSY  235 (336)
T ss_dssp             CCSSCCHHHHHHHTHHHHTSHHHHHHHHHHHHHHTTCCHHHHHHHHHHHHTTTTTCEEEET-----TEEEECCHHHHTCH
T ss_pred             cccchhHHHHHhCcccccCCHHHHHHHHHHHHHHhhcchHHHHHHhhhheeeEeeeeeccC-----CCceEecccccCCH
Confidence            9999999999999999999999999999999999999999999999999999999999999     99999 99999999


Q ss_pred             HHHHhhhc-----ccccccccccCCCCCCCCCCcchhhhhcCCcccccCchHHHHHHHHh--hcccCCceEEEeeccccc
Q psy14589        554 DFLAGLAF-----RVFHSTQYIRHPSKPLYTPEPDVCHELLGHVPLFADPSFAQFSQEIG--LASLGAPYLFYYVCHELL  626 (655)
Q Consensus       554 ~~~~~l~~-----~~f~~~~~ir~~~~~~y~~~pd~~hd~~ghvp~l~~p~f~~~~~~~g--~~~~~a~~~~~~~~~~~~  626 (655)
                      +|++|+.+     +.|.+..-+++++.++-.+           =-++.-++|.+..+.+.  ...++.||.++|  +++|
T Consensus       236 gEl~~als~~~~~~pfd~~~v~~t~y~i~~~Q-----------p~YFV~~Sfe~l~e~l~~fa~~~~rpf~~~y--~p~t  302 (336)
T d1toha_         236 GELLHSLSEEPEVRAFDPDTAAVQPYQDQTYQ-----------PVYFVSESFNDAKDKLRNYASRIQRPFSVKF--DPYT  302 (336)
T ss_dssp             HHHHHHTSSSSEEEECCHHHHHTCCCCSSSCC-----------SEEEEESCHHHHHHHHHHHHHTSCCSCEEEE--ETTT
T ss_pred             HHHHHHccCCCcccCCCHHHHhcCCCCCCccc-----------cceEEECCHHHHHHHHHHHHHhcCCCccccc--CCcc
Confidence            99999865     3555544445544433333           12344555666665555  245689999999  9999


Q ss_pred             CccccccCch
Q psy14589        627 GHVPLFADPS  636 (655)
Q Consensus       627 ~~~~~~~~~~  636 (655)
                      ++|-|+|++.
T Consensus       303 ~~vevl~~~~  312 (336)
T d1toha_         303 LAIDVLDSPH  312 (336)
T ss_dssp             TEEEEECSHH
T ss_pred             ceEEeeCCHH
Confidence            9999999986



>d1j8ua_ d.178.1.1 (A:) Phenylalanine hydroxylase, PAH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mlwa_ d.178.1.1 (A:) Tryptophan hydroxylase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ltza_ d.178.1.1 (A:) Phenylalanine hydroxylase, PAH {Chromobacterium violaceum [TaxId: 536]} Back     information, alignment and structure
>d1mlwa_ d.178.1.1 (A:) Tryptophan hydroxylase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ltza_ d.178.1.1 (A:) Phenylalanine hydroxylase, PAH {Chromobacterium violaceum [TaxId: 536]} Back     information, alignment and structure
>d1toha_ d.178.1.1 (A:) Tyrosine hydroxylase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1j8ua_ d.178.1.1 (A:) Phenylalanine hydroxylase, PAH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2qmwa2 d.58.18.3 (A:185-264) Prephenate dehydratase C-terminal domain {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1phza1 d.58.18.3 (A:19-115) Phenylalanine hydroxylase N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3ja1 b.35.1.2 (A:4-142,A:313-351) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d1cdoa1 b.35.1.2 (A:1-164,A:340-374) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1y7pa2 d.58.18.12 (A:2-78) Hypothetical protein AF1403, N-terminal domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1h2ba1 b.35.1.2 (A:17-154,A:327-359) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1f8fa1 b.35.1.2 (A:4-162,A:337-371) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1kola1 b.35.1.2 (A:2-160,A:356-397) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f1fa1 d.58.18.6 (A:2-77) Acetolactate synthase small subunit, IlvH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d2fgca2 d.58.18.6 (A:27-104) Acetolactate synthase small subunit, IlvH {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yb5a1 b.35.1.2 (A:6-120,A:295-329) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pc6a2 d.58.18.6 (A:1-77) Acetolactate synthase small subunit, IlvH {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1iz0a1 b.35.1.2 (A:1-98,A:270-302) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1qora1 b.35.1.2 (A:2-112,A:292-327) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1gu7a1 b.35.1.2 (A:23-160,A:350-386) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d1sc6a3 d.58.18.1 (A:327-410) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1r0ka2 c.2.1.3 (A:3-126,A:265-290) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2bhsa1 c.79.1.1 (A:2-293) O-acetylserine sulfhydrylase (Cysteine synthase) {Escherichia coli, isoform B (CysM) [TaxId: 562]} Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1llua1 b.35.1.2 (A:2-143,A:310-342) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xa0a1 b.35.1.2 (A:1-118,A:295-328) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2f06a1 d.58.18.11 (A:71-141) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ygya3 d.58.18.1 (A:452-529) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2f06a2 d.58.18.11 (A:1-70) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2dula1 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1piwa1 b.35.1.2 (A:1-152,A:321-360) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1pl8a1 b.35.1.2 (A:1-145,A:317-356) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jbqa_ c.79.1.1 (A:) Cystathionine beta-synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1gtma1 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1q0qa2 c.2.1.3 (A:1-125,A:275-300) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d2fzwa1 b.35.1.2 (A:1-162,A:339-373) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2g82a1 c.2.1.3 (A:1-148,A:311-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e3ia1 b.35.1.2 (A:1-167,A:342-376) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1tt7a1 b.35.1.2 (A:2-127,A:295-330) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1u7za_ c.72.3.1 (A:) Coenzyme A biosynthesis bifunctional protein CoaBC, phosphopantothenoylcysteine synthase domain (CoaB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jvba1 b.35.1.2 (A:1-143,A:314-347) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1tdja1 c.79.1.1 (A:5-335) Threonine deaminase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wg8a2 c.66.1.23 (A:5-108,A:207-284) TM0872, methyltransferase domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure