Psyllid ID: psy14604

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------21
GKSKRRPVRGAAARGKKKKKSTGRASKAADDDDDEDLKAAYFNDGKKKKSKGRGKTKTKELQEDEDGASGSKPRRYTPPPEKPTTDLRKKYEKQPPFLDDTGMQLHAYQLEGINWLRYSWGQNIDTILADEMGLGKTIQTITFLYSLFKEGHCKGPFLVSAPLSTIINWEREFETWAPDFYVVTYVGDKDCRIVLRDHDISWEDTANRG
ccccccccHHHHHHcHHccccccHHHHccccccHHHHHHHcccccHHHHccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccccEEcccccccHHHHHHHHHHHHHHcccccccEEEEEEcccHHHHHHHHHHHcccccEEEEEccHHHHHHHHHHccccccccccc
cccccccccccccccccccccccccccHHccccccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccEEcccccccccccccccHHHHHHHHHHHHHHHccccEEEEHHccccHHHHHHHHHHHHHHcccccccEEEEEcHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHccEEEccccccc
gkskrrpvrgaaargkkkkkstgraskaadddddeDLKAAYfndgkkkkskgrgktktkelqededgasgskprrytpppekpttdlrkkyekqppflddtgMQLHAYQLEGINWLRYSWGQNIDTILAdemglgktIQTITFLYSLFkeghckgpflvsaplstiINWEREFetwapdfyvvtyvgdkdcrivlrdhdiswedtanrg
gkskrrpvrgaaargkkkkkstgraskaadddddedlkaayfndgkkkkskgrgktktkelqededgasgskprrytpppekpttdlrkkyEKQPPFLDDTGMQLHAYQLEGINWLRYSWGQNIDTILADEMGLGKTIQTITFLYSLFKEGHCKGPFLVSAPLSTIINWEREFETWAPDFYVVTYVgdkdcrivlrdhdiswedtanrg
GKSKRRPVrgaaargkkkkkstgraskaadddddedlkaaYFNDgkkkkskgrgktktkELQEDEDGASGSKPRRYTPPPEKPTTDLRKKYEKQPPFLDDTGMQLHAYQLEGINWLRYSWGQNIDTILADEMGLGKTIQTITFLYSLFKEGHCKGPFLVSAPLSTIINWEREFETWAPDFYVVTYVGDKDCRIVLRDHDISWEDTANRG
**************************************************************************************************DDTGMQLHAYQLEGINWLRYSWGQNIDTILADEMGLGKTIQTITFLYSLFKEGHCKGPFLVSAPLSTIINWEREFETWAPDFYVVTYVGDKDCRIVLRDHDISW*******
***********************************************************************************************PFLDDTGMQLHAYQLEGINWLRYSWGQNIDTILADEMGLGKTIQTITFLYSLFKEGHCKGPFLVSAPLSTIINWEREFETWAPDFYVVTYVGDKDCRIVLRDHDIS*E******
********************************DDEDLKAAYFNDG*****************************************LRKKYEKQPPFLDDTGMQLHAYQLEGINWLRYSWGQNIDTILADEMGLGKTIQTITFLYSLFKEGHCKGPFLVSAPLSTIINWEREFETWAPDFYVVTYVGDKDCRIVLRDHDISWEDTANRG
***********************RASKAADDDDDEDLKAAYFNDGKKKKSKGRGK**************************KPTTDLRKKYEKQPPFLDDTGMQLHAYQLEGINWLRYSWGQNIDTILADEMGLGKTIQTITFLYSLFKEGHCKGPFLVSAPLSTIINWEREFETWAPDFYVVTYVGDKDCRIVLRDHDISWEDT****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
GKSKRRPVRGAAARGKKKKKSTGRASKAADDDDDEDLKAAYFNDGKKKKSKGRGKTKTKELQEDEDGASGSKPRRYTPPPEKPTTDLRKKYEKQPPFLDDTGMQLHAYQLEGINWLRYSWGQNIDTILADEMGLGKTIQTITFLYSLFKEGHCKGPFLVSAPLSTIINWEREFETWAPDFYVVTYVGDKDCRIVLRDHDISWEDTANRG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query209 2.2.26 [Sep-21-2011]
O97159 1982 Chromodomain-helicase-DNA yes N/A 0.650 0.068 0.764 2e-64
Q6PDQ2 1915 Chromodomain-helicase-DNA yes N/A 0.626 0.068 0.725 1e-54
Q14839 1912 Chromodomain-helicase-DNA yes N/A 0.626 0.068 0.725 1e-54
Q12873 2000 Chromodomain-helicase-DNA no N/A 0.626 0.065 0.709 1e-52
Q8TDI0 1954 Chromodomain-helicase-DNA no N/A 0.622 0.066 0.7 9e-52
O16102 892 Chromodomain-helicase-DNA no N/A 0.602 0.141 0.674 1e-50
G5EBZ4 1829 Protein let-418 OS=Caenor yes N/A 0.598 0.068 0.672 2e-49
Q22516 1787 Chromodomain-helicase-DNA no N/A 0.598 0.069 0.672 7e-49
O14647 1828 Chromodomain-helicase-DNA no N/A 0.511 0.058 0.542 2e-31
Q7KU24 1883 Chromodomain-helicase-DNA no N/A 0.550 0.061 0.525 2e-31
>sp|O97159|CHDM_DROME Chromodomain-helicase-DNA-binding protein Mi-2 homolog OS=Drosophila melanogaster GN=Mi-2 PE=1 SV=2 Back     alignment and function desciption
 Score =  244 bits (624), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 104/136 (76%), Positives = 123/136 (90%)

Query: 74  RRYTPPPEKPTTDLRKKYEKQPPFLDDTGMQLHAYQLEGINWLRYSWGQNIDTILADEMG 133
           + YTPPPEKPTTDL+KKYE QP FL+ TGMQLH YQ+EGINWLRYSWGQ IDTILADEMG
Sbjct: 699 KHYTPPPEKPTTDLKKKYEDQPAFLEGTGMQLHPYQIEGINWLRYSWGQGIDTILADEMG 758

Query: 134 LGKTIQTITFLYSLFKEGHCKGPFLVSAPLSTIINWEREFETWAPDFYVVTYVGDKDCRI 193
           LGKTIQT+TFLYSL+KEGHC+GPFLV+ PLST++NWEREFE WAPDFY +TY+GDKD R 
Sbjct: 759 LGKTIQTVTFLYSLYKEGHCRGPFLVAVPLSTLVNWEREFELWAPDFYCITYIGDKDSRA 818

Query: 194 VLRDHDISWEDTANRG 209
           V+R++++S+E+ A RG
Sbjct: 819 VIRENELSFEEGAIRG 834
Vital role in development. Protein binds to a portion of Hunchback (HB) protein that is critical for repression of bithorax complex (BXC) genes. May also function in polycomb group (PcG) repression of Hox genes.
Drosophila melanogaster (taxid: 7227)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 2
>sp|Q6PDQ2|CHD4_MOUSE Chromodomain-helicase-DNA-binding protein 4 OS=Mus musculus GN=Chd4 PE=1 SV=1 Back     alignment and function description
>sp|Q14839|CHD4_HUMAN Chromodomain-helicase-DNA-binding protein 4 OS=Homo sapiens GN=CHD4 PE=1 SV=2 Back     alignment and function description
>sp|Q12873|CHD3_HUMAN Chromodomain-helicase-DNA-binding protein 3 OS=Homo sapiens GN=CHD3 PE=1 SV=3 Back     alignment and function description
>sp|Q8TDI0|CHD5_HUMAN Chromodomain-helicase-DNA-binding protein 5 OS=Homo sapiens GN=CHD5 PE=2 SV=1 Back     alignment and function description
>sp|O16102|CHD3_DROME Chromodomain-helicase-DNA-binding protein 3 OS=Drosophila melanogaster GN=Chd3 PE=2 SV=3 Back     alignment and function description
>sp|G5EBZ4|LE418_CAEEL Protein let-418 OS=Caenorhabditis elegans GN=let-418 PE=1 SV=1 Back     alignment and function description
>sp|Q22516|CHD3_CAEEL Chromodomain-helicase-DNA-binding protein 3 homolog OS=Caenorhabditis elegans GN=chd-3 PE=2 SV=2 Back     alignment and function description
>sp|O14647|CHD2_HUMAN Chromodomain-helicase-DNA-binding protein 2 OS=Homo sapiens GN=CHD2 PE=1 SV=2 Back     alignment and function description
>sp|Q7KU24|CHD1_DROME Chromodomain-helicase-DNA-binding protein 1 OS=Drosophila melanogaster GN=Chd1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query209
383851360 1967 PREDICTED: chromodomain-helicase-DNA-bin 0.708 0.075 0.782 9e-68
110777198 1966 PREDICTED: chromodomain-helicase-DNA-bin 0.708 0.075 0.782 1e-67
380020464 1964 PREDICTED: LOW QUALITY PROTEIN: chromodo 0.708 0.075 0.782 1e-67
340726708 1974 PREDICTED: LOW QUALITY PROTEIN: chromodo 0.708 0.074 0.782 1e-67
350424653 1965 PREDICTED: chromodomain-helicase-DNA-bin 0.708 0.075 0.782 1e-67
332029993 1852 Chromodomain-helicase-DNA-binding protei 0.708 0.079 0.776 3e-67
345481883 2009 PREDICTED: chromodomain-helicase-DNA-bin 0.813 0.084 0.728 4e-67
307199491 1948 Chromodomain-helicase-DNA-binding protei 0.703 0.075 0.774 8e-67
170036699 1982 chromodomain helicase-DNA-binding protei 0.722 0.076 0.767 2e-66
242023690 1999 Chromodomain helicase-DNA-binding protei 0.818 0.085 0.729 2e-66
>gi|383851360|ref|XP_003701201.1| PREDICTED: chromodomain-helicase-DNA-binding protein Mi-2 homolog [Megachile rotundata] Back     alignment and taxonomy information
 Score =  261 bits (668), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 136/152 (89%), Gaps = 4/152 (2%)

Query: 58  TKELQEDEDGASGSKPRRYTPPPEKPTTDLRKKYEKQPPFLDDTGMQLHAYQLEGINWLR 117
           T+EL +DE+      P+RYTPPP+KPTTDL+KKYE+QP +LD TGMQLH YQLEG+NWLR
Sbjct: 678 TRELIDDEE----RTPKRYTPPPDKPTTDLKKKYERQPEYLDQTGMQLHPYQLEGLNWLR 733

Query: 118 YSWGQNIDTILADEMGLGKTIQTITFLYSLFKEGHCKGPFLVSAPLSTIINWEREFETWA 177
           YSWGQ IDTILADEMGLGKTIQTITFLYSL+KEGHCKGPFLVS PLSTIINWEREFETWA
Sbjct: 734 YSWGQGIDTILADEMGLGKTIQTITFLYSLYKEGHCKGPFLVSVPLSTIINWEREFETWA 793

Query: 178 PDFYVVTYVGDKDCRIVLRDHDISWEDTANRG 209
           PDFY VTYVGDKD RIV+R++++S+E+ A RG
Sbjct: 794 PDFYCVTYVGDKDSRIVIRENELSFEEGAVRG 825

Source: Megachile rotundata

Species: Megachile rotundata

Genus: Megachile

Family: Megachilidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|110777198|ref|XP_624414.2| PREDICTED: chromodomain-helicase-DNA-binding protein Mi-2 homolog [Apis mellifera] Back     alignment and taxonomy information
>gi|380020464|ref|XP_003694103.1| PREDICTED: LOW QUALITY PROTEIN: chromodomain-helicase-DNA-binding protein Mi-2 homolog [Apis florea] Back     alignment and taxonomy information
>gi|340726708|ref|XP_003401695.1| PREDICTED: LOW QUALITY PROTEIN: chromodomain-helicase-DNA-binding protein Mi-2 homolog [Bombus terrestris] Back     alignment and taxonomy information
>gi|350424653|ref|XP_003493868.1| PREDICTED: chromodomain-helicase-DNA-binding protein Mi-2 homolog [Bombus impatiens] Back     alignment and taxonomy information
>gi|332029993|gb|EGI69818.1| Chromodomain-helicase-DNA-binding protein Mi-2-like protein [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|345481883|ref|XP_001605650.2| PREDICTED: chromodomain-helicase-DNA-binding protein Mi-2 homolog [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|307199491|gb|EFN80104.1| Chromodomain-helicase-DNA-binding protein Mi-2-like protein [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|170036699|ref|XP_001846200.1| chromodomain helicase-DNA-binding protein 3 [Culex quinquefasciatus] gi|167879513|gb|EDS42896.1| chromodomain helicase-DNA-binding protein 3 [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|242023690|ref|XP_002432264.1| Chromodomain helicase-DNA-binding protein, putative [Pediculus humanus corporis] gi|212517673|gb|EEB19526.1| Chromodomain helicase-DNA-binding protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query209
FB|FBgn0262519 1982 Mi-2 [Drosophila melanogaster 0.693 0.073 0.715 1.3e-58
UNIPROTKB|F5GWX5 1905 CHD4 "Chromodomain-helicase-DN 0.717 0.078 0.658 7.4e-51
UNIPROTKB|E2RHA0 1912 CHD4 "Uncharacterized protein" 0.717 0.078 0.658 7.5e-51
UNIPROTKB|Q14839 1912 CHD4 "Chromodomain-helicase-DN 0.717 0.078 0.658 7.5e-51
UNIPROTKB|F1SLR5 1912 CHD4 "Uncharacterized protein" 0.717 0.078 0.658 7.5e-51
MGI|MGI:1344380 1915 Chd4 "chromodomain helicase DN 0.717 0.078 0.658 7.5e-51
UNIPROTKB|E9PU01 1915 Chd4 "Protein Chd4" [Rattus no 0.717 0.078 0.658 7.5e-51
UNIPROTKB|J9NW81 1932 CHD4 "Uncharacterized protein" 0.717 0.077 0.658 7.6e-51
UNIPROTKB|F1N3F6 1934 CHD4 "Uncharacterized protein" 0.717 0.077 0.658 7.6e-51
UNIPROTKB|F1LM59 1945 Chd4 "Protein Chd4" [Rattus no 0.717 0.077 0.658 7.7e-51
FB|FBgn0262519 Mi-2 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 616 (221.9 bits), Expect = 1.3e-58, P = 1.3e-58
 Identities = 108/151 (71%), Positives = 132/151 (87%)

Query:    60 ELQEDEDGASGSKP-RRYTPPPEKPTTDLRKKYEKQPPFLDDTGMQLHAYQLEGINWLRY 118
             ++++DED     +P + YTPPPEKPTTDL+KKYE QP FL+ TGMQLH YQ+EGINWLRY
Sbjct:   689 KVEDDED-----RPVKHYTPPPEKPTTDLKKKYEDQPAFLEGTGMQLHPYQIEGINWLRY 743

Query:   119 SWGQNIDTILADEMGLGKTIQTITFLYSLFKEGHCKGPFLVSAPLSTIINWEREFETWAP 178
             SWGQ IDTILADEMGLGKTIQT+TFLYSL+KEGHC+GPFLV+ PLST++NWEREFE WAP
Sbjct:   744 SWGQGIDTILADEMGLGKTIQTVTFLYSLYKEGHCRGPFLVAVPLSTLVNWEREFELWAP 803

Query:   179 DFYVVTYVGDKDCRIVLRDHDISWEDTANRG 209
             DFY +TY+GDKD R V+R++++S+E+ A RG
Sbjct:   804 DFYCITYIGDKDSRAVIRENELSFEEGAIRG 834
GO:0016887 "ATPase activity" evidence=IDA;NAS
GO:0005634 "nucleus" evidence=ISS;IDA;NAS
GO:0004003 "ATP-dependent DNA helicase activity" evidence=ISS
GO:0004386 "helicase activity" evidence=ISS
GO:0016581 "NuRD complex" evidence=ISS;TAS
GO:0006333 "chromatin assembly or disassembly" evidence=ISS
GO:0003682 "chromatin binding" evidence=ISS;IDA
GO:0003678 "DNA helicase activity" evidence=ISS
GO:0005700 "polytene chromosome" evidence=IDA
GO:0042766 "nucleosome mobilization" evidence=IDA
GO:0003677 "DNA binding" evidence=IDA
GO:0005524 "ATP binding" evidence=IEA
GO:0008026 "ATP-dependent helicase activity" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0005515 "protein binding" evidence=IPI
GO:0007517 "muscle organ development" evidence=IMP
GO:0048813 "dendrite morphogenesis" evidence=IMP
GO:0031491 "nucleosome binding" evidence=IDA
GO:0000122 "negative regulation of transcription from RNA polymerase II promoter" evidence=IDA
GO:0070615 "nucleosome-dependent ATPase activity" evidence=IDA
UNIPROTKB|F5GWX5 CHD4 "Chromodomain-helicase-DNA-binding protein 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2RHA0 CHD4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q14839 CHD4 "Chromodomain-helicase-DNA-binding protein 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SLR5 CHD4 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1344380 Chd4 "chromodomain helicase DNA binding protein 4" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E9PU01 Chd4 "Protein Chd4" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|J9NW81 CHD4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1N3F6 CHD4 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1LM59 Chd4 "Protein Chd4" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O97159CHDM_DROME3, ., 6, ., 4, ., 1, 20.76470.65070.0686yesN/A
Q14839CHD4_HUMAN3, ., 6, ., 4, ., 1, 20.72510.62670.0685yesN/A
G5EBZ4LE418_CAEELNo assigned EC number0.6720.59800.0683yesN/A
Q6PDQ2CHD4_MOUSE3, ., 6, ., 4, ., 1, 20.72510.62670.0684yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query209
pfam00176 301 pfam00176, SNF2_N, SNF2 family N-terminal domain 2e-31
PLN03142 1033 PLN03142, PLN03142, Probable chromatin-remodeling 5e-23
COG0553 866 COG0553, HepA, Superfamily II DNA/RNA helicases, S 3e-21
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 5e-14
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 6e-10
>gnl|CDD|215770 pfam00176, SNF2_N, SNF2 family N-terminal domain Back     alignment and domain information 
 Score =  115 bits (290), Expect = 2e-31
 Identities = 52/101 (51%), Positives = 59/101 (58%), Gaps = 1/101 (0%)

Query: 108 YQLEGINWLRYSWGQNIDTILADEMGLGKTIQTITFLYSLFKEGHC-KGPFLVSAPLSTI 166
           YQLEG+NWL       +  ILADEMGLGKT+QTI  L +  KEG   +GP LV  PLST+
Sbjct: 1   YQLEGVNWLISLESNGLGGILADEMGLGKTLQTIALLATYLKEGKDRRGPTLVVCPLSTL 60

Query: 167 INWEREFETWAPDFYVVTYVGDKDCRIVLRDHDISWEDTAN 207
            NW  EFE WAP   VV Y GD   R  LR       DT +
Sbjct: 61  HNWLNEFEKWAPALRVVVYHGDGRERSKLRQSMAKRLDTYD 101

This domain is found in proteins involved in a variety of processes including transcription regulation (e.g., SNF2, STH1, brahma, MOT1), DNA repair (e.g. ERCC6, RAD16, RAD5), DNA recombination (e.g. RAD54), and chromatin unwinding (e.g. ISWI) as well as a variety of other proteins with little functional information (e.g. lodestar, ETL1). Length = 301
>gnl|CDD|215601 PLN03142, PLN03142, Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>gnl|CDD|223627 COG0553, HepA, Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 209
KOG0384|consensus 1373 99.95
KOG0385|consensus 971 99.95
KOG0389|consensus 941 99.94
KOG0387|consensus 923 99.94
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 99.91
KOG0388|consensus 1185 99.91
KOG0391|consensus 1958 99.89
KOG0386|consensus 1157 99.88
KOG0392|consensus 1549 99.86
KOG1002|consensus 791 99.8
KOG0383|consensus 696 99.8
KOG1015|consensus 1567 99.79
PF00176 299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 99.79
KOG0390|consensus 776 99.76
KOG4439|consensus 901 99.74
COG0553 866 HepA Superfamily II DNA/RNA helicases, SNF2 family 99.7
KOG1000|consensus 689 99.69
PRK04914 956 ATP-dependent helicase HepA; Validated 99.59
KOG1016|consensus 1387 99.5
TIGR00603 732 rad25 DNA repair helicase rad25. All proteins in t 99.35
KOG1001|consensus 674 99.08
PF04851184 ResIII: Type III restriction enzyme, res subunit; 99.06
PRK13766 773 Hef nuclease; Provisional 98.86
COG1061 442 SSL2 DNA or RNA helicases of superfamily II [Trans 98.78
PHA02558 501 uvsW UvsW helicase; Provisional 98.68
smart00487201 DEXDc DEAD-like helicases superfamily. 98.68
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 98.58
KOG0298|consensus 1394 98.53
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 98.33
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 98.31
KOG1123|consensus 776 98.23
PRK11776 460 ATP-dependent RNA helicase DbpA; Provisional 98.22
TIGR00348 667 hsdR type I site-specific deoxyribonuclease, HsdR 98.18
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 98.16
TIGR00643 630 recG ATP-dependent DNA helicase RecG. 98.11
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 98.02
COG4096 875 HsdR Type I site-specific restriction-modification 98.02
PTZ00424 401 helicase 45; Provisional 97.93
PRK01172 674 ski2-like helicase; Provisional 97.91
PRK10590 456 ATP-dependent RNA helicase RhlE; Provisional 97.9
PRK10917 681 ATP-dependent DNA helicase RecG; Provisional 97.89
PRK01297 475 ATP-dependent RNA helicase RhlB; Provisional 97.89
PRK04837 423 ATP-dependent RNA helicase RhlB; Provisional 97.89
PRK11192 434 ATP-dependent RNA helicase SrmB; Provisional 97.89
PRK05580 679 primosome assembly protein PriA; Validated 97.84
PRK02362 737 ski2-like helicase; Provisional 97.83
PTZ00110 545 helicase; Provisional 97.76
PLN00206 518 DEAD-box ATP-dependent RNA helicase; Provisional 97.64
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 97.63
PRK00254 720 ski2-like helicase; Provisional 97.58
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 97.54
COG1111 542 MPH1 ERCC4-like helicases [DNA replication, recomb 97.53
PRK13767 876 ATP-dependent helicase; Provisional 97.46
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 97.45
PRK09401 1176 reverse gyrase; Reviewed 97.45
COG1204 766 Superfamily II helicase [General function predicti 97.39
TIGR00614 470 recQ_fam ATP-dependent DNA helicase, RecQ family. 97.36
PRK10689 1147 transcription-repair coupling factor; Provisional 97.33
TIGR03714 762 secA2 accessory Sec system translocase SecA2. Memb 97.32
KOG0354|consensus 746 97.3
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 97.21
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 97.15
TIGR01407 850 dinG_rel DnaQ family exonuclease/DinG family helic 97.14
COG0556 663 UvrB Helicase subunit of the DNA excision repair c 97.1
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 97.1
COG1205 851 Distinct helicase family with a unique C-terminal 96.92
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 96.88
PRK14701 1638 reverse gyrase; Provisional 96.84
TIGR03158 357 cas3_cyano CRISPR-associated helicase, Cyano-type. 96.81
COG4889 1518 Predicted helicase [General function prediction on 96.71
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 96.7
KOG0350|consensus 620 96.64
PF13086 236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 96.57
PRK15483 986 type III restriction-modification system StyLTI en 96.5
PRK09200 790 preprotein translocase subunit SecA; Reviewed 96.49
TIGR01587 358 cas3_core CRISPR-associated helicase Cas3. This mo 96.47
smart00489 289 DEXDc3 DEAD-like helicases superfamily. 96.47
smart00488 289 DEXDc2 DEAD-like helicases superfamily. 96.47
TIGR00631 655 uvrb excinuclease ABC, B subunit. This family is b 96.46
COG0513 513 SrmB Superfamily II DNA and RNA helicases [DNA rep 96.44
COG1200 677 RecG RecG-like helicase [DNA replication, recombin 96.36
KOG0330|consensus 476 96.33
TIGR03117 636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 96.23
PRK09694 878 helicase Cas3; Provisional 96.04
TIGR00595 505 priA primosomal protein N'. All proteins in this f 96.01
PRK12898 656 secA preprotein translocase subunit SecA; Reviewed 95.98
KOG0331|consensus 519 95.91
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 95.9
TIGR00963 745 secA preprotein translocase, SecA subunit. The pro 95.8
PRK05298 652 excinuclease ABC subunit B; Provisional 95.75
KOG1802|consensus 935 95.72
KOG0345|consensus 567 95.71
TIGR00604 705 rad3 DNA repair helicase (rad3). All proteins in t 95.7
TIGR00376 637 DNA helicase, putative. The gene product may repre 95.38
PF12340 229 DUF3638: Protein of unknown function (DUF3638); In 95.28
COG1201 814 Lhr Lhr-like helicases [General function predictio 95.25
KOG0335|consensus 482 95.02
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 94.9
COG1199 654 DinG Rad3-related DNA helicases [Transcription / D 94.61
PRK07246 820 bifunctional ATP-dependent DNA helicase/DNA polyme 94.54
COG1197 1139 Mfd Transcription-repair coupling factor (superfam 94.52
PHA02653 675 RNA helicase NPH-II; Provisional 94.42
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 94.41
PRK12906 796 secA preprotein translocase subunit SecA; Reviewed 94.35
PRK12326 764 preprotein translocase subunit SecA; Reviewed 94.21
PF1324576 AAA_19: Part of AAA domain 93.6
KOG1131|consensus 755 93.13
PF13872 303 AAA_34: P-loop containing NTP hydrolase pore-1 93.02
PRK08074 928 bifunctional ATP-dependent DNA helicase/DNA polyme 92.92
PRK12904 830 preprotein translocase subunit SecA; Reviewed 92.74
PF07517266 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 92.73
KOG0338|consensus 691 92.62
COG1203 733 CRISPR-associated helicase Cas3 [Defense mechanism 92.6
COG4098 441 comFA Superfamily II DNA/RNA helicase required for 92.18
PRK13107 908 preprotein translocase subunit SecA; Reviewed 92.17
KOG0952|consensus 1230 92.12
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 91.8
COG1198 730 PriA Primosomal protein N' (replication factor Y) 91.07
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 90.92
PRK14873 665 primosome assembly protein PriA; Provisional 90.77
PF00580 315 UvrD-helicase: UvrD/REP helicase N-terminal domain 89.86
KOG1803|consensus 649 89.39
KOG0298|consensus 1394 89.18
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 88.82
KOG0334|consensus 997 88.64
KOG0342|consensus 543 88.5
KOG0329|consensus 387 88.41
PRK11747 697 dinG ATP-dependent DNA helicase DinG; Provisional 88.02
PRK11054 684 helD DNA helicase IV; Provisional 87.31
PF02562 205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 87.13
PRK10875 615 recD exonuclease V subunit alpha; Provisional 86.19
cd01124 187 KaiC KaiC is a circadian clock protein primarily f 85.9
KOG0348|consensus 708 85.12
PRK10536 262 hypothetical protein; Provisional 84.99
TIGR01447 586 recD exodeoxyribonuclease V, alpha subunit. This f 84.78
CHL00122 870 secA preprotein translocase subunit SecA; Validate 83.54
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 83.5
KOG0340|consensus 442 83.37
PRK07952244 DNA replication protein DnaC; Validated 83.01
PRK12902 939 secA preprotein translocase subunit SecA; Reviewed 83.0
COG3587 985 Restriction endonuclease [Defense mechanisms] 82.61
KOG0333|consensus 673 82.53
TIGR01448 720 recD_rel helicase, putative, RecD/TraA family. Thi 82.07
COG1484254 DnaC DNA replication protein [DNA replication, rec 81.98
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, 81.38
PF09848 352 DUF2075: Uncharacterized conserved protein (DUF207 81.22
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 81.03
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 80.21
>KOG0384|consensus Back     alignment and domain information 
Probab=99.95  E-value=1.1e-28  Score=239.88  Aligned_cols=120  Identities=51%  Similarity=0.877  Sum_probs=112.9

Q ss_pred             CChhhhhhhccCCCCccccCCCCchHHHHHHHHHHHhhcCCCceEEEcCCCCchHHHHHHHHHHHHhhCCCCCcEEEEeC
Q psy14604         83 PTTDLRKKYEKQPPFLDDTGMQLHAYQLEGINWLRYSWGQNIDTILADEMGLGKTIQTITFLYSLFKEGHCKGPFLVSAP  162 (209)
Q Consensus        83 ~~~~~~~~~~~~p~~~~~~~~~L~~~Q~~gv~~l~~~~~~~~g~iLaD~mGLGKT~q~ia~l~~~~~~~~~~~~~LIV~P  162 (209)
                      +.-....+++.+|.|+.+  ..||+||++|+|||..+|+++..||||||||||||||+|+||..++...+..+|+|||+|
T Consensus       351 ~~rp~~~Kle~qp~~~~g--~~LRdyQLeGlNWl~~~W~~~~n~ILADEmgLgktvqti~fl~~l~~~~~~~gpflvvvp  428 (1373)
T KOG0384|consen  351 PQRPRFRKLEKQPEYKGG--NELRDYQLEGLNWLLYSWYKRNNCILADEMGLGKTVQTITFLSYLFHSLQIHGPFLVVVP  428 (1373)
T ss_pred             ccchhHHHhhcCcccccc--chhhhhhcccchhHHHHHHhcccceehhhcCCCcchHHHHHHHHHHHhhhccCCeEEEee
Confidence            334455678899999976  899999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccHHHHHHHHHHhCCCceEEEEEcChhHHHHHhhhceeccCc
Q psy14604        163 LSTIINWEREFETWAPDFYVVTYVGDKDCRIVLRDHDISWEDT  205 (209)
Q Consensus       163 ~sl~~qW~~E~~~~~~~l~v~~y~G~~~~r~~i~~~~~~~~~~  205 (209)
                      +|++.+|++||.+|+ ++++++|+|+..+|..|++|+|.+..+
T Consensus       429 lst~~~W~~ef~~w~-~mn~i~y~g~~~sr~~i~~ye~~~~~~  470 (1373)
T KOG0384|consen  429 LSTITAWEREFETWT-DMNVIVYHGNLESRQLIRQYEFYHSSN  470 (1373)
T ss_pred             hhhhHHHHHHHHHHh-hhceeeeecchhHHHHHHHHHheecCC
Confidence            999999999999999 999999999999999999999998874

>KOG0385|consensus Back     alignment and domain information
>KOG0389|consensus Back     alignment and domain information
>KOG0387|consensus Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>KOG0388|consensus Back     alignment and domain information
>KOG0391|consensus Back     alignment and domain information
>KOG0386|consensus Back     alignment and domain information
>KOG0392|consensus Back     alignment and domain information
>KOG1002|consensus Back     alignment and domain information
>KOG0383|consensus Back     alignment and domain information
>KOG1015|consensus Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>KOG0390|consensus Back     alignment and domain information
>KOG4439|consensus Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1000|consensus Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>KOG1016|consensus Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>KOG1001|consensus Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>KOG0298|consensus Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>KOG1123|consensus Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>KOG0354|consensus Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0350|consensus Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>KOG0330|consensus Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0331|consensus Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>KOG1802|consensus Back     alignment and domain information
>KOG0345|consensus Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>KOG0335|consensus Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>KOG1131|consensus Back     alignment and domain information
>PF13872 AAA_34: P-loop containing NTP hydrolase pore-1 Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane Back     alignment and domain information
>KOG0338|consensus Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0952|consensus Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA Back     alignment and domain information
>KOG1803|consensus Back     alignment and domain information
>KOG0298|consensus Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>KOG0334|consensus Back     alignment and domain information
>KOG0342|consensus Back     alignment and domain information
>KOG0329|consensus Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>PRK11054 helD DNA helicase IV; Provisional Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>KOG0348|consensus Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>KOG0340|consensus Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG3587 Restriction endonuclease [Defense mechanisms] Back     alignment and domain information
>KOG0333|consensus Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query209
3mwy_W 800 Crystal Structure Of The Chromodomain-atpase Portio 9e-22
1z6a_A 500 Sulfolobus Solfataricus Swi2SNF2 ATPASE CORE DOMAIN 2e-12
1z63_A 500 Sulfolobus Solfataricus Swi2SNF2 ATPASE CORE IN COM 3e-11
1z3i_X 644 Structure Of The Swi2SNF2 CHROMATIN REMODELING DOMA 5e-07
>pdb|3MWY|W Chain W, Crystal Structure Of The Chromodomain-atpase Portion Of The Yeast Chd1 Chromatin Remodeler Length = 800 Back     alignment and structure 
Iteration: 1

 Score = 99.8 bits (247), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 49/118 (41%), Positives = 72/118 (61%), Gaps = 5/118 (4%)
Query: 85  TDLRKKYEK---QPPFLDDTGMQLHAYQLEGINWLRYSWGQNIDTILADEMGLGKTIQTI 141
           T  R ++EK   QPPF+   G +L  +QL GINW+ + W +  + ILADEMGLGKT+QT+
Sbjct: 216 TSQRPRFEKLSVQPPFI--KGGELRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTV 273
Query: 142 TFLYSLFKEGHCKGPFLVSAPLSTIINWEREFETWAPDFYVVTYVGDKDCRIVLRDHD 199
            F+  L       GP ++  PLST+  W   FE WAPD   + Y+G++  R  +R+++
Sbjct: 274 AFISWLIFARRQNGPHIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQKSRDTIREYE 331
>pdb|1Z6A|A Chain A, Sulfolobus Solfataricus Swi2SNF2 ATPASE CORE DOMAIN Length = 500 Back     alignment and structure
>pdb|1Z63|A Chain A, Sulfolobus Solfataricus Swi2SNF2 ATPASE CORE IN COMPLEX With Dsdna Length = 500 Back     alignment and structure
>pdb|1Z3I|X Chain X, Structure Of The Swi2SNF2 CHROMATIN REMODELING DOMAIN OF EUKARYOTIC Rad54 Length = 644 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query209
3mwy_W 800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 5e-56
1z3i_X 644 Similar to RAD54-like; recombination ATPase helica 1e-40
1z63_A 500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 7e-27
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 7e-20
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Length = 800 Back     alignment and structure
 Score =  188 bits (480), Expect = 5e-56
 Identities = 50/154 (32%), Positives = 75/154 (48%), Gaps = 6/154 (3%)

Query: 55  KTKTKELQEDEDGASGSKPRRYTPPPEKPTTDLRKKYEKQPPFLDDTGMQLHAYQLEGIN 114
             + K  Q  E+     +                +K   QPPF+   G +L  +QL GIN
Sbjct: 193 PEQVKHFQNRENSKILPQYSSNYTSQRPR----FEKLSVQPPFI--KGGELRDFQLTGIN 246

Query: 115 WLRYSWGQNIDTILADEMGLGKTIQTITFLYSLFKEGHCKGPFLVSAPLSTIINWEREFE 174
           W+ + W +  + ILADEMGLGKT+QT+ F+  L       GP ++  PLST+  W   FE
Sbjct: 247 WMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIFARRQNGPHIIVVPLSTMPAWLDTFE 306

Query: 175 TWAPDFYVVTYVGDKDCRIVLRDHDISWEDTANR 208
            WAPD   + Y+G++  R  +R+++      A  
Sbjct: 307 KWAPDLNCICYMGNQKSRDTIREYEFYTNPRAKG 340
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Length = 644 Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Length = 500 Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Length = 968 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query209
3mwy_W 800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 99.89
1z63_A 500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 99.8
1z3i_X 644 Similar to RAD54-like; recombination ATPase helica 99.8
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 99.55
1wp9_A 494 ATP-dependent RNA helicase, putative; ATPase, DNA 99.5
2fwr_A 472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 99.26
3tbk_A 555 RIG-I helicase domain; DECH helicase, ATP binding, 99.22
4a2p_A 556 RIG-I, retinoic acid inducible protein I; hydrolas 99.19
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 99.17
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 99.16
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 99.12
4a2q_A 797 RIG-I, retinoic acid inducible protein I; hydrolas 99.1
4gl2_A 699 Interferon-induced helicase C domain-containing P; 99.1
1xti_A 391 Probable ATP-dependent RNA helicase P47; alpha-bet 99.1
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 99.09
2oca_A 510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 99.08
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 99.08
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 99.07
3b6e_A216 Interferon-induced helicase C domain-containing P; 99.03
3h1t_A 590 Type I site-specific restriction-modification syst 98.99
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 98.96
1s2m_A 400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 98.95
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 98.95
1fuu_A 394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 98.94
2z0m_A 337 337AA long hypothetical ATP-dependent RNA helicase 98.94
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 98.94
2j0s_A 410 ATP-dependent RNA helicase DDX48; mRNA processing, 98.92
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 98.9
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 98.9
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 98.89
1hv8_A 367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 98.84
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 98.82
3pey_A 395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 98.81
3eiq_A 414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 98.81
3bor_A237 Human initiation factor 4A-II; translation initiat 98.8
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 98.66
3oiy_A 414 Reverse gyrase helicase domain; topoisomerase, DNA 98.62
2i4i_A 417 ATP-dependent RNA helicase DDX3X; DEAD, structural 98.59
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 98.59
3fht_A 412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 98.58
2db3_A 434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 98.56
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 98.54
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 98.51
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 98.51
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 98.49
1gm5_A 780 RECG; helicase, replication restart; HET: DNA ADP; 98.41
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 98.39
3fho_A 508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 98.36
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 98.35
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 98.32
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 98.31
3fmp_B 479 ATP-dependent RNA helicase DDX19B; nuclear porin, 98.23
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA com 98.19
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 98.09
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 98.08
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 97.97
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 97.95
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 97.94
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 97.93
3crv_A 551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 97.92
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 97.84
2vl7_A 540 XPD; helicase, unknown function; 2.25A {Sulfolobus 97.72
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 97.57
4a15_A 620 XPD helicase, ATP-dependent DNA helicase TA0057; h 97.49
1c4o_A 664 DNA nucleotide excision repair enzyme UVRB; uvrabc 97.25
2d7d_A 661 Uvrabc system protein B; helicase, protein-DNA-ADP 97.08
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 96.52
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 96.38
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 96.37
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 96.37
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 96.21
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 95.67
2v6i_A 431 RNA helicase; membrane, hydrolase, transmembrane, 95.4
4b3f_X 646 DNA-binding protein smubp-2; hydrolase, helicase; 94.98
2z83_A 459 Helicase/nucleoside triphosphatase; hydrolase, mem 94.86
1yks_A 440 Genome polyprotein [contains: flavivirin protease 94.6
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 94.59
3upu_A 459 ATP-dependent DNA helicase DDA; RECA-like domain, 93.89
2wv9_A 673 Flavivirin protease NS2B regulatory subunit, FLAV 93.64
2gk6_A 624 Regulator of nonsense transcripts 1; UPF1, helicas 93.37
3jux_A 822 Protein translocase subunit SECA; protein transloc 93.01
2jlq_A 451 Serine protease subunit NS3; ribonucleoprotein, nu 92.97
3o8b_A 666 HCV NS3 protease/helicase; ntpase, RNA, translocat 92.78
2whx_A 618 Serine protease/ntpase/helicase NS3; transcription 92.56
3e1s_A 574 Exodeoxyribonuclease V, subunit RECD; alpha and be 92.04
2wjy_A 800 Regulator of nonsense transcripts 1; nonsense medi 91.88
2xzl_A 802 ATP-dependent helicase NAM7; hydrolase-RNA complex 91.83
3rc3_A 677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 91.12
3lfu_A 647 DNA helicase II; SF1 helicase, ATP-binding, DNA da 90.36
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 89.2
1w36_D 608 RECD, exodeoxyribonuclease V alpha chain; recombin 89.06
1uaa_A 673 REP helicase, protein (ATP-dependent DNA helicase 87.51
3hjh_A 483 Transcription-repair-coupling factor; MFD, mutatio 86.58
2b8t_A 223 Thymidine kinase; deoxyribonucleoside kinase, zinc 81.54
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
Probab=99.89  E-value=1.4e-23  Score=202.73  Aligned_cols=110  Identities=41%  Similarity=0.828  Sum_probs=99.2

Q ss_pred             hccCCCCccccCCCCchHHHHHHHHHHHhhcCCCceEEEcCCCCchHHHHHHHHHHHHhhCCCCCcEEEEeCcccHHHHH
Q psy14604         91 YEKQPPFLDDTGMQLHAYQLEGINWLRYSWGQNIDTILADEMGLGKTIQTITFLYSLFKEGHCKGPFLVSAPLSTIINWE  170 (209)
Q Consensus        91 ~~~~p~~~~~~~~~L~~~Q~~gv~~l~~~~~~~~g~iLaD~mGLGKT~q~ia~l~~~~~~~~~~~~~LIV~P~sl~~qW~  170 (209)
                      +..+|+++  .+..|+|||.+||+||...+..+.+|||||+||||||+|+|++|..++......+|+|||||.+++.||.
T Consensus       225 ~~~~p~~~--~~~~Lr~yQ~egv~~l~~~~~~~~~~ILademGlGKT~~ai~~i~~l~~~~~~~~~~LIV~P~sll~qW~  302 (800)
T 3mwy_W          225 LSVQPPFI--KGGELRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIFARRQNGPHIIVVPLSTMPAWL  302 (800)
T ss_dssp             CSSCCTTC--CSSCCCTHHHHHHHHHHHHHTTTCCEEECCCTTSSTTHHHHHHHHHHHHHHSCCSCEEEECCTTTHHHHH
T ss_pred             cccCCCcc--CCCCcCHHHHHHHHHHHHHhhcCCCEEEEeCCCcchHHHHHHHHHHHHHhcCCCCCEEEEECchHHHHHH
Confidence            34556655  3578999999999999999999999999999999999999999998887777778999999999999999


Q ss_pred             HHHHHhCCCceEEEEEcChhHHHHHhhhceec
Q psy14604        171 REFETWAPDFYVVTYVGDKDCRIVLRDHDISW  202 (209)
Q Consensus       171 ~E~~~~~~~l~v~~y~G~~~~r~~i~~~~~~~  202 (209)
                      +||.+|+|++++++|+|+...|..++.+++..
T Consensus       303 ~E~~~~~p~~~v~~~~g~~~~r~~~~~~~~~~  334 (800)
T 3mwy_W          303 DTFEKWAPDLNCICYMGNQKSRDTIREYEFYT  334 (800)
T ss_dssp             HHHHHHSTTCCEEECCCSSHHHHHHHHHHSCS
T ss_pred             HHHHHHCCCceEEEEeCCHHHHHHHHHHHhhc
Confidence            99999999999999999999999998877654
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3hjh_A Transcription-repair-coupling factor; MFD, mutation frequency decline, ATP-binding, DNA DAMA repair, DNA-binding, helicase, hydrolase; 1.95A {Escherichia coli} PDB: 2b2n_A* 4dfc_A Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 209
d1z3ix2 298 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fis 1e-17
d1z63a1 230 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 h 7e-17
d2fz4a1206 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Arc 0.003
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Length = 298 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Rad54-like, Rad54L
species: Zebra fish (Danio rerio) [TaxId: 7955]

 Score = 77.1 bits (188), Expect = 1e-17
 Identities = 38/148 (25%), Positives = 58/148 (39%), Gaps = 19/148 (12%)

Query: 76  YTPPPEKPTTDLRKKYEKQP------PFLDDTGMQLHAYQLEGINWL-----RYSWGQNI 124
           Y PP       ++   EK P      P L      L  +Q EG+ +L           + 
Sbjct: 24  YEPPAISAHDLIKADKEKLPVHVVVDPVL---SKVLRPHQREGVKFLWDCVTGRRIENSY 80

Query: 125 DTILADEMGLGKTIQTITFLYSLFKEGHCKGP----FLVSAPLSTIINWEREFETWAPDF 180
             I+ADEMGLGKT+Q IT +++L K+     P     +V +P S + NW  E   W    
Sbjct: 81  GCIMADEMGLGKTLQCITLIWTLLKQSPDCKPEIDKVIVVSPSSLVRNWYNEVGKWLG-G 139

Query: 181 YVVTYVGDKDCRIVLRDHDISWEDTANR 208
            V     D   +  +    +++      
Sbjct: 140 RVQPVAIDGGSKDEIDSKLVNFISQQGM 167
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Length = 230 Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 206 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query209
d1z3ix2 298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 99.91
d1z63a1 230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 99.88
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.46
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 99.19
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.12
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 98.82
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 98.53
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 98.18
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 98.16
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 97.94
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 97.85
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 97.85
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 97.82
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 97.71
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 97.65
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 97.42
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 97.38
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 97.33
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 96.85
d2bmfa2 305 Dengue virus helicase {Dengue virus type 2 [TaxId: 96.48
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 96.46
d1t5la1 413 Nucleotide excision repair enzyme UvrB {Bacillus c 96.26
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 96.22
d1c4oa1 408 Nucleotide excision repair enzyme UvrB {Thermus th 95.64
d1uaaa1 306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 94.3
d1pjra1 318 DEXX box DNA helicase {Bacillus stearothermophilus 91.72
d1w36d1 359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 91.4
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 90.68
d1tf5a3273 Translocation ATPase SecA, nucleotide-binding doma 84.31
d1nkta3288 Translocation ATPase SecA, nucleotide-binding doma 80.33
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Rad54-like, Rad54L
species: Zebra fish (Danio rerio) [TaxId: 7955]

Probab=99.91  E-value=1.6e-24  Score=184.72  Aligned_cols=94  Identities=32%  Similarity=0.461  Sum_probs=78.2

Q ss_pred             ccCCCCchHHHHHHHHHHHhhc-----CCCceEEEcCCCCchHHHHHHHHHHHHhhCCCC----CcEEEEeCcccHHHHH
Q psy14604        100 DTGMQLHAYQLEGINWLRYSWG-----QNIDTILADEMGLGKTIQTITFLYSLFKEGHCK----GPFLVSAPLSTIINWE  170 (209)
Q Consensus       100 ~~~~~L~~~Q~~gv~~l~~~~~-----~~~g~iLaD~mGLGKT~q~ia~l~~~~~~~~~~----~~~LIV~P~sl~~qW~  170 (209)
                      .+...|+|||.+||+||+.++.     .+.|||||||||||||+|+|+++..++......    .++|||||.+++.||.
T Consensus        51 ~l~~~Lr~hQ~~gv~~l~~~~~~~~~~~~~g~iLaDemGlGKT~qaia~l~~l~~~~~~~~~~~~~~LIV~P~sl~~qW~  130 (298)
T d1z3ix2          51 VLSKVLRPHQREGVKFLWDCVTGRRIENSYGCIMADEMGLGKTLQCITLIWTLLKQSPDCKPEIDKVIVVSPSSLVRNWY  130 (298)
T ss_dssp             HHHTTCCHHHHHHHHHHHHHHTTSSSTTCCEEEECCCTTSCHHHHHHHHHHHHHHCCTTSSCSCSCEEEEECHHHHHHHH
T ss_pred             hhhccccHHHHHHHHHHHHHHHhhhhccCCceEEEeCCCCCHHHHHHHHHHHHHHhcccccCCCCcEEEEccchhhHHHH
Confidence            3556899999999999987653     566899999999999999999999988765433    4699999999999999


Q ss_pred             HHHHHhCC-CceEEEEEcChhHHH
Q psy14604        171 REFETWAP-DFYVVTYVGDKDCRI  193 (209)
Q Consensus       171 ~E~~~~~~-~l~v~~y~G~~~~r~  193 (209)
                      +||.+|++ .+.++.++|....+.
T Consensus       131 ~Ei~k~~~~~~~~v~~~~~~~~~~  154 (298)
T d1z3ix2         131 NEVGKWLGGRVQPVAIDGGSKDEI  154 (298)
T ss_dssp             HHHHHHHGGGCCEEEECSSCHHHH
T ss_pred             HHHHhhcCCceeEEEEeCchHHHH
Confidence            99999986 466777777665543
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure