Psyllid ID: psy14678

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------13
ILEYISLYLQDLFKNIPDLSECGFSELYSWQREALNGKPEFILHDGPPYANGTPHIGHAVNKILKDITLRSNLLQGKRVHYVPGWDCHGLPIELKAITSKDKLLSPLDIRKKGLHLPRLEASLLVTIIQ
ccccccccccccccccHHHHHHHHHHHHHHHHHHccccccEEccccccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHcc
ccccccccccccccccHHHHHHHHHHHHHHHHHHcccccEccEEccccEccccccHHHHHHHHHHHHHHHHHHccccEcccccEEEcccHHHHHHEEEcccccccHHHHHHHHHHHHHHHHHHHHHHcc
ILEYISLYLQDLFknipdlsecgfsELYSWQREAlngkpefilhdgppyangtphiGHAVNKILKDITLRSNllqgkrvhyvpgwdchglpielkaitskdkllspldirkkglhlprLEASLLVTIIQ
ILEYISLYLQDLFKNIPDLSECGFSELYSWQREALNGKPEFILHDGPPYANGTPHIGHAVNKILKDITLRSNLLQGKRVHYVPGWDCHGLPIELKAItskdkllspldirkkglhlprleasllvtiiq
ILEYISLYLQDLFKNIPDLSECGFSELYSWQREALNGKPEFILHDGPPYANGTPHIGHAVNKILKDITLRSNLLQGKRVHYVPGWDCHGLPIELKAITSKDKLLSPLDIRKKGLHLPRLEASLLVTIIQ
**EYISLYLQDLFKNIPDLSECGFSELYSWQREALNGKPEFILHDGPPYANGTPHIGHAVNKILKDITLRSNLLQGKRVHYVPGWDCHGLPIELKAITSKDKLLSPLDIRKKGLHLPRLEASLLVTI**
ILEYISLYLQDLFKNIPDLSECGFSELYSWQREALNGKPEFILHDGPPYANGTPHIGHAVNKILKDITLRSNLLQGKRVHYVPGWDCHGLPIELKAITS**KLLSPLDIRKKGLHLPRLEASLLVTIIQ
ILEYISLYLQDLFKNIPDLSECGFSELYSWQREALNGKPEFILHDGPPYANGTPHIGHAVNKILKDITLRSNLLQGKRVHYVPGWDCHGLPIELKAITSKDKLLSPLDIRKKGLHLPRLEASLLVTIIQ
ILEYISLYLQDLFKNIPDLSECGFSELYSWQREALNGKPEFILHDGPPYANGTPHIGHAVNKILKDITLRSNLLQGKRVHYVPGWDCHGLPIELKAITSKDKLLSPLDIRKKGLHLPRLEASLLVTIIQ
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ILEYISLYLQDLFKNIPDLSECGFSELYSWQREALNGKPEFILHDGPPYANGTPHIGHAVNKILKDITLRSNLLQGKRVHYVPGWDCHGLPIELKAITSKDKLLSPLDIRKKGLHLPRLEASLLVTIIQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query129 2.2.26 [Sep-21-2011]
Q5ZKA2 1000 Isoleucine--tRNA ligase, yes N/A 0.697 0.09 0.655 5e-32
Q9NSE4 1012 Isoleucine--tRNA ligase, yes N/A 0.868 0.110 0.528 4e-31
Q8BIJ6 1012 Isoleucine--tRNA ligase, yes N/A 0.713 0.090 0.614 6e-31
Q4R646 993 Isoleucine--tRNA ligase, N/A N/A 0.713 0.092 0.614 9e-31
Q9USL3 973 Isoleucine--tRNA ligase, yes N/A 0.674 0.089 0.643 2e-27
Q7NF75 983 Isoleucine--tRNA ligase O yes N/A 0.651 0.085 0.547 3e-25
Q8YXY3 960 Isoleucine--tRNA ligase O yes N/A 0.565 0.076 0.649 4e-25
Q7U9G9 974 Isoleucine--tRNA ligase O yes N/A 0.643 0.085 0.574 4e-25
B0JSP4 952 Isoleucine--tRNA ligase O yes N/A 0.651 0.088 0.568 7e-25
Q0I1V8 937 Isoleucine--tRNA ligase O yes N/A 0.658 0.090 0.627 9e-25
>sp|Q5ZKA2|SYIM_CHICK Isoleucine--tRNA ligase, mitochondrial OS=Gallus gallus GN=IARS2 PE=2 SV=1 Back     alignment and function desciption
 Score =  136 bits (342), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 61/93 (65%), Positives = 75/93 (80%), Gaps = 3/93 (3%)

Query: 23  GFSELYSWQREALNGKPEFILHDGPPYANGTPHIGHAVNKILKDITLRSNLLQGKRVHYV 82
           GF ELYSWQR+    K EF LHDGPPYANG PH+GHA+NKILKDIT R ++++G +VHYV
Sbjct: 78  GFLELYSWQRQR-KAKQEFCLHDGPPYANGDPHVGHALNKILKDITNRFHMMRGYKVHYV 136

Query: 83  PGWDCHGLPIELKAITSKD--KLLSPLDIRKKG 113
           PGWDCHGLPIELKA++     + LSP++IR+K 
Sbjct: 137 PGWDCHGLPIELKALSEVKGAENLSPVEIRQKA 169

Gallus gallus (taxid: 9031)
EC: 6EC: .EC: 1EC: .EC: 1EC: .EC: 5
>sp|Q9NSE4|SYIM_HUMAN Isoleucine--tRNA ligase, mitochondrial OS=Homo sapiens GN=IARS2 PE=1 SV=2 Back     alignment and function description
>sp|Q8BIJ6|SYIM_MOUSE Isoleucine--tRNA ligase, mitochondrial OS=Mus musculus GN=Iars2 PE=2 SV=1 Back     alignment and function description
>sp|Q4R646|SYIM_MACFA Isoleucine--tRNA ligase, mitochondrial (Fragment) OS=Macaca fascicularis GN=IARS2 PE=2 SV=2 Back     alignment and function description
>sp|Q9USL3|SYIM_SCHPO Isoleucine--tRNA ligase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ism1 PE=3 SV=1 Back     alignment and function description
>sp|Q7NF75|SYI_GLOVI Isoleucine--tRNA ligase OS=Gloeobacter violaceus (strain PCC 7421) GN=ileS PE=3 SV=1 Back     alignment and function description
>sp|Q8YXY3|SYI_NOSS1 Isoleucine--tRNA ligase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=ileS PE=3 SV=1 Back     alignment and function description
>sp|Q7U9G9|SYI_SYNPX Isoleucine--tRNA ligase OS=Synechococcus sp. (strain WH8102) GN=ileS PE=3 SV=1 Back     alignment and function description
>sp|B0JSP4|SYI_MICAN Isoleucine--tRNA ligase OS=Microcystis aeruginosa (strain NIES-843) GN=ileS PE=3 SV=1 Back     alignment and function description
>sp|Q0I1V8|SYI_HAES1 Isoleucine--tRNA ligase OS=Haemophilus somnus (strain 129Pt) GN=ileS PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query129
193788707 960 mitochondrial isoleucine tRNA synthetase 0.744 0.1 0.623 1e-33
350416933 963 PREDICTED: isoleucyl-tRNA synthetase, mi 0.713 0.095 0.666 8e-33
307191176 934 Isoleucyl-tRNA synthetase, mitochondrial 0.720 0.099 0.673 9e-33
307205447 954 Isoleucyl-tRNA synthetase, mitochondrial 0.720 0.097 0.673 1e-32
340725121 963 PREDICTED: isoleucyl-tRNA synthetase, mi 0.713 0.095 0.655 2e-32
345329562 1007 PREDICTED: isoleucyl-tRNA synthetase, mi 0.720 0.092 0.649 3e-32
328793797 964 PREDICTED: isoleucyl-tRNA synthetase, mi 0.697 0.093 0.688 4e-32
332020768 933 Isoleucyl-tRNA synthetase, mitochondrial 0.720 0.099 0.673 4e-32
449270246 926 Isoleucyl-tRNA synthetase, mitochondrial 0.713 0.099 0.663 1e-31
449496224 994 PREDICTED: LOW QUALITY PROTEIN: isoleuci 0.713 0.092 0.652 1e-31
>gi|193788707|ref|NP_001123293.1| mitochondrial isoleucine tRNA synthetase [Nasonia vitripennis] Back     alignment and taxonomy information
 Score =  147 bits (371), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 68/109 (62%), Positives = 84/109 (77%), Gaps = 13/109 (11%)

Query: 8   YLQDLFKNIPDLSECGFSELYSWQREALNGKPEFILHDGPPYANGTPHIGHAVNKILKDI 67
           YLQD         +CGFSELY+WQR  L G P+F+LHDGPPYANG PH+GH +NK+LKDI
Sbjct: 65  YLQD---------KCGFSELYNWQRANLEG-PDFVLHDGPPYANGDPHMGHTINKVLKDI 114

Query: 68  TLRSNLLQGKRVHYVPGWDCHGLPIELKAITSKDKL---LSPLDIRKKG 113
           T+RS +++G+RVHYVPGWDCHGLPIELKA+TS  K    L+P+ IR + 
Sbjct: 115 TIRSKVIKGQRVHYVPGWDCHGLPIELKALTSAKKRVSELTPMQIRAQA 163

Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|350416933|ref|XP_003491175.1| PREDICTED: isoleucyl-tRNA synthetase, mitochondrial-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|307191176|gb|EFN74873.1| Isoleucyl-tRNA synthetase, mitochondrial [Camponotus floridanus] Back     alignment and taxonomy information
>gi|307205447|gb|EFN83779.1| Isoleucyl-tRNA synthetase, mitochondrial [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|340725121|ref|XP_003400922.1| PREDICTED: isoleucyl-tRNA synthetase, mitochondrial-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|345329562|ref|XP_001511676.2| PREDICTED: isoleucyl-tRNA synthetase, mitochondrial-like [Ornithorhynchus anatinus] Back     alignment and taxonomy information
>gi|328793797|ref|XP_001122215.2| PREDICTED: isoleucyl-tRNA synthetase, mitochondrial-like [Apis mellifera] Back     alignment and taxonomy information
>gi|332020768|gb|EGI61172.1| Isoleucyl-tRNA synthetase, mitochondrial [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|449270246|gb|EMC80942.1| Isoleucyl-tRNA synthetase, mitochondrial, partial [Columba livia] Back     alignment and taxonomy information
>gi|449496224|ref|XP_004175169.1| PREDICTED: LOW QUALITY PROTEIN: isoleucine--tRNA ligase, mitochondrial [Taeniopygia guttata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query129
UNIPROTKB|F1S9K1 731 LOC100739845 "Uncharacterized 0.705 0.124 0.621 1.5e-29
UNIPROTKB|F1Q1M2 940 IARS2 "Uncharacterized protein 0.705 0.096 0.642 2.1e-29
UNIPROTKB|F1P399 1000 IARS2 "Isoleucine--tRNA ligase 0.689 0.089 0.663 4.9e-29
UNIPROTKB|Q5ZKA2 1000 IARS2 "Isoleucine--tRNA ligase 0.689 0.089 0.663 4.9e-29
UNIPROTKB|F1P2C8 1011 IARS2 "Isoleucine--tRNA ligase 0.689 0.088 0.663 5e-29
UNIPROTKB|F6SBX2 940 IARS2 "Isoleucine--tRNA ligase 0.705 0.096 0.621 7.1e-29
UNIPROTKB|Q9NSE4 1012 IARS2 "Isoleucine--tRNA ligase 0.705 0.089 0.621 8.2e-29
RGD|1311857 951 Iars2 "isoleucyl-tRNA syntheta 0.705 0.095 0.621 1.5e-28
ZFIN|ZDB-GENE-030616-608 983 iars2 "isoleucine-tRNA synthet 0.705 0.092 0.634 1.6e-28
MGI|MGI:1919586 1012 Iars2 "isoleucine-tRNA synthet 0.705 0.089 0.621 3.6e-28
UNIPROTKB|F1S9K1 LOC100739845 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
 Score = 336 (123.3 bits), Expect = 1.5e-29, P = 1.5e-29
 Identities = 59/95 (62%), Positives = 76/95 (80%)

Query:    21 ECGFSELYSWQREALNGKPEFILHDGPPYANGTPHIGHAVNKILKDITLRSNLLQGKRVH 80
             +CGFSELYSWQRE    K EF LHDGPPYANG PH+GHA+NKILKDI  R ++++G ++H
Sbjct:    90 KCGFSELYSWQRER-KAKTEFCLHDGPPYANGDPHVGHALNKILKDIANRYHMMRGSKIH 148

Query:    81 YVPGWDCHGLPIELKAITS---KDKLLSPLDIRKK 112
             +VPGWDCHGLPIE+K ++    K + LS ++IR+K
Sbjct:   149 FVPGWDCHGLPIEIKVLSELGGKAQNLSAMEIREK 183
GO:0005524 "ATP binding" evidence=IEA
GO:0006428 "isoleucyl-tRNA aminoacylation" evidence=IEA
GO:0005737 "cytoplasm" evidence=IEA
GO:0004822 "isoleucine-tRNA ligase activity" evidence=IEA
GO:0002161 "aminoacyl-tRNA editing activity" evidence=IEA
UNIPROTKB|F1Q1M2 IARS2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1P399 IARS2 "Isoleucine--tRNA ligase, mitochondrial" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZKA2 IARS2 "Isoleucine--tRNA ligase, mitochondrial" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1P2C8 IARS2 "Isoleucine--tRNA ligase, mitochondrial" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F6SBX2 IARS2 "Isoleucine--tRNA ligase, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9NSE4 IARS2 "Isoleucine--tRNA ligase, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1311857 Iars2 "isoleucyl-tRNA synthetase 2, mitochondrial" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030616-608 iars2 "isoleucine-tRNA synthetase 2, mitochondrial" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:1919586 Iars2 "isoleucine-tRNA synthetase 2, mitochondrial" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q7MNM8SYI_VIBVY6, ., 1, ., 1, ., 50.50940.79060.1075yesN/A
Q5NQQ7SYI_ZYMMO6, ., 1, ., 1, ., 50.68570.54260.0743yesN/A
A5UDA6SYI_HAEIE6, ., 1, ., 1, ., 50.51880.79060.1083yesN/A
Q9CKF7SYI_PASMU6, ., 1, ., 1, ., 50.60460.65890.0912yesN/A
A3MYB6SYI_ACTP26, ., 1, ., 1, ., 50.61620.65890.0906yesN/A
Q7W8Z2SYI_BORPA6, ., 1, ., 1, ., 50.50890.75190.1017yesN/A
B0UV12SYI_HAES26, ., 1, ., 1, ., 50.62790.65890.0907yesN/A
Q8BIJ6SYIM_MOUSE6, ., 1, ., 1, ., 50.61450.71310.0909yesN/A
C6DF04SYI_PECCP6, ., 1, ., 1, ., 50.61620.65890.0907yesN/A
B3GZN4SYI_ACTP76, ., 1, ., 1, ., 50.61620.65890.0906yesN/A
B1JKZ8SYI_YERPY6, ., 1, ., 1, ., 50.59300.65890.0906yesN/A
Q5ZKA2SYIM_CHICK6, ., 1, ., 1, ., 50.65590.69760.09yesN/A
Q7WKD5SYI_BORBR6, ., 1, ., 1, ., 50.50890.75190.1017yesN/A
Q7VXK3SYI_BORPE6, ., 1, ., 1, ., 50.50890.75190.1017yesN/A
Q747X9SYI_GEOSL6, ., 1, ., 1, ., 50.53330.73640.1029yesN/A
Q8DES7SYI_VIBVU6, ., 1, ., 1, ., 50.50940.79060.1075yesN/A
Q66ES4SYI_YERPS6, ., 1, ., 1, ., 50.59300.65890.0906yesN/A
A4XQV5SYI_PSEMY6, ., 1, ., 1, ., 50.60460.65890.0901yesN/A
A4TQF3SYI_YERPP6, ., 1, ., 1, ., 50.59300.65890.0906yesN/A
A1K4R7SYI_AZOSB6, ., 1, ., 1, ., 50.56970.66660.0922yesN/A
B0JSP4SYI_MICAN6, ., 1, ., 1, ., 50.56840.65110.0882yesN/A
B4F2T5SYI_PROMH6, ., 1, ., 1, ., 50.60460.65890.0908yesN/A
Q21HK3SYI_SACD26, ., 1, ., 1, ., 50.68110.53480.0740yesN/A
Q4QLU5SYI_HAEI86, ., 1, ., 1, ., 50.51880.79060.1083yesN/A
A9R008SYI_YERPG6, ., 1, ., 1, ., 50.59300.65890.0906yesN/A
Q889E4SYI_PSESM6, ., 1, ., 1, ., 50.64550.61240.0837yesN/A
Q7U9G9SYI_SYNPX6, ., 1, ., 1, ., 50.57470.64340.0852yesN/A
Q7N8X2SYI_PHOLL6, ., 1, ., 1, ., 50.59300.65890.0907yesN/A
B2IZP5SYI_NOSP76, ., 1, ., 1, ., 50.62330.56580.0761yesN/A
Q7NF75SYI_GLOVI6, ., 1, ., 1, ., 50.54730.65110.0854yesN/A
Q3J8W1SYI_NITOC6, ., 1, ., 1, ., 50.69560.53480.0734yesN/A
Q8ZIM0SYI_YERPE6, ., 1, ., 1, ., 50.59300.65890.0906yesN/A
A5UIA3SYI_HAEIG6, ., 1, ., 1, ., 50.51880.79060.1083yesN/A
A0KG39SYI_AERHH6, ., 1, ., 1, ., 50.61620.65890.0891yesN/A
C5B7M4SYI_EDWI96, ., 1, ., 1, ., 50.59300.65890.0896yesN/A
Q6D0C3SYI_ERWCT6, ., 1, ., 1, ., 50.61620.65890.0907yesN/A
Q1CMV1SYI_YERPN6, ., 1, ., 1, ., 50.59300.65890.0906yesN/A
Q8YXY3SYI_NOSS16, ., 1, ., 1, ., 50.64930.56580.0760yesN/A
Q0I1V8SYI_HAES16, ., 1, ., 1, ., 50.62790.65890.0907yesN/A
Q3SHS3SYI_THIDA6, ., 1, ., 1, ., 50.56040.64340.0893yesN/A
Q9NSE4SYIM_HUMAN6, ., 1, ., 1, ., 50.52890.86820.1106yesN/A
A4SIX5SYI_AERS46, ., 1, ., 1, ., 50.60460.65890.0891yesN/A
Q0VSE1SYI_ALCBS6, ., 1, ., 1, ., 50.65780.58910.0811yesN/A
Q9USL3SYIM_SCHPO6, ., 1, ., 1, ., 50.64360.67440.0894yesN/A
Q5P221SYI_AROAE6, ., 1, ., 1, ., 50.60710.64340.0883yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query129
PRK05743 912 PRK05743, ileS, isoleucyl-tRNA synthetase; Reviewe 2e-43
COG0060 933 COG0060, IleS, Isoleucyl-tRNA synthetase [Translat 1e-40
PLN02843 974 PLN02843, PLN02843, isoleucyl-tRNA synthetase 1e-38
cd00818 338 cd00818, IleRS_core, catalytic core domain of isol 1e-37
TIGR00392 861 TIGR00392, ileS, isoleucyl-tRNA synthetase 3e-35
PRK13804 961 PRK13804, ileS, isoleucyl-tRNA synthetase; Provisi 5e-35
pfam00133 606 pfam00133, tRNA-synt_1, tRNA synthetases class I ( 6e-30
PRK06039 975 PRK06039, ileS, isoleucyl-tRNA synthetase; Reviewe 1e-28
cd00668 312 cd00668, Ile_Leu_Val_MetRS_core, catalytic core do 2e-20
PLN02882 1159 PLN02882, PLN02882, aminoacyl-tRNA ligase 8e-18
PTZ00427 1205 PTZ00427, PTZ00427, isoleucine-tRNA ligase, putati 8e-15
cd00814 319 cd00814, MetRS_core, catalytic core domain of meth 5e-14
COG0143 558 COG0143, MetG, Methionyl-tRNA synthetase [Translat 4e-13
TIGR00422 861 TIGR00422, valS, valyl-tRNA synthetase 4e-13
pfam09334 388 pfam09334, tRNA-synt_1g, tRNA synthetases class I 6e-13
TIGR00398 530 TIGR00398, metG, methionyl-tRNA synthetase 8e-13
PRK00133 673 PRK00133, metG, methionyl-tRNA synthetase; Reviewe 2e-12
COG0525 877 COG0525, ValS, Valyl-tRNA synthetase [Translation, 3e-12
PRK13208 800 PRK13208, valS, valyl-tRNA synthetase; Reviewed 4e-12
cd00817 382 cd00817, ValRS_core, catalytic core domain of valy 1e-11
PRK12268 556 PRK12268, PRK12268, methionyl-tRNA synthetase; Rev 2e-11
cd00812 314 cd00812, LeuRS_core, catalytic core domain of leuc 2e-08
COG0495 814 COG0495, LeuS, Leucyl-tRNA synthetase [Translation 5e-08
PRK12267 648 PRK12267, PRK12267, methionyl-tRNA synthetase; Rev 6e-08
TIGR00396 842 TIGR00396, leuS_bact, leucyl-tRNA synthetase, euba 2e-06
PRK11893 511 PRK11893, PRK11893, methionyl-tRNA synthetase; Rev 2e-06
PLN02943 958 PLN02943, PLN02943, aminoacyl-tRNA ligase 5e-05
PLN02563 963 PLN02563, PLN02563, aminoacyl-tRNA ligase 7e-05
PRK14900 1052 PRK14900, valS, valyl-tRNA synthetase; Provisional 1e-04
TIGR00395 938 TIGR00395, leuS_arch, leucyl-tRNA synthetase, arch 1e-04
PLN02381 1066 PLN02381, PLN02381, valyl-tRNA synthetase 2e-04
PLN02224 616 PLN02224, PLN02224, methionine-tRNA ligase 4e-04
PTZ00419 995 PTZ00419, PTZ00419, valyl-tRNA synthetase-like pro 0.002
>gnl|CDD|235588 PRK05743, ileS, isoleucyl-tRNA synthetase; Reviewed Back     alignment and domain information 
 Score =  151 bits (383), Expect = 2e-43
 Identities = 56/89 (62%), Positives = 63/89 (70%), Gaps = 3/89 (3%)

Query: 27  LYSWQREALNGKPEFILHDGPPYANGTPHIGHAVNKILKDITLRSNLLQGKRVHYVPGWD 86
           LY   REA  GKP+FILHDGPPYANG  HIGHA+NKILKDI ++S  + G    YVPGWD
Sbjct: 37  LYQKIREANKGKPKFILHDGPPYANGDIHIGHALNKILKDIIVKSKTMSGFDAPYVPGWD 96

Query: 87  CHGLPIEL---KAITSKDKLLSPLDIRKK 112
           CHGLPIEL   K +  K K LS  + RKK
Sbjct: 97  CHGLPIELKVEKKLGKKGKKLSAAEFRKK 125

Length = 912
>gnl|CDD|223138 COG0060, IleS, Isoleucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|215452 PLN02843, PLN02843, isoleucyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|173909 cd00818, IleRS_core, catalytic core domain of isoleucyl-tRNA synthetases Back     alignment and domain information
>gnl|CDD|232953 TIGR00392, ileS, isoleucyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|237514 PRK13804, ileS, isoleucyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|215739 pfam00133, tRNA-synt_1, tRNA synthetases class I (I, L, M and V) Back     alignment and domain information
>gnl|CDD|235681 PRK06039, ileS, isoleucyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|185674 cd00668, Ile_Leu_Val_MetRS_core, catalytic core domain of isoleucyl, leucyl, valyl and methioninyl tRNA synthetases Back     alignment and domain information
>gnl|CDD|215477 PLN02882, PLN02882, aminoacyl-tRNA ligase Back     alignment and domain information
>gnl|CDD|173617 PTZ00427, PTZ00427, isoleucine-tRNA ligase, putative; Provisional Back     alignment and domain information
>gnl|CDD|173907 cd00814, MetRS_core, catalytic core domain of methioninyl-tRNA synthetases Back     alignment and domain information
>gnl|CDD|223221 COG0143, MetG, Methionyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|232969 TIGR00422, valS, valyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|220185 pfam09334, tRNA-synt_1g, tRNA synthetases class I (M) Back     alignment and domain information
>gnl|CDD|232957 TIGR00398, metG, methionyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|234655 PRK00133, metG, methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|223599 COG0525, ValS, Valyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|237306 PRK13208, valS, valyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|185677 cd00817, ValRS_core, catalytic core domain of valyl-tRNA synthetases Back     alignment and domain information
>gnl|CDD|237029 PRK12268, PRK12268, methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|173906 cd00812, LeuRS_core, catalytic core domain of leucyl-tRNA synthetases Back     alignment and domain information
>gnl|CDD|223569 COG0495, LeuS, Leucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|237028 PRK12267, PRK12267, methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|232956 TIGR00396, leuS_bact, leucyl-tRNA synthetase, eubacterial and mitochondrial family Back     alignment and domain information
>gnl|CDD|237012 PRK11893, PRK11893, methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|215509 PLN02943, PLN02943, aminoacyl-tRNA ligase Back     alignment and domain information
>gnl|CDD|178177 PLN02563, PLN02563, aminoacyl-tRNA ligase Back     alignment and domain information
>gnl|CDD|237855 PRK14900, valS, valyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|232955 TIGR00395, leuS_arch, leucyl-tRNA synthetase, archaeal and cytosolic family Back     alignment and domain information
>gnl|CDD|215214 PLN02381, PLN02381, valyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|177869 PLN02224, PLN02224, methionine-tRNA ligase Back     alignment and domain information
>gnl|CDD|240411 PTZ00419, PTZ00419, valyl-tRNA synthetase-like protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 129
TIGR00396 842 leuS_bact leucyl-tRNA synthetase, eubacterial and 99.94
COG0143 558 MetG Methionyl-tRNA synthetase [Translation, ribos 99.93
PRK00390 805 leuS leucyl-tRNA synthetase; Validated 99.93
TIGR00422 861 valS valyl-tRNA synthetase. The valyl-tRNA synthet 99.92
PRK13208 800 valS valyl-tRNA synthetase; Reviewed 99.92
cd00814 319 MetRS_core catalytic core domain of methioninyl-tR 99.92
PF09334 391 tRNA-synt_1g: tRNA synthetases class I (M); InterP 99.92
PRK05743 912 ileS isoleucyl-tRNA synthetase; Reviewed 99.92
PLN02224 616 methionine-tRNA ligase 99.92
COG0495 814 LeuS Leucyl-tRNA synthetase [Translation, ribosoma 99.92
PLN02563 963 aminoacyl-tRNA ligase 99.92
TIGR00392 861 ileS isoleucyl-tRNA synthetase. The isoleucyl tRNA 99.91
PRK13804 961 ileS isoleucyl-tRNA synthetase; Provisional 99.91
cd00817 382 ValRS_core catalytic core domain of valyl-tRNA syn 99.91
PLN02843 974 isoleucyl-tRNA synthetase 99.91
cd00668 312 Ile_Leu_Val_MetRS_core catalytic core domain of is 99.91
PRK12268 556 methionyl-tRNA synthetase; Reviewed 99.91
PLN02381 1066 valyl-tRNA synthetase 99.91
PRK06039 975 ileS isoleucyl-tRNA synthetase; Reviewed 99.91
PF00133 601 tRNA-synt_1: tRNA synthetases class I (I, L, M and 99.91
PLN02943 958 aminoacyl-tRNA ligase 99.91
PRK05729 874 valS valyl-tRNA synthetase; Reviewed 99.91
cd00812 314 LeuRS_core catalytic core domain of leucyl-tRNA sy 99.91
PTZ00427 1205 isoleucine-tRNA ligase, putative; Provisional 99.91
cd00818 338 IleRS_core catalytic core domain of isoleucyl-tRNA 99.91
PRK00133 673 metG methionyl-tRNA synthetase; Reviewed 99.91
PLN02610 801 probable methionyl-tRNA synthetase 99.9
PRK12267 648 methionyl-tRNA synthetase; Reviewed 99.9
PRK14900 1052 valS valyl-tRNA synthetase; Provisional 99.9
PLN02882 1159 aminoacyl-tRNA ligase 99.9
PRK11893 511 methionyl-tRNA synthetase; Reviewed 99.9
cd00672 213 CysRS_core catalytic core domain of cysteinyl tRNA 99.9
TIGR00395 938 leuS_arch leucyl-tRNA synthetase, archaeal and cyt 99.9
TIGR00398 530 metG methionyl-tRNA synthetase. The methionyl-tRNA 99.9
PTZ00419 995 valyl-tRNA synthetase-like protein; Provisional 99.89
PLN02959 1084 aminoacyl-tRNA ligase 99.89
COG0525 877 ValS Valyl-tRNA synthetase [Translation, ribosomal 99.89
COG0060 933 IleS Isoleucyl-tRNA synthetase [Translation, ribos 99.89
TIGR03447 411 mycothiol_MshC cysteine--1-D-myo-inosityl 2-amino- 99.83
KOG0435|consensus 876 99.82
PRK12418 384 cysteinyl-tRNA synthetase; Provisional 99.82
TIGR00435 465 cysS cysteinyl-tRNA synthetase. This model finds t 99.81
PRK00260 463 cysS cysteinyl-tRNA synthetase; Validated 99.81
KOG0432|consensus 995 99.8
KOG0436|consensus 578 99.8
PTZ00399 651 cysteinyl-tRNA-synthetase; Provisional 99.79
cd00671 212 ArgRS_core catalytic core domain of arginyl-tRNA s 99.79
PLN02946 557 cysteine-tRNA ligase 99.78
PRK14535 699 cysS cysteinyl-tRNA synthetase; Provisional 99.76
PRK01611 507 argS arginyl-tRNA synthetase; Reviewed 99.75
PRK14536 490 cysS cysteinyl-tRNA synthetase; Provisional 99.73
cd00802143 class_I_aaRS_core catalytic core domain of class I 99.73
PRK14534 481 cysS cysteinyl-tRNA synthetase; Provisional 99.7
PF01406 300 tRNA-synt_1e: tRNA synthetases class I (C) catalyt 99.7
cd00674 353 LysRS_core_class_I catalytic core domain of class 99.67
COG0215 464 CysS Cysteinyl-tRNA synthetase [Translation, ribos 99.67
PRK12300 897 leuS leucyl-tRNA synthetase; Reviewed 99.56
KOG0434|consensus 1070 99.55
KOG0433|consensus 937 99.52
KOG0437|consensus 1080 99.43
PRK00750 510 lysK lysyl-tRNA synthetase; Reviewed 99.41
KOG2007|consensus 586 99.37
KOG1247|consensus 567 99.3
TIGR00467 515 lysS_arch lysyl-tRNA synthetase, archaeal and spir 99.24
TIGR00456 566 argS arginyl-tRNA synthetase. This model recognize 99.14
COG0018 577 ArgS Arginyl-tRNA synthetase [Translation, ribosom 99.12
PF00750 354 tRNA-synt_1d: tRNA synthetases class I (R); InterP 99.07
PRK12451 562 arginyl-tRNA synthetase; Reviewed 99.0
PLN02286 576 arginine-tRNA ligase 98.94
cd09287 240 GluRS_non_core catalytic core domain of non-discri 98.21
PRK04156 567 gltX glutamyl-tRNA synthetase; Provisional 97.88
KOG1195|consensus 567 97.66
TIGR00463 560 gltX_arch glutamyl-tRNA synthetase, archaeal and e 97.4
PF01921 360 tRNA-synt_1f: tRNA synthetases class I (K); InterP 97.28
COG1384 521 LysS Lysyl-tRNA synthetase (class I) [Translation, 97.07
KOG4426|consensus 656 97.01
PLN02486 383 aminoacyl-tRNA ligase 96.99
PRK12285 368 tryptophanyl-tRNA synthetase; Reviewed 96.82
TIGR03838 272 queuosine_YadB glutamyl-queuosine tRNA(Asp) synthe 96.54
cd00418 230 GlxRS_core catalytic core domain of glutamyl-tRNA 96.49
PF00749 314 tRNA-synt_1c: tRNA synthetases class I (E and Q), 96.46
cd00805 269 TyrRS_core catalytic core domain of tyrosinyl-tRNA 96.43
PLN03233 523 putative glutamate-tRNA ligase; Provisional 96.34
cd00808 239 GluRS_core catalytic core domain of discriminating 96.31
cd00807 238 GlnRS_core catalytic core domain of glutaminyl-tRN 96.31
COG0008 472 GlnS Glutamyl- and glutaminyl-tRNA synthetases [Tr 96.28
PTZ00402 601 glutamyl-tRNA synthetase; Provisional 96.21
TIGR00440 522 glnS glutaminyl-tRNA synthetase. This protein is a 96.16
PRK05347 554 glutaminyl-tRNA synthetase; Provisional 96.16
PLN02907 722 glutamate-tRNA ligase 96.13
PRK13354 410 tyrosyl-tRNA synthetase; Provisional 96.08
PRK05710 299 glutamyl-Q tRNA(Asp) synthetase; Reviewed 96.04
PTZ00437 574 glutaminyl-tRNA synthetase; Provisional 95.96
cd00395 273 Tyr_Trp_RS_core catalytic core domain of tyrosinyl 95.87
PRK12410 433 glutamylglutaminyl-tRNA synthetase; Provisional 95.7
TIGR00464 470 gltX_bact glutamyl-tRNA synthetase, bacterial fami 95.69
PLN02859 788 glutamine-tRNA ligase 95.58
PRK12558 445 glutamyl-tRNA synthetase; Provisional 95.53
PRK14895 513 gltX glutamyl-tRNA synthetase; Provisional 95.46
PRK14703 771 glutaminyl-tRNA synthetase/YqeY domain fusion prot 95.41
PRK01406 476 gltX glutamyl-tRNA synthetase; Reviewed 95.38
cd00806 280 TrpRS_core catalytic core domain of tryptophanyl-t 95.3
PRK08560 329 tyrosyl-tRNA synthetase; Validated 95.22
PLN02627 535 glutamyl-tRNA synthetase 95.01
PTZ00126 383 tyrosyl-tRNA synthetase; Provisional 94.78
TIGR00234 377 tyrS tyrosyl-tRNA synthetase. This tyrosyl-tRNA sy 94.25
PRK05912 408 tyrosyl-tRNA synthetase; Validated 94.23
PRK00927 333 tryptophanyl-tRNA synthetase; Reviewed 94.14
TIGR00233 328 trpS tryptophanyl-tRNA synthetase. This model repr 93.83
PRK12284 431 tryptophanyl-tRNA synthetase; Reviewed 93.62
PLN02886 389 aminoacyl-tRNA ligase 93.12
COG0162 401 TyrS Tyrosyl-tRNA synthetase [Translation, ribosom 92.94
COG0180 314 TrpS Tryptophanyl-tRNA synthetase [Translation, ri 92.31
PRK12556 332 tryptophanyl-tRNA synthetase; Provisional 92.13
PRK12282 333 tryptophanyl-tRNA synthetase II; Reviewed 91.78
PRK12283 398 tryptophanyl-tRNA synthetase; Reviewed 91.03
PF00579 292 tRNA-synt_1b: tRNA synthetases class I (W and Y); 90.86
KOG1147|consensus 712 89.51
KOG1148|consensus 764 88.96
KOG2145|consensus 397 88.71
PTZ00348 682 tyrosyl-tRNA synthetase; Provisional 87.22
>TIGR00396 leuS_bact leucyl-tRNA synthetase, eubacterial and mitochondrial family Back     alignment and domain information 
Probab=99.94  E-value=4.1e-26  Score=205.46  Aligned_cols=111  Identities=25%  Similarity=0.334  Sum_probs=101.5

Q ss_pred             HHHHHHHHHHHhcCCCccccchhhhHHHHHHhcCCCCcEEEEcCCCCCCCcCCchHHHHHHHHHHHHHHHHhcCCceEEe
Q psy14678          3 EYISLYLQDLFKNIPDLSECGFSELYSWQREALNGKPEFILHDGPPYANGTPHIGHAVNKILKDITLRSNLLQGKRVHYV   82 (129)
Q Consensus         3 ~~~~~~~~~~~~~~~~~~~~~~~~~~~w~~~~~~~~~~~~i~~~~P~vng~lHiGH~~~~v~~D~~~R~~~~~G~~V~~~   82 (129)
                      ..++.-||+.|++...|....           ..++++|+++++||||||.|||||+++++++|+++||+||+|++|+|+
T Consensus         4 ~~iE~kwq~~W~~~~~f~~~~-----------~~~k~k~~v~~~pPy~nG~lHiGH~~~~~~~Dvi~Ry~rm~G~~V~~~   72 (842)
T TIGR00396         4 IEIEEKWQQKWKENKVFKFTD-----------DSNKPKYYILDMFPYPSGALHMGHVRNYTITDVLSRYYRMKGYNVLHP   72 (842)
T ss_pred             HHHHHHHHHHHHhcCCcccCC-----------CCCCCCEEEEcCCCCCCCccccchhHHHHHHHHHHHHHHhcCCceecc
Confidence            457888999999998887543           235677999999999999999999999999999999999999999999


Q ss_pred             CCCCcCCchHHHHHHHhcCCCCCHHHHH-HHHHHHHHHhhccCCcc
Q psy14678         83 PGWDCHGLPIELKAITSKDKLLSPLDIR-KKGLHLPRLEASLLVTI  127 (129)
Q Consensus        83 ~G~D~~G~ki~~~a~k~l~~~~~p~e~~-~~~~~~~~~~~~L~i~~  127 (129)
                      +|||+||+|++.+|+++   |.+|.+++ +++..+++.+++||++.
T Consensus        73 ~G~D~~Glpie~~a~~~---g~~p~~~~~~~~~~~~~~~~~lG~~~  115 (842)
T TIGR00396        73 MGWDAFGLPAENAAIKR---GIHPAKWTYENIANMKKQLQALGFSY  115 (842)
T ss_pred             CCcCCCChHHHHHHHHc---CCCHHHHHHHHHHHHHHHHHHhCCcc
Confidence            99999999999999998   99999997 78999999999999985

The leucyl-tRNA synthetases belong to two families so broadly different that they are represented by separate models. This model includes both eubacterial and mitochondrial leucyl-tRNA synthetases. It generates higher scores for some valyl-tRNA synthetases than for any archaeal or eukaryotic cytosolic leucyl-tRNA synthetase. Note that the enzyme from Aquifex aeolicus is split into alpha and beta chains; neither chain is long enough to score above the trusted cutoff, but the alpha chain scores well above the noise cutoff. The beta chain must be found by a model and search designed for partial length matches.
>COG0143 MetG Methionyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK00390 leuS leucyl-tRNA synthetase; Validated Back     alignment and domain information
>TIGR00422 valS valyl-tRNA synthetase Back     alignment and domain information
>PRK13208 valS valyl-tRNA synthetase; Reviewed Back     alignment and domain information
>cd00814 MetRS_core catalytic core domain of methioninyl-tRNA synthetases Back     alignment and domain information
>PF09334 tRNA-synt_1g: tRNA synthetases class I (M); InterPro: IPR015413 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PRK05743 ileS isoleucyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PLN02224 methionine-tRNA ligase Back     alignment and domain information
>COG0495 LeuS Leucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02563 aminoacyl-tRNA ligase Back     alignment and domain information
>TIGR00392 ileS isoleucyl-tRNA synthetase Back     alignment and domain information
>PRK13804 ileS isoleucyl-tRNA synthetase; Provisional Back     alignment and domain information
>cd00817 ValRS_core catalytic core domain of valyl-tRNA synthetases Back     alignment and domain information
>PLN02843 isoleucyl-tRNA synthetase Back     alignment and domain information
>cd00668 Ile_Leu_Val_MetRS_core catalytic core domain of isoleucyl, leucyl, valyl and methioninyl tRNA synthetases Back     alignment and domain information
>PRK12268 methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PLN02381 valyl-tRNA synthetase Back     alignment and domain information
>PRK06039 ileS isoleucyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PF00133 tRNA-synt_1: tRNA synthetases class I (I, L, M and V); InterPro: IPR002300 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PLN02943 aminoacyl-tRNA ligase Back     alignment and domain information
>PRK05729 valS valyl-tRNA synthetase; Reviewed Back     alignment and domain information
>cd00812 LeuRS_core catalytic core domain of leucyl-tRNA synthetases Back     alignment and domain information
>PTZ00427 isoleucine-tRNA ligase, putative; Provisional Back     alignment and domain information
>cd00818 IleRS_core catalytic core domain of isoleucyl-tRNA synthetases Back     alignment and domain information
>PRK00133 metG methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PLN02610 probable methionyl-tRNA synthetase Back     alignment and domain information
>PRK12267 methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK14900 valS valyl-tRNA synthetase; Provisional Back     alignment and domain information
>PLN02882 aminoacyl-tRNA ligase Back     alignment and domain information
>PRK11893 methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>cd00672 CysRS_core catalytic core domain of cysteinyl tRNA synthetase Back     alignment and domain information
>TIGR00395 leuS_arch leucyl-tRNA synthetase, archaeal and cytosolic family Back     alignment and domain information
>TIGR00398 metG methionyl-tRNA synthetase Back     alignment and domain information
>PTZ00419 valyl-tRNA synthetase-like protein; Provisional Back     alignment and domain information
>PLN02959 aminoacyl-tRNA ligase Back     alignment and domain information
>COG0525 ValS Valyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0060 IleS Isoleucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR03447 mycothiol_MshC cysteine--1-D-myo-inosityl 2-amino-2-deoxy-alpha-D-glucopyranoside ligase Back     alignment and domain information
>KOG0435|consensus Back     alignment and domain information
>PRK12418 cysteinyl-tRNA synthetase; Provisional Back     alignment and domain information
>TIGR00435 cysS cysteinyl-tRNA synthetase Back     alignment and domain information
>PRK00260 cysS cysteinyl-tRNA synthetase; Validated Back     alignment and domain information
>KOG0432|consensus Back     alignment and domain information
>KOG0436|consensus Back     alignment and domain information
>PTZ00399 cysteinyl-tRNA-synthetase; Provisional Back     alignment and domain information
>cd00671 ArgRS_core catalytic core domain of arginyl-tRNA synthetases Back     alignment and domain information
>PLN02946 cysteine-tRNA ligase Back     alignment and domain information
>PRK14535 cysS cysteinyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK01611 argS arginyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK14536 cysS cysteinyl-tRNA synthetase; Provisional Back     alignment and domain information
>cd00802 class_I_aaRS_core catalytic core domain of class I amino acyl-tRNA synthetase Back     alignment and domain information
>PRK14534 cysS cysteinyl-tRNA synthetase; Provisional Back     alignment and domain information
>PF01406 tRNA-synt_1e: tRNA synthetases class I (C) catalytic domain; InterPro: IPR015803 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>cd00674 LysRS_core_class_I catalytic core domain of class I lysyl tRNA synthetase Back     alignment and domain information
>COG0215 CysS Cysteinyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK12300 leuS leucyl-tRNA synthetase; Reviewed Back     alignment and domain information
>KOG0434|consensus Back     alignment and domain information
>KOG0433|consensus Back     alignment and domain information
>KOG0437|consensus Back     alignment and domain information
>PRK00750 lysK lysyl-tRNA synthetase; Reviewed Back     alignment and domain information
>KOG2007|consensus Back     alignment and domain information
>KOG1247|consensus Back     alignment and domain information
>TIGR00467 lysS_arch lysyl-tRNA synthetase, archaeal and spirochete Back     alignment and domain information
>TIGR00456 argS arginyl-tRNA synthetase Back     alignment and domain information
>COG0018 ArgS Arginyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF00750 tRNA-synt_1d: tRNA synthetases class I (R); InterPro: IPR015945 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PRK12451 arginyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PLN02286 arginine-tRNA ligase Back     alignment and domain information
>cd09287 GluRS_non_core catalytic core domain of non-discriminating glutamyl-tRNA synthetase Back     alignment and domain information
>PRK04156 gltX glutamyl-tRNA synthetase; Provisional Back     alignment and domain information
>KOG1195|consensus Back     alignment and domain information
>TIGR00463 gltX_arch glutamyl-tRNA synthetase, archaeal and eukaryotic family Back     alignment and domain information
>PF01921 tRNA-synt_1f: tRNA synthetases class I (K); InterPro: IPR002904 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>COG1384 LysS Lysyl-tRNA synthetase (class I) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4426|consensus Back     alignment and domain information
>PLN02486 aminoacyl-tRNA ligase Back     alignment and domain information
>PRK12285 tryptophanyl-tRNA synthetase; Reviewed Back     alignment and domain information
>TIGR03838 queuosine_YadB glutamyl-queuosine tRNA(Asp) synthetase Back     alignment and domain information
>cd00418 GlxRS_core catalytic core domain of glutamyl-tRNA and glutaminyl-tRNA synthetase Back     alignment and domain information
>PF00749 tRNA-synt_1c: tRNA synthetases class I (E and Q), catalytic domain; InterPro: IPR020058 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>cd00805 TyrRS_core catalytic core domain of tyrosinyl-tRNA synthetase Back     alignment and domain information
>PLN03233 putative glutamate-tRNA ligase; Provisional Back     alignment and domain information
>cd00808 GluRS_core catalytic core domain of discriminating glutamyl-tRNA synthetase Back     alignment and domain information
>cd00807 GlnRS_core catalytic core domain of glutaminyl-tRNA synthetase Back     alignment and domain information
>COG0008 GlnS Glutamyl- and glutaminyl-tRNA synthetases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PTZ00402 glutamyl-tRNA synthetase; Provisional Back     alignment and domain information
>TIGR00440 glnS glutaminyl-tRNA synthetase Back     alignment and domain information
>PRK05347 glutaminyl-tRNA synthetase; Provisional Back     alignment and domain information
>PLN02907 glutamate-tRNA ligase Back     alignment and domain information
>PRK13354 tyrosyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK05710 glutamyl-Q tRNA(Asp) synthetase; Reviewed Back     alignment and domain information
>PTZ00437 glutaminyl-tRNA synthetase; Provisional Back     alignment and domain information
>cd00395 Tyr_Trp_RS_core catalytic core domain of tyrosinyl-tRNA and tryptophanyl-tRNA synthetase Back     alignment and domain information
>PRK12410 glutamylglutaminyl-tRNA synthetase; Provisional Back     alignment and domain information
>TIGR00464 gltX_bact glutamyl-tRNA synthetase, bacterial family Back     alignment and domain information
>PLN02859 glutamine-tRNA ligase Back     alignment and domain information
>PRK12558 glutamyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK14895 gltX glutamyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK14703 glutaminyl-tRNA synthetase/YqeY domain fusion protein; Provisional Back     alignment and domain information
>PRK01406 gltX glutamyl-tRNA synthetase; Reviewed Back     alignment and domain information
>cd00806 TrpRS_core catalytic core domain of tryptophanyl-tRNA synthetase Back     alignment and domain information
>PRK08560 tyrosyl-tRNA synthetase; Validated Back     alignment and domain information
>PLN02627 glutamyl-tRNA synthetase Back     alignment and domain information
>PTZ00126 tyrosyl-tRNA synthetase; Provisional Back     alignment and domain information
>TIGR00234 tyrS tyrosyl-tRNA synthetase Back     alignment and domain information
>PRK05912 tyrosyl-tRNA synthetase; Validated Back     alignment and domain information
>PRK00927 tryptophanyl-tRNA synthetase; Reviewed Back     alignment and domain information
>TIGR00233 trpS tryptophanyl-tRNA synthetase Back     alignment and domain information
>PRK12284 tryptophanyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PLN02886 aminoacyl-tRNA ligase Back     alignment and domain information
>COG0162 TyrS Tyrosyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0180 TrpS Tryptophanyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK12556 tryptophanyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK12282 tryptophanyl-tRNA synthetase II; Reviewed Back     alignment and domain information
>PRK12283 tryptophanyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PF00579 tRNA-synt_1b: tRNA synthetases class I (W and Y); InterPro: IPR002305 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>KOG1147|consensus Back     alignment and domain information
>KOG1148|consensus Back     alignment and domain information
>KOG2145|consensus Back     alignment and domain information
>PTZ00348 tyrosyl-tRNA synthetase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query129
1qu2_A 917 Insights Into Editing From An Ile-Trna Synthetase S 4e-20
1jzq_A 821 Isoleucyl-Trna Synthetase Complexed With Isoleucyl- 1e-12
1f4l_A 551 Crystal Structure Of The E.Coli Methionyl-Trna Synt 4e-07
3h97_A 560 Structure Of A Mutant Methionyl-trna Synthetase Wit 4e-07
1qqt_A 551 Methionyl-Trna Synthetase From Escherichia Coli Len 4e-07
3h9c_A 547 Structure Of Methionyl-Trna Synthetase: Crystal For 4e-07
1p7p_A 551 Methionyl-trna Synthetase From Escherichia Coli Com 4e-07
1gax_A 862 Crystal Structure Of Thermus Thermophilus Valyl-Trn 1e-05
3tun_A 542 Trypanosoma Brucei Methionyl-Trna Synthetase In Com 2e-05
4eg5_A 542 Trypanosoma Brucei Methionyl-Trna Synthetase In Com 2e-05
4eg1_A 542 Trypanosoma Brucei Methionyl-Trna Synthetase In Com 2e-05
2x1l_A 524 Crystal Structure Of Mycobacterium Smegmatis Methio 2e-05
4aq7_A 880 Ternary Complex Of E. Coli Leucyl-Trna Synthetase, 4e-05
2v0c_A 878 Leucyl-Trna Synthetase From Thermus Thermophilus Co 5e-05
1obh_A 878 Leucyl-Trna Synthetase From Thermus Thermophilus Co 5e-05
4dlp_A 536 Crystal Structure Of Methionyl-Trna Synthetase Metr 7e-05
1rqg_A 722 Methionyl-Trna Synthetase From Pyrococcus Abyssi Le 2e-04
3ziu_A 637 Crystal Structure Of Mycoplasma Mobile Leucyl-trna 4e-04
2csx_A 497 Crystal Structure Of Aquifex Aeolicus Methionyl-Trn 6e-04
3kfl_A 564 Leishmania Major Methionyl-Trna Synthetase In Compl 7e-04
>pdb|1QU2|A Chain A, Insights Into Editing From An Ile-Trna Synthetase Structure With Trna(Ile) And Mupirocin Length = 917 Back     alignment and structure 
Iteration: 1

 Score = 92.8 bits (229), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 46/83 (55%), Positives = 55/83 (66%), Gaps = 4/83 (4%)
Query: 33  EALNGKPEFILHDGPPYANGTPHIGHAVNKILKDITLRSNLLQGKRVHYVPGWDCHGLPI 92
           E   G   FILHDGPPYANG  H+GHA+NKILKD  +R   +QG    YVPGWD HGLPI
Sbjct: 42  EKNKGNETFILHDGPPYANGNLHMGHALNKILKDFIVRYKTMQGFYAPYVPGWDTHGLPI 101
Query: 93  ELKAITSKD---KLLSPLDIRKK 112
           E +A+T K    K +S  + R+K
Sbjct: 102 E-QALTKKGVDRKKMSTAEFREK 123
>pdb|1JZQ|A Chain A, Isoleucyl-Trna Synthetase Complexed With Isoleucyl- Adenylate Analogue Length = 821 Back     alignment and structure
>pdb|1F4L|A Chain A, Crystal Structure Of The E.Coli Methionyl-Trna Synthetase Complexed With Methionine Length = 551 Back     alignment and structure
>pdb|3H97|A Chain A, Structure Of A Mutant Methionyl-trna Synthetase With Modified Specificity Length = 560 Back     alignment and structure
>pdb|1QQT|A Chain A, Methionyl-Trna Synthetase From Escherichia Coli Length = 551 Back     alignment and structure
>pdb|3H9C|A Chain A, Structure Of Methionyl-Trna Synthetase: Crystal Form 2 Length = 547 Back     alignment and structure
>pdb|1P7P|A Chain A, Methionyl-trna Synthetase From Escherichia Coli Complexed With Methionine Phosphonate Length = 551 Back     alignment and structure
>pdb|1GAX|A Chain A, Crystal Structure Of Thermus Thermophilus Valyl-Trna Synthetase Complexed With Trna(Val) And Valyl-Adenylate Analogue Length = 862 Back     alignment and structure
>pdb|3TUN|A Chain A, Trypanosoma Brucei Methionyl-Trna Synthetase In Complex With Inhibitor Chem 1356 Length = 542 Back     alignment and structure
>pdb|4EG5|A Chain A, Trypanosoma Brucei Methionyl-Trna Synthetase In Complex With Inhibitor Chem 1312 Length = 542 Back     alignment and structure
>pdb|4EG1|A Chain A, Trypanosoma Brucei Methionyl-Trna Synthetase In Complex With Substrate Methionine Length = 542 Back     alignment and structure
>pdb|2X1L|A Chain A, Crystal Structure Of Mycobacterium Smegmatis Methionyl-Trna Synthetase In Complex With Methionine And Adenosine Length = 524 Back     alignment and structure
>pdb|4AQ7|A Chain A, Ternary Complex Of E. Coli Leucyl-Trna Synthetase, Trna(Leu) And Leucyl-Adenylate Analogue In The Aminoacylation Conformation Length = 880 Back     alignment and structure
>pdb|2V0C|A Chain A, Leucyl-Trna Synthetase From Thermus Thermophilus Complexed With A Sulphamoyl Analogue Of Leucyl-Adenylate In The Synthetic Site And An Adduct Of Amp With 5-Fluoro-1,3- Dihydro-1-Hydroxy-2,1-Benzoxaborole (An2690) In The Editing Site Length = 878 Back     alignment and structure
>pdb|1OBH|A Chain A, Leucyl-Trna Synthetase From Thermus Thermophilus Complexed With A Pre-Transfer Editing Substrate Analogue In Both Synthetic Active Site And Editing Site Length = 878 Back     alignment and structure
>pdb|4DLP|A Chain A, Crystal Structure Of Methionyl-Trna Synthetase Metrs From Brucella Melitensis Bound To Selenomethionine Length = 536 Back     alignment and structure
>pdb|1RQG|A Chain A, Methionyl-Trna Synthetase From Pyrococcus Abyssi Length = 722 Back     alignment and structure
>pdb|3ZIU|A Chain A, Crystal Structure Of Mycoplasma Mobile Leucyl-trna Synthetase With Leu-ams In The Active Site Length = 637 Back     alignment and structure
>pdb|2CSX|A Chain A, Crystal Structure Of Aquifex Aeolicus Methionyl-Trna Synthetase Complexed With Trna(Met) Length = 497 Back     alignment and structure
>pdb|3KFL|A Chain A, Leishmania Major Methionyl-Trna Synthetase In Complex With Methionyladenylate And Pyrophosphate Length = 564 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query129
1ffy_A 917 Isoleucyl-tRNA synthetase; protein-RNA complex, me 3e-46
1ile_A 821 Ilers, isoleucyl-tRNA synthetase; aminoacyl-tRNA s 3e-34
1wz2_A 967 Leucyl-tRNA synthetase; ligase, riken structural g 3e-28
1wkb_A 810 Leucyl-tRNA synthetase; leucine, aminoacyl-tRNA, e 2e-26
3h99_A 560 Methionyl-tRNA synthetase; rossmann fold, aminoacy 6e-13
1rqg_A 722 Methionyl-tRNA synthetase; translation, dimerizati 3e-12
2d5b_A 500 Methionyl-tRNA synthetase; rossmann fold, class 1A 3e-09
2csx_A 497 Methionyl-tRNA synthetase; ligase, riken structura 3e-09
2x1l_A 524 Methionyl-tRNA synthetase; nucleotide-binding, pro 3e-09
4dlp_A 536 Aminoacyl-tRNA synthetase, class I:aminoacyl-tRNA 4e-09
3tun_A 542 Methionyl-tRNA synthetase; aminoacyl-tRNA syntheta 5e-09
3kfl_A 564 Methionyl-tRNA synthetase; parasite, aminoacyl-tRN 8e-09
1gax_A 862 Valrs, valyl-tRNA synthetase; protein-RNA complex, 2e-04
2v0c_A 878 Aminoacyl-tRNA synthetase; ligase, nucleotide-bind 7e-04
>1ffy_A Isoleucyl-tRNA synthetase; protein-RNA complex, metal IONS, editing tRNA synthetase, double-sieve, ligase/RNA, mupiroci; HET: MRC; 2.20A {Staphylococcus aureus} SCOP: a.27.1.1 b.51.1.1 c.26.1.1 PDB: 1qu2_A* 1qu3_A* Length = 917 Back     alignment and structure
 Score =  158 bits (402), Expect = 3e-46
 Identities = 46/97 (47%), Positives = 56/97 (57%), Gaps = 4/97 (4%)

Query: 19  LSECGFSELYSWQREALNGKPEFILHDGPPYANGTPHIGHAVNKILKDITLRSNLLQGKR 78
             +    + Y    E   G   FILHDGPPYANG  H+GHA+NKILKD  +R   +QG  
Sbjct: 28  QEKWDAEDQYHKALEKNKGNETFILHDGPPYANGNLHMGHALNKILKDFIVRYKTMQGFY 87

Query: 79  VHYVPGWDCHGLPIELKAITSKD---KLLSPLDIRKK 112
             YVPGWD HGLPIE   +T K    K +S  + R+K
Sbjct: 88  APYVPGWDTHGLPIEQA-LTKKGVDRKKMSTAEFREK 123
>1ile_A Ilers, isoleucyl-tRNA synthetase; aminoacyl-tRNA synthetase, riken structural genomics/proteom initiative, RSGI, structural genomics; 2.50A {Thermus thermophilus} SCOP: a.27.1.1 b.51.1.1 c.26.1.1 PDB: 1jzq_A* 1jzs_A* Length = 821 Back     alignment and structure
>1wz2_A Leucyl-tRNA synthetase; ligase, riken structural genomics/proteomics initiativ structural genomics, ligase-RNA complex; 3.21A {Pyrococcus horikoshii} Length = 967 Back     alignment and structure
>1wkb_A Leucyl-tRNA synthetase; leucine, aminoacyl-tRNA, editing, amino acid, aminoacylation, trnaLeu, structural genomics; 2.05A {Pyrococcus horikoshii} Length = 810 Back     alignment and structure
>3h99_A Methionyl-tRNA synthetase; rossmann fold, aminoacyl-tRNA synthetase, ATP-binding, ligas binding, nucleotide-binding, protein biosynthesis; HET: CIT; 1.40A {Escherichia coli} PDB: 3h97_A* 3h9b_A* 1f4l_A 3h9c_A* 1pfv_A* 1pfu_A 1p7p_A* 1pfw_A* 1pfy_A* 1pg0_A* 1pg2_A* 1qqt_A 1mea_A 1med_A Length = 560 Back     alignment and structure
>1rqg_A Methionyl-tRNA synthetase; translation, dimerization, ligase; 2.90A {Pyrococcus abyssi} SCOP: a.27.1.1 c.26.1.1 g.41.1.1 Length = 722 Back     alignment and structure
>2d5b_A Methionyl-tRNA synthetase; rossmann fold, class 1A AARS, isomerase, structural genomics, NPPSFA; 1.80A {Thermus thermophilus} SCOP: a.27.1.1 c.26.1.1 PDB: 1woy_A 1a8h_A 2d54_A Length = 500 Back     alignment and structure
>2csx_A Methionyl-tRNA synthetase; ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics, ligase/RNA complex; 2.70A {Aquifex aeolicus} PDB: 2ct8_A* Length = 497 Back     alignment and structure
>2x1l_A Methionyl-tRNA synthetase; nucleotide-binding, protein biosynthesis, ligase, aminoacyl- synthetase; HET: ADN CXS; 2.30A {Mycobacterium smegmatis} PDB: 2x1m_A* Length = 524 Back     alignment and structure
>4dlp_A Aminoacyl-tRNA synthetase, class I:aminoacyl-tRNA synthetase, class IA:methionyl-tRNA...; structural genomics; 2.65A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} Length = 536 Back     alignment and structure
>3tun_A Methionyl-tRNA synthetase; aminoacyl-tRNA synthetase, AARS, metrs, parasite, protein-IN complex, translation, nucleotide binding; HET: C13; 2.55A {Trypanosoma brucei} Length = 542 Back     alignment and structure
>3kfl_A Methionyl-tRNA synthetase; parasite, aminoacyl-tRNA synthetase, tRNA ligase metrs, methionine, translation, ATP-binding; HET: ME8; 2.00A {Leishmania major} Length = 564 Back     alignment and structure
>1gax_A Valrs, valyl-tRNA synthetase; protein-RNA complex, rossmann fold, coiled coil, riken structural genomics/proteomics initiative, RSGI; HET: VAA; 2.90A {Thermus thermophilus} SCOP: a.2.7.3 a.27.1.1 b.51.1.1 c.26.1.1 PDB: 1ivs_A* 1iyw_A Length = 862 Back     alignment and structure
>2v0c_A Aminoacyl-tRNA synthetase; ligase, nucleotide-binding, protein biosynthesis; HET: LMS ANZ; 1.85A {Thermus thermophilus} PDB: 1h3n_A* 1obc_A* 1obh_A* 2bte_A* 2byt_A 2v0g_A* Length = 878 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query129
3u1f_A 542 Methionyl-tRNA synthetase; aminoacyl-tRNA syntheta 99.95
4arc_A 880 Leucine--tRNA ligase; ligase-RNA complex, nucleoti 99.92
1ffy_A 917 Isoleucyl-tRNA synthetase; protein-RNA complex, me 99.92
1gax_A 862 Valrs, valyl-tRNA synthetase; protein-RNA complex, 99.92
1rqg_A 722 Methionyl-tRNA synthetase; translation, dimerizati 99.92
2v0c_A 878 Aminoacyl-tRNA synthetase; ligase, nucleotide-bind 99.91
1ile_A 821 Ilers, isoleucyl-tRNA synthetase; aminoacyl-tRNA s 99.9
2x1l_A 524 Methionyl-tRNA synthetase; nucleotide-binding, pro 99.9
1wz2_A 967 Leucyl-tRNA synthetase; ligase, riken structural g 99.9
2csx_A 497 Methionyl-tRNA synthetase; ligase, riken structura 99.9
2d5b_A 500 Methionyl-tRNA synthetase; rossmann fold, class 1A 99.9
3h99_A 560 Methionyl-tRNA synthetase; rossmann fold, aminoacy 99.9
3kfl_A 564 Methionyl-tRNA synthetase; parasite, aminoacyl-tRN 99.89
1wkb_A 810 Leucyl-tRNA synthetase; leucine, aminoacyl-tRNA, e 99.89
4dlp_A 536 Aminoacyl-tRNA synthetase, class I:aminoacyl-tRNA 99.89
3tqo_A 462 Cysteinyl-tRNA synthetase; protein synthesis, liga 99.83
3c8z_A 414 Cysteinyl-tRNA synthetase; cysteine ligase, rossma 99.82
3sp1_A 501 Cysteinyl-tRNA synthetase; structural genomics, se 99.79
1li5_A 461 Cysrs, cysteinyl-tRNA synthetase, transfer RNA-Cys 99.78
2zue_A 629 Arginyl-tRNA synthetase; aminoacyl-tRNA synthetase 99.61
1irx_A 523 Lysyl-tRNA synthetase; beta sandwitch, zinc-bindin 99.51
1f7u_A 607 Arginyl-tRNA synthetase; RNA-protein complex, amin 99.49
1iq0_A 592 Arginyl-tRNA synthetase; riken structural genomics 99.4
3fnr_A 464 Arginyl-tRNA synthetase; transferase, PSI-2, NYSGX 99.32
1nzj_A 298 Hypothetical protein YADB; Zn cluster, glutamyl T- 97.98
3aii_A 553 Glutamyl-tRNA synthetase; amino-acyl tRNA syntheta 97.87
3al0_C 592 Glutamyl-tRNA(Gln) amidotransferase subunit C, GL 97.81
1qtq_A 553 GLNRS, protein (glutaminyl-tRNA synthetase); gluta 97.68
2o5r_A 481 Glutamyl-tRNA synthetase 1; TM1351, EC 6.1.1.17, g 97.61
2hz7_A 851 Glutaminyl-tRNA synthetase; rossmann fold, GLNRS c 97.6
2cfo_A 492 Glutamyl-tRNA synthetase; ligase, aminoacyl-tRNA s 97.41
4g6z_A 490 Glutamate-tRNA ligase; aminoacyl-tRNA synthetase, 97.19
3foc_A 451 Tryptophanyl-tRNA synthetase; structural genomics, 96.95
3hzr_A 386 Tryptophanyl-tRNA synthetase; APO tRNA-ligase, str 96.83
3jxe_A 392 Tryptophanyl-tRNA synthetase; adenosine triphospha 96.54
1jil_A 420 Tyrrs, tyrosyl-tRNA synthetase; truncation, based 96.51
3tzl_A 322 Tryptophanyl-tRNA synthetase; structural genomics, 96.33
2cyb_A 323 Tyrosyl-tRNA synthetase; rossmann-fold, structural 96.33
3i05_A 395 Tryptophanyl-tRNA synthetase; APO tRNA-ligase, ATP 96.31
4gri_A 512 Glutamate--tRNA ligase; structural genomics, seatt 96.3
3tze_A 406 Tryptophanyl-tRNA synthetase; structural genomics, 96.27
2j5b_A 348 Tyrosyl-tRNA synthetase; ligase, protein biosynthe 96.2
2cya_A 364 Tyrosyl-tRNA synthetase; tyrrs, aminoacylation, st 96.18
1j09_A 468 Glutamyl-tRNA synthetase; glurs-ATP-Glu complex, r 96.15
3a04_A 372 Tryptophanyl-tRNA synthetase; ligase, aminoacyl-tR 96.15
2ts1_A 419 Tyrosyl-tRNA synthetase; ligase (synthetase); 2.30 96.06
3hv0_A 393 Tryptophanyl-tRNA synthetase; tRNA-ligase, ATP-bin 95.94
2pid_A 356 Tyrosyl-tRNA synthetase; aminoacyl-tRNA synthetase 95.91
2ip1_A 432 Tryptophanyl-tRNA synthetase; rossmann fold, struc 95.9
2zp1_A 314 Tyrosyl-tRNA synthetase; tRNA synthetases class I, 95.7
3afh_A 488 Glutamyl-tRNA synthetase 2; protein-substrate comp 95.7
2el7_A 337 Tryptophanyl-tRNA synthetase; aminoacyl-tRNA synth 95.63
3vgj_A 373 Tyrosyl-tRNA synthetase, putative; tyrrs, ligase; 95.6
2cyc_A 375 Tyrosyl-tRNA synthetase; tyrosine, tyrrs, aminoacy 95.58
2yxn_A 322 Tyrosyl-tRNA synthetase; tRNA synthetases class I, 95.55
1r6u_A 437 Tryptophanyl-tRNA synthetase; class IC tRNA synthe 95.55
3p0j_A 690 Tyrosyl-tRNA synthetase; aminoacyl-tRNA synthetase 95.4
1i6k_A 328 TRPRS, tryptophanyl-tRNA synthetase; class I tRNA 95.32
2ja2_A 498 Glutamyl-tRNA synthetase; non-discriminating gluta 95.17
2jan_A 432 Tyrosyl-tRNA synthetase; protein biosynthesis, ami 95.07
1r6t_A 477 Tryptophanyl-tRNA synthetase; class IC tRNA synthe 95.03
2g36_A 340 Tryptophanyl-tRNA synthetase; TM0492, structural g 94.93
3prh_A 388 Tryptophanyl-tRNA synthetase; TRPRS, protein biosy 94.69
1y42_X 392 Tyrosyl-tRNA synthetase, mitochondrial; CYT-18, tR 94.6
3sz3_A 341 Tryptophanyl-tRNA synthetase; structural genomics, 94.41
2yy5_A 348 Tryptophanyl-tRNA synthetase; aminoaccyl tRNA synt 94.38
1yi8_B 351 Tryptophanyl-tRNA synthetase; ligase; HET: TRP; 2. 94.19
2dlc_X 394 Tyrosyl-tRNA synthetase, cytoplasmic; tyrrs, ligas 93.86
1h3f_A 432 Tyrosyl-tRNA synthetase; ligase, aminoacyl-tRNA sy 93.37
3n9i_A 346 Tryptophanyl-tRNA synthetase; tryptophan-tRNA liga 93.09
1n3l_A 372 Tyrosyl-tRNA synthetase; rossmann fold AS catalyti 91.69
3p0j_A 690 Tyrosyl-tRNA synthetase; aminoacyl-tRNA synthetase 91.28
>3u1f_A Methionyl-tRNA synthetase; aminoacyl-tRNA synthetase, AARS, metrs, parasite, protein-IN complex, rossmann-fold, translation; HET: 392; 2.20A {Trypanosoma brucei} PDB: 3u1e_A* 3u1g_A* 3u20_A* 4eg1_A 4eg3_A* 4eg6_A* 4eg8_A* 4eg5_A* 3tun_A* 3u1z_A* 4eg4_A* 4eg7_A* 4ega_A* Back     alignment and structure
Probab=99.95  E-value=1.4e-28  Score=208.65  Aligned_cols=88  Identities=25%  Similarity=0.371  Sum_probs=85.1

Q ss_pred             CCCcEEEEcCCCCCCCcCCchHHHHHHHHHHHHHHHHhcCCceEEeCCCCcCCchHHHHHHHhcCCCCCHHHHH-HHHHH
Q psy14678         37 GKPEFILHDGPPYANGTPHIGHAVNKILKDITLRSNLLQGKRVHYVPGWDCHGLPIELKAITSKDKLLSPLDIR-KKGLH  115 (129)
Q Consensus        37 ~~~~~~i~~~~P~vng~lHiGH~~~~v~~D~~~R~~~~~G~~V~~~~G~D~~G~ki~~~a~k~l~~~~~p~e~~-~~~~~  115 (129)
                      .+++|+|++|+|||||.|||||+++++++|+++||+||+|++|+|++|+||||+||+.+|+++   |++|+|++ ++...
T Consensus         7 ~~k~f~Ittp~pY~nG~lHiGHa~~~~~~Dii~Ry~r~~G~~v~~v~G~D~hG~~ie~~a~k~---g~~~~e~~~~~~~~   83 (542)
T 3u1f_A            7 VEKVFFVTSPIYYVNAAPHIGHVYSTLITDVIGRYHRVKGERVFALTGTDEHGQKVAEAAKQK---QVSPYDFTTAVAGE   83 (542)
T ss_dssp             CCCCEEEEEEEEECSSCCCHHHHHHHHHHHHHHHHHHHTTCCEEEEEEEECCSHHHHHHHHHT---TSCHHHHHHHHHHH
T ss_pred             CCCCEEEeCCCCCCCCchhhHHHHHHHHHHHHHHHHHhcCCCccccCccCcChHHHHHHHHHc---CCCHHHHHHHHHHH
Confidence            678999999999999999999999999999999999999999999999999999999999999   99999997 78999


Q ss_pred             HHHHhhccCCcc
Q psy14678        116 LPRLEASLLVTI  127 (129)
Q Consensus       116 ~~~~~~~L~i~~  127 (129)
                      |++++++|||+.
T Consensus        84 ~~~~~~~lgi~~   95 (542)
T 3u1f_A           84 FKKCFEQMDYSI   95 (542)
T ss_dssp             HHHHHHHHTCCC
T ss_pred             HHHHHHHhCCcc
Confidence            999999999974
>4arc_A Leucine--tRNA ligase; ligase-RNA complex, nucleotide-binding, protein biosynthesis I aminoacyl-tRNA synthetase, ATP-binding; 2.00A {Escherichia coli} PDB: 4aq7_A 4ari_A* 4as1_A* Back     alignment and structure
>1ffy_A Isoleucyl-tRNA synthetase; protein-RNA complex, metal IONS, editing tRNA synthetase, double-sieve, ligase/RNA, mupiroci; HET: MRC; 2.20A {Staphylococcus aureus} SCOP: a.27.1.1 b.51.1.1 c.26.1.1 PDB: 1qu2_A* 1qu3_A* Back     alignment and structure
>1gax_A Valrs, valyl-tRNA synthetase; protein-RNA complex, rossmann fold, coiled coil, riken structural genomics/proteomics initiative, RSGI; HET: VAA; 2.90A {Thermus thermophilus} SCOP: a.2.7.3 a.27.1.1 b.51.1.1 c.26.1.1 PDB: 1ivs_A* 1iyw_A Back     alignment and structure
>1rqg_A Methionyl-tRNA synthetase; translation, dimerization, ligase; 2.90A {Pyrococcus abyssi} SCOP: a.27.1.1 c.26.1.1 g.41.1.1 Back     alignment and structure
>2v0c_A Aminoacyl-tRNA synthetase; ligase, nucleotide-binding, protein biosynthesis; HET: LMS ANZ; 1.85A {Thermus thermophilus} PDB: 1h3n_A* 1obc_A* 1obh_A* 2bte_A* 2byt_A 2v0g_A* Back     alignment and structure
>1ile_A Ilers, isoleucyl-tRNA synthetase; aminoacyl-tRNA synthetase, riken structural genomics/proteom initiative, RSGI, structural genomics; 2.50A {Thermus thermophilus} SCOP: a.27.1.1 b.51.1.1 c.26.1.1 PDB: 1jzq_A* 1jzs_A* Back     alignment and structure
>2x1l_A Methionyl-tRNA synthetase; nucleotide-binding, protein biosynthesis, ligase, aminoacyl- synthetase; HET: ADN CXS; 2.30A {Mycobacterium smegmatis} PDB: 2x1m_A* Back     alignment and structure
>1wz2_A Leucyl-tRNA synthetase; ligase, riken structural genomics/proteomics initiativ structural genomics, ligase-RNA complex; 3.21A {Pyrococcus horikoshii} Back     alignment and structure
>2csx_A Methionyl-tRNA synthetase; ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics, ligase/RNA complex; 2.70A {Aquifex aeolicus} PDB: 2ct8_A* Back     alignment and structure
>2d5b_A Methionyl-tRNA synthetase; rossmann fold, class 1A AARS, isomerase, structural genomics, NPPSFA; 1.80A {Thermus thermophilus} SCOP: a.27.1.1 c.26.1.1 PDB: 1woy_A 1a8h_A 2d54_A Back     alignment and structure
>3h99_A Methionyl-tRNA synthetase; rossmann fold, aminoacyl-tRNA synthetase, ATP-binding, ligas binding, nucleotide-binding, protein biosynthesis; HET: CIT; 1.40A {Escherichia coli} PDB: 3h97_A* 3h9b_A* 1f4l_A 3h9c_A* 1pfv_A* 1pfu_A 1p7p_A* 1pfw_A* 1pfy_A* 1pg0_A* 1pg2_A* 1qqt_A 1mea_A 1med_A Back     alignment and structure
>3kfl_A Methionyl-tRNA synthetase; parasite, aminoacyl-tRNA synthetase, tRNA ligase metrs, methionine, translation, ATP-binding; HET: ME8; 2.00A {Leishmania major} Back     alignment and structure
>1wkb_A Leucyl-tRNA synthetase; leucine, aminoacyl-tRNA, editing, amino acid, aminoacylation, trnaLeu, structural genomics; 2.05A {Pyrococcus horikoshii} Back     alignment and structure
>4dlp_A Aminoacyl-tRNA synthetase, class I:aminoacyl-tRNA synthetase, class IA:methionyl-tRNA...; structural genomics; 2.65A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} Back     alignment and structure
>3tqo_A Cysteinyl-tRNA synthetase; protein synthesis, ligase; 2.30A {Coxiella burnetii} Back     alignment and structure
>3c8z_A Cysteinyl-tRNA synthetase; cysteine ligase, rossmann fold, Cys-SA inhibitor, zinc binding, ATP-binding, aminoacyl-tRNA synthetase; HET: 5CA 1PE EPE; 1.60A {Mycobacterium smegmatis} Back     alignment and structure
>3sp1_A Cysteinyl-tRNA synthetase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, LYME disease; HET: AMP; 2.55A {Borrelia burgdorferi} Back     alignment and structure
>1li5_A Cysrs, cysteinyl-tRNA synthetase, transfer RNA-Cys; cysteine, E.coli, ligase; 2.30A {Escherichia coli} SCOP: a.27.1.1 c.26.1.1 PDB: 1li7_A 1u0b_B Back     alignment and structure
>2zue_A Arginyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, ligase, nucleotide-binding, protein biosynthesis, ligase/RNA complex; HET: ANP; 2.00A {Pyrococcus horikoshii} PDB: 2zuf_A Back     alignment and structure
>1irx_A Lysyl-tRNA synthetase; beta sandwitch, zinc-binding structure, rossmann fold, alpha-helix CAGE; 2.60A {Pyrococcus horikoshii} SCOP: a.97.1.2 c.26.1.1 Back     alignment and structure
>1f7u_A Arginyl-tRNA synthetase; RNA-protein complex, aminoacylation; HET: PSU 1MG 2MG H2U M2G 5MC 5MU 1MA ARG; 2.20A {Saccharomyces cerevisiae} SCOP: a.27.1.1 c.26.1.1 d.67.2.1 PDB: 1bs2_A* 1f7v_A* Back     alignment and structure
>1iq0_A Arginyl-tRNA synthetase; riken structural genomics/proteomics initiative, RSGI, structural genomics, ligase; 2.30A {Thermus thermophilus} SCOP: a.27.1.1 c.26.1.1 d.67.2.1 Back     alignment and structure
>3fnr_A Arginyl-tRNA synthetase; transferase, PSI-2, NYSGXRC, struc genomics, protein structure initiative; 2.20A {Campylobacter jejuni} Back     alignment and structure
>1nzj_A Hypothetical protein YADB; Zn cluster, glutamyl T-RNA synthetase, structural genomics, unknown function; 1.50A {Escherichia coli} SCOP: c.26.1.1 PDB: 2zlz_A* 4a91_A* Back     alignment and structure
>3aii_A Glutamyl-tRNA synthetase; amino-acyl tRNA synthetase, ligase; 1.65A {Methanothermobacter thermautotrophicusorganism_taxid} Back     alignment and structure
>3al0_C Glutamyl-tRNA(Gln) amidotransferase subunit C, GL tRNA synthetase 2; protein-RNA complex, ligase-RNA complex; HET: GSU; 3.37A {Thermotoga maritima} Back     alignment and structure
>1qtq_A GLNRS, protein (glutaminyl-tRNA synthetase); glutamine, trnaGln, E. coli, complex, ligase/RNA complex; HET: QSI; 2.25A {Escherichia coli} SCOP: b.53.1.2 c.26.1.1 PDB: 1gsg_P* 1gts_A* 1gtr_A* 1zjw_A* 1o0b_A* 1o0c_A* 1qru_A* 1qrs_A* 1qrt_A* 1euy_A* 1euq_A* 1exd_A* 2rd2_A* 2re8_A* 1nyl_A Back     alignment and structure
>2o5r_A Glutamyl-tRNA synthetase 1; TM1351, EC 6.1.1.17, glutamate-T ligase 1, glurs 1, structural genomics, joint center for ST genomics, JCSG; 2.34A {Thermotoga maritima} Back     alignment and structure
>2hz7_A Glutaminyl-tRNA synthetase; rossmann fold, GLNRS core, class I aminoacyl-tRNA synthetase, ligase; 2.30A {Deinococcus radiodurans} Back     alignment and structure
>2cfo_A Glutamyl-tRNA synthetase; ligase, aminoacyl-tRNA synthetase, ATP-binding, nucleotide-B; HET: GLU; 2.45A {Synechococcus elongatus} Back     alignment and structure
>4g6z_A Glutamate-tRNA ligase; aminoacyl-tRNA synthetase, AARS, class 1B AARS, ATP-dependen charging, protein synthesis, structural genomics; HET: GLU; 2.05A {Burkholderia thailandensis} Back     alignment and structure
>3foc_A Tryptophanyl-tRNA synthetase; structural genomics, giardiasi aminoacyl-tRNA synthetase, ligase; 2.09A {Giardia lamblia atcc 50803} Back     alignment and structure
>3hzr_A Tryptophanyl-tRNA synthetase; APO tRNA-ligase, structural genomics, medical structural GEN pathogenic protozoa, MSGPP, ligase; 3.00A {Entamoeba histolytica} Back     alignment and structure
>3jxe_A Tryptophanyl-tRNA synthetase; adenosine triphosphate, rossmann fold, crystallography, X-RAY, P. horikoshii, aminoacyl-tRNA synthetase; HET: TYM; 3.00A {Pyrococcus horikoshii} Back     alignment and structure
>1jil_A Tyrrs, tyrosyl-tRNA synthetase; truncation, based inhibitor design, ligase; HET: 485; 2.20A {Staphylococcus aureus} SCOP: c.26.1.1 PDB: 1jij_A* 1jii_A* 1jik_A* Back     alignment and structure
>3tzl_A Tryptophanyl-tRNA synthetase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta structure; HET: ADP TRP; 2.15A {Campylobacter jejuni subsp} SCOP: c.26.1.0 PDB: 3m5w_A* Back     alignment and structure
>2cyb_A Tyrosyl-tRNA synthetase; rossmann-fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: TYR; 1.80A {Archaeoglobus fulgidus} Back     alignment and structure
>3i05_A Tryptophanyl-tRNA synthetase; APO tRNA-ligase, ATP-binding, aminoacyl-tRNA synthetase, LIG nucleotide-binding, protein biosynthesis; 2.80A {Trypanosoma brucei} SCOP: c.26.1.0 Back     alignment and structure
>4gri_A Glutamate--tRNA ligase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, aminoacyl-tRNA synthetase; HET: GLU; 2.60A {Borrelia burgdorferi} Back     alignment and structure
>3tze_A Tryptophanyl-tRNA synthetase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, amino acylation; HET: TRP; 2.60A {Encephalitozoon cuniculi} Back     alignment and structure
>2j5b_A Tyrosyl-tRNA synthetase; ligase, protein biosynthesis, ATP-binding; HET: TYE; 2.20A {Acanthamoeba polyphaga mimivirus} Back     alignment and structure
>2cya_A Tyrosyl-tRNA synthetase; tyrrs, aminoacylation, structural genomics, NPPSFA, national on protein structural and functional analyses; 2.20A {Aeropyrum pernix} Back     alignment and structure
>1j09_A Glutamyl-tRNA synthetase; glurs-ATP-Glu complex, riken structural genomics/proteomics initiative, RSGI, structural genomics, ligase; HET: GLU ATP; 1.80A {Thermus thermophilus} SCOP: a.97.1.1 c.26.1.1 PDB: 1n75_A* 1n77_A* 1n78_A* 2cuz_A* 2cv0_A* 2cv1_A* 2cv2_A* 2dxi_A* 1g59_A 1gln_A Back     alignment and structure
>3a04_A Tryptophanyl-tRNA synthetase; ligase, aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, nucleotide-binding, protein biosynthesis; 1.97A {Aeropyrum pernix} PDB: 3a05_A* Back     alignment and structure
>2ts1_A Tyrosyl-tRNA synthetase; ligase (synthetase); 2.30A {Geobacillus stearothermophilus} SCOP: c.26.1.1 PDB: 3ts1_A* 1tyd_E* 1tya_E* 1tyc_A 1tyb_E* 4ts1_A* 1jh3_A Back     alignment and structure
>3hv0_A Tryptophanyl-tRNA synthetase; tRNA-ligase, ATP-binding, aminoacyl-tRNA synthetase, ligase, nucleotide-binding; HET: TRP; 2.42A {Cryptosporidium parvum iowa II} SCOP: c.26.1.0 Back     alignment and structure
>2pid_A Tyrosyl-tRNA synthetase; aminoacyl-tRNA synthetase, protein-substrate complex, ATP-BI ligase, mitochondrion, nucleotide-binding, protein biosynth; HET: YSA; 2.20A {Homo sapiens} PDB: 3zxi_A* Back     alignment and structure
>2ip1_A Tryptophanyl-tRNA synthetase; rossmann fold, structural genomics, PSI-2, protein structure initiative; HET: PG4; 1.80A {Saccharomyces cerevisiae} PDB: 3kt0_A* 3kt3_A* 3kt6_A* 3kt8_A* Back     alignment and structure
>2zp1_A Tyrosyl-tRNA synthetase; tRNA synthetases class I, ligase, aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, nucleotide-binding; HET: IYR; 1.70A {Methanocaldococcus jannaschii} PDB: 1zh6_A* 1j1u_A* 1u7d_A 2q1g_A* 2pxh_A* 1zh0_A* 2q1i_A* 2ag6_A* 3qe4_A* 3d6u_A* 3d6v_A* 1u7x_A 3n2y_A* 2hgz_A* Back     alignment and structure
>3afh_A Glutamyl-tRNA synthetase 2; protein-substrate complex, aminoacyl-tRNA synthetase, ATP-binding, ligase, nucleotide-binding; HET: GSU; 2.00A {Thermotoga maritima} PDB: 3akz_B* Back     alignment and structure
>2el7_A Tryptophanyl-tRNA synthetase; aminoacyl-tRNA synthetase, translation, structural GEN NPPSFA; 2.50A {Thermus thermophilus} Back     alignment and structure
>3vgj_A Tyrosyl-tRNA synthetase, putative; tyrrs, ligase; HET: YAP; 2.21A {Plasmodium falciparum} Back     alignment and structure
>2cyc_A Tyrosyl-tRNA synthetase; tyrosine, tyrrs, aminoacylation, structural genomics; HET: TYR; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>2yxn_A Tyrosyl-tRNA synthetase; tRNA synthetases class I, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: AZY; 1.80A {Escherichia coli str} PDB: 1wq3_A* 1wq4_A* 1x8x_A* 1vbn_A* 1vbm_A* Back     alignment and structure
>1r6u_A Tryptophanyl-tRNA synthetase; class IC tRNA synthetase, rossmann fold catalytic domain, AN recognition domain, bound Trp-AMP, ligase; HET: TYM; 2.00A {Homo sapiens} SCOP: c.26.1.1 PDB: 1ulh_A 2dr2_A* 2ake_A* 1o5t_A Back     alignment and structure
>3p0j_A Tyrosyl-tRNA synthetase; aminoacyl-tRNA synthetase, tRNA ligase, AARS, tyrrs, pseudod translation, ATP-binding, nucleotide-binding, ligase; HET: TYE; 2.89A {Leishmania major} PDB: 3p0i_A* 3p0h_A* Back     alignment and structure
>1i6k_A TRPRS, tryptophanyl-tRNA synthetase; class I tRNA synthetase, AARS, induced FIT, ligase; HET: TYM; 1.72A {Geobacillus stearothermophilus} SCOP: c.26.1.1 PDB: 1i6l_A* 1i6m_A* 1m83_A* 1mau_A* 1maw_A* 1mb2_A* 2ov4_A* 3fhj_A* 3fi0_A* 1d2r_A 3u1v_A Back     alignment and structure
>2ja2_A Glutamyl-tRNA synthetase; non-discriminating glutamyl-tRNA aminoacylation, protein biosynthesis, aminoacyl-tRNA synthetase, ligase; 1.65A {Mycobacterium tuberculosis} PDB: 3pny_A 3pnv_A Back     alignment and structure
>2jan_A Tyrosyl-tRNA synthetase; protein biosynthesis, aminoacyl-tRNA synthetase, tyrrs, ligase, tyrosine, RNA-binding, ATP-binding; 2.9A {Mycobacterium tuberculosis} Back     alignment and structure
>1r6t_A Tryptophanyl-tRNA synthetase; class IC tRNA synthetase, rossmann fold catalytical domain, recognition domain, bound Trp-AMP, ligase; HET: TYM; 2.10A {Homo sapiens} SCOP: a.16.1.3 c.26.1.1 PDB: 2azx_A* 2quh_A* 2qui_A* 2quj_A* 2quk_A Back     alignment and structure
>2g36_A Tryptophanyl-tRNA synthetase; TM0492, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI, ligase; HET: TRP; 2.50A {Thermotoga maritima} Back     alignment and structure
>3prh_A Tryptophanyl-tRNA synthetase; TRPRS, protein biosynthesis, translation, class I tRNA synth rossman fold, high motif, KMSKS motif; 2.80A {Bacillus subtilis} Back     alignment and structure
>1y42_X Tyrosyl-tRNA synthetase, mitochondrial; CYT-18, tRNA ligase, group I intron; HET: TYR; 1.95A {Neurospora crassa} PDB: 2rkj_A Back     alignment and structure
>3sz3_A Tryptophanyl-tRNA synthetase; structural genomics, center for structural genomics of infec diseases, csgid, rossmann fold; HET: TRP; 1.50A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>2yy5_A Tryptophanyl-tRNA synthetase; aminoaccyl tRNA synthetase, structural genomics, NPPSFA; HET: WSA; 2.55A {Mycoplasma pneumoniae} Back     alignment and structure
>1yi8_B Tryptophanyl-tRNA synthetase; ligase; HET: TRP; 2.10A {Deinococcus radiodurans} PDB: 1yia_B* 1yid_B* 2a4m_A* Back     alignment and structure
>2dlc_X Tyrosyl-tRNA synthetase, cytoplasmic; tyrrs, ligase-tRNA complex; HET: 2MG OMG M2G PSU 6IA 5MC 5MU 1MA YMP; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1h3f_A Tyrosyl-tRNA synthetase; ligase, aminoacyl-tRNA synthetase; HET: TYE; 2.00A {Thermus thermophilus} SCOP: c.26.1.1 d.66.1.4 PDB: 1h3e_A* Back     alignment and structure
>3n9i_A Tryptophanyl-tRNA synthetase; tryptophan-tRNA ligase, csgid, structural genomics, niaid, center for structural genomics infectious diseases; 1.95A {Yersinia pestis} SCOP: c.26.1.1 Back     alignment and structure
>1n3l_A Tyrosyl-tRNA synthetase; rossmann fold AS catalytic domain, unique anticodon recognit domain, dimer, ligase; 1.18A {Homo sapiens} SCOP: c.26.1.1 PDB: 1q11_A* Back     alignment and structure
>3p0j_A Tyrosyl-tRNA synthetase; aminoacyl-tRNA synthetase, tRNA ligase, AARS, tyrrs, pseudod translation, ATP-binding, nucleotide-binding, ligase; HET: TYE; 2.89A {Leishmania major} PDB: 3p0i_A* 3p0h_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 129
d1ilea3 452 c.26.1.1 (A:1-197,A:387-641) Isoleucyl-tRNA synthe 6e-29
d1h3na3 494 c.26.1.1 (A:1-225,A:418-686) Leucyl-tRNA synthetas 5e-28
d1ffya3 450 c.26.1.1 (A:1-200,A:395-644) Isoleucyl-tRNA synthe 7e-24
d1ivsa4 425 c.26.1.1 (A:1-189,A:343-578) Valyl-tRNA synthetase 5e-23
d1pfva2 350 c.26.1.1 (A:4-140,A:176-388) Methionyl-tRNA synthe 5e-21
d1rqga2 361 c.26.1.1 (A:1-138,A:174-396) Methionyl-tRNA synthe 1e-19
d2d5ba2 348 c.26.1.1 (A:1-348) Methionyl-tRNA synthetase (MetR 7e-19
d1irxa2 317 c.26.1.1 (A:3-319) Class I lysyl-tRNA synthetase { 3e-06
d1li5a2 315 c.26.1.1 (A:1-315) Cysteinyl-tRNA synthetase (CysR 6e-04
>d1ilea3 c.26.1.1 (A:1-197,A:387-641) Isoleucyl-tRNA synthetase (IleRS) {Thermus thermophilus [TaxId: 274]} Length = 452 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Adenine nucleotide alpha hydrolase-like
superfamily: Nucleotidylyl transferase
family: Class I aminoacyl-tRNA synthetases (RS), catalytic domain
domain: Isoleucyl-tRNA synthetase (IleRS)
species: Thermus thermophilus [TaxId: 274]

 Score =  106 bits (265), Expect = 6e-29
 Identities = 27/73 (36%), Positives = 41/73 (56%)

Query: 25 SELYSWQREALNGKPEFILHDGPPYANGTPHIGHAVNKILKDITLRSNLLQGKRVHYVPG 84
           +++    E   G P + +++GPP ANG PH+GHA  +  KD+  R   ++G       G
Sbjct: 24 EKIFQKSVENRKGGPRYTVYEGPPTANGLPHVGHAQARSYKDLFPRYKTMRGYYAPRRAG 83

Query: 85 WDCHGLPIELKAI 97
          WD HGLP+EL+  
Sbjct: 84 WDTHGLPVELEVE 96
>d1h3na3 c.26.1.1 (A:1-225,A:418-686) Leucyl-tRNA synthetase (LeuRS) {Thermus thermophilus [TaxId: 274]} Length = 494 Back     information, alignment and structure
>d1ffya3 c.26.1.1 (A:1-200,A:395-644) Isoleucyl-tRNA synthetase (IleRS) {Staphylococcus aureus [TaxId: 1280]} Length = 450 Back     information, alignment and structure
>d1ivsa4 c.26.1.1 (A:1-189,A:343-578) Valyl-tRNA synthetase (ValRS) {Thermus thermophilus [TaxId: 274]} Length = 425 Back     information, alignment and structure
>d1pfva2 c.26.1.1 (A:4-140,A:176-388) Methionyl-tRNA synthetase (MetRS) {Escherichia coli [TaxId: 562]} Length = 350 Back     information, alignment and structure
>d1rqga2 c.26.1.1 (A:1-138,A:174-396) Methionyl-tRNA synthetase (MetRS) {Pyrococcus abyssi [TaxId: 29292]} Length = 361 Back     information, alignment and structure
>d2d5ba2 c.26.1.1 (A:1-348) Methionyl-tRNA synthetase (MetRS) {Thermus thermophilus [TaxId: 274]} Length = 348 Back     information, alignment and structure
>d1irxa2 c.26.1.1 (A:3-319) Class I lysyl-tRNA synthetase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 317 Back     information, alignment and structure
>d1li5a2 c.26.1.1 (A:1-315) Cysteinyl-tRNA synthetase (CysRS) {Escherichia coli [TaxId: 562]} Length = 315 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query129
d1h3na3 494 Leucyl-tRNA synthetase (LeuRS) {Thermus thermophil 99.95
d1ivsa4 425 Valyl-tRNA synthetase (ValRS) {Thermus thermophilu 99.94
d1ilea3 452 Isoleucyl-tRNA synthetase (IleRS) {Thermus thermop 99.93
d2d5ba2 348 Methionyl-tRNA synthetase (MetRS) {Thermus thermop 99.93
d1pfva2 350 Methionyl-tRNA synthetase (MetRS) {Escherichia col 99.93
d1ffya3 450 Isoleucyl-tRNA synthetase (IleRS) {Staphylococcus 99.93
d1rqga2 361 Methionyl-tRNA synthetase (MetRS) {Pyrococcus abys 99.91
d1li5a2 315 Cysteinyl-tRNA synthetase (CysRS) {Escherichia col 99.81
d1irxa2 317 Class I lysyl-tRNA synthetase {Archaeon Pyrococcus 99.61
d1f7ua2 348 Arginyl-tRNA synthetase (ArgRS) {Baker's yeast (Sa 99.12
d1iq0a2 370 Arginyl-tRNA synthetase (ArgRS) {Thermus thermophi 98.9
d1j09a2 305 Glutamyl-tRNA synthetase (GluRS) {Thermus thermoph 97.32
d1r6ta2 386 Tryptophanyl-tRNA synthetase (TrpRS) {Human (Homo 97.06
d1nzja_ 286 Glutamyl-Q tRNA-Asp synthetase YadB {Escherichia c 96.57
d1gtra2 331 Glutaminyl-tRNA synthetase (GlnRS) {Escherichia co 96.55
d1jila_ 323 Tyrosyl-tRNA synthetase (TyrRS) {Staphylococcus au 96.06
d2ts1a_ 319 Tyrosyl-tRNA synthetase (TyrRS) {Bacillus stearoth 95.95
d1j1ua_ 306 Tyrosyl-tRNA synthetase (TyrRS) {Archaeon Methanoc 95.74
d1i6la_ 326 Tryptophanyl-tRNA synthetase (TrpRS) {Bacillus ste 94.37
d1h3fa1 343 Tyrosyl-tRNA synthetase (TyrRS) {Thermus thermophi 94.19
d1n3la_ 339 Tyrosyl-tRNA synthetase (TyrRS) {Human (Homo sapie 93.51
>d1h3na3 c.26.1.1 (A:1-225,A:418-686) Leucyl-tRNA synthetase (LeuRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Adenine nucleotide alpha hydrolase-like
superfamily: Nucleotidylyl transferase
family: Class I aminoacyl-tRNA synthetases (RS), catalytic domain
domain: Leucyl-tRNA synthetase (LeuRS)
species: Thermus thermophilus [TaxId: 274]

Probab=99.95  E-value=2.5e-28  Score=199.83  Aligned_cols=88  Identities=26%  Similarity=0.323  Sum_probs=84.4

Q ss_pred             CCCcEEEEcCCCCCCCcCCchHHHHHHHHHHHHHHHHhcCCceEEeCCCCcCCchHHHHHHHhcCCCCCHHHHH-HHHHH
Q psy14678         37 GKPEFILHDGPPYANGTPHIGHAVNKILKDITLRSNLLQGKRVHYVPGWDCHGLPIELKAITSKDKLLSPLDIR-KKGLH  115 (129)
Q Consensus        37 ~~~~~~i~~~~P~vng~lHiGH~~~~v~~D~~~R~~~~~G~~V~~~~G~D~~G~ki~~~a~k~l~~~~~p~e~~-~~~~~  115 (129)
                      ++++|+|++|||||||.||||||++++++|+++||+||+|++|.|++||||||+|||.+|++.   +..+++++ +....
T Consensus        31 ~~~~~~i~~~pP~~nG~lHiGH~~~~~~~D~~~R~~rm~G~~v~~~~G~D~~G~~~e~~~~k~---~~~~~~~~~~~~~~  107 (494)
T d1h3na3          31 GRGKQYVLVMFPYPSGDLHMGHLKNYTMGDVLARFRRMQGYEVLHPMGWDAFGLPAENAALKF---GVHPKDWTYANIRQ  107 (494)
T ss_dssp             TTCEEEEEECCCCSSSCCBHHHHHHHHHHHHHHHHHHHTTCEEECCCCBCCSSHHHHHHHHHT---TCCHHHHHHHHHHH
T ss_pred             CCCCeEEEeCCCCCCCchhhhHHHHHHHHHHHHHHHHccCCcccCcCCcCcchHHHHHHHHHh---CCChHHHHHHHHHH
Confidence            567899999999999999999999999999999999999999999999999999999999999   99999996 78999


Q ss_pred             HHHHhhccCCcc
Q psy14678        116 LPRLEASLLVTI  127 (129)
Q Consensus       116 ~~~~~~~L~i~~  127 (129)
                      +++.+++||++.
T Consensus       108 ~~~~~~~~g~~~  119 (494)
T d1h3na3         108 AKESLRLMGILY  119 (494)
T ss_dssp             HHHHHHHTTCCC
T ss_pred             hHHHHHhcCccc
Confidence            999999999875
>d1ivsa4 c.26.1.1 (A:1-189,A:343-578) Valyl-tRNA synthetase (ValRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ilea3 c.26.1.1 (A:1-197,A:387-641) Isoleucyl-tRNA synthetase (IleRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2d5ba2 c.26.1.1 (A:1-348) Methionyl-tRNA synthetase (MetRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1pfva2 c.26.1.1 (A:4-140,A:176-388) Methionyl-tRNA synthetase (MetRS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ffya3 c.26.1.1 (A:1-200,A:395-644) Isoleucyl-tRNA synthetase (IleRS) {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1rqga2 c.26.1.1 (A:1-138,A:174-396) Methionyl-tRNA synthetase (MetRS) {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1li5a2 c.26.1.1 (A:1-315) Cysteinyl-tRNA synthetase (CysRS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1irxa2 c.26.1.1 (A:3-319) Class I lysyl-tRNA synthetase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1f7ua2 c.26.1.1 (A:136-483) Arginyl-tRNA synthetase (ArgRS) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iq0a2 c.26.1.1 (A:97-466) Arginyl-tRNA synthetase (ArgRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1j09a2 c.26.1.1 (A:1-305) Glutamyl-tRNA synthetase (GluRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r6ta2 c.26.1.1 (A:82-467) Tryptophanyl-tRNA synthetase (TrpRS) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzja_ c.26.1.1 (A:) Glutamyl-Q tRNA-Asp synthetase YadB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gtra2 c.26.1.1 (A:8-338) Glutaminyl-tRNA synthetase (GlnRS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jila_ c.26.1.1 (A:) Tyrosyl-tRNA synthetase (TyrRS) {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2ts1a_ c.26.1.1 (A:) Tyrosyl-tRNA synthetase (TyrRS) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} Back     information, alignment and structure
>d1j1ua_ c.26.1.1 (A:) Tyrosyl-tRNA synthetase (TyrRS) {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1i6la_ c.26.1.1 (A:) Tryptophanyl-tRNA synthetase (TrpRS) {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1h3fa1 c.26.1.1 (A:5-347) Tyrosyl-tRNA synthetase (TyrRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1n3la_ c.26.1.1 (A:) Tyrosyl-tRNA synthetase (TyrRS) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure