Psyllid ID: psy14686


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300------
MKGVMQYIFKLVPGLEVAGTVVPLAMIINKAMEDSQCSEPESLRKLFIGGLDYRTNDDSLKAFFEQWGEIVDVVVMKDPVTKRSRGFGFITYSESKMVDEAMSNRPHEIDGRVVETKRAVPREVKVRRVTKVQIALEQMDYFGQYGTIESVNMVTNKETGAKRGFAFIEFDDYDVVDKIVLDKVVVLEVDQEVINGEDHRTHGTHQEAKVDGVTTTNQTHGTIREVVGMDNSKVVAGEIKEVGVVSLVVDGVVAKVATVGVDKMLIQSFILLLSIRDLLSYFMCFLLYLSYYKCLCLGHGNCQSYA
ccccEEEEEEEcccEEcccEEccccccccccccccccccccccccEEEccccccccHHHHHHHHHcccEEEEEEEEEcccccccccEEEEEEccHHHHHHHHHccccEEccEEEccccccccccccccccccccccHHHHHHHccccEEEEEEEccccccccccEEEEEEcccHHHHHHHHHccEEEcccEEEEcccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEEEEEcHHHHHHHHHHHHEEEEEHHHHHHHHHHHHHHHHHHHEEEcccccccccc
cccHHHHHHHccccccccccEcccccEcccccccccccccHHHHEEEEEcccccccHHHHHHHHHHHccEEEEEEEEccccccEEEEEEEEEccHHHHHHHHcccccEEccEEcEEEEccccccccccccccccHHHHHHHHHHHccEEEEEEEEccccccEEEEEEEEEccHHHHHHHHccccEEEcccEEEEEEccccccccHHHccccccccccccccccccccccccccccccccccccEEEEcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccc
MKGVMQYIFKLVpglevagtvVPLAMIINKAmedsqcsepeSLRKLFIGgldyrtnddSLKAFFEQWGEIVDVVVMkdpvtkrsrgfgfitysESKMVdeamsnrpheidgrvvetkravprevkVRRVTKVQIALEQMdyfgqygtiESVNMvtnketgakrgfafiefddydvvdkIVLDKVVVLEVDqevingedhrthgthqeakvdgvtttnqthgTIREVVGMDNSKVVAGEIKEVGVVSLVVDGVVAKVATVGVDKMLIQSFILLLSIRDLLSYFMCFLLYLSYYKClclghgncqsya
MKGVMQYIFKLvpglevagTVVPLAMIINKAmedsqcsepESLRKLFIGGLDYRTNDDSLKAFFEQWGEIVdvvvmkdpvtkrsrgfgfityseskmvdeamsnrpheidgrvvetkravprevkvrrvtkvqialeqmdyfgqyGTIESVNMVTNKETGAKRGFAFIEFDDYDVVDKIVLDKVVVLEVDQEvingedhrthgthqeakvdgvtttnqthgtirevvgmdnSKVVAGEIKEVGVVSLVVDGVVAKVATVGVDKMLIQSFILLLSIRDLLSYFMCFLLYLSYYKCLCLGHGNCQSYA
MKGVMQYIFKLVPGLEVAGTVVPLAMIINKAMEDSQCSEPESLRKLFIGGLDYRTNDDSLKAFFEQWGEIVDVVVMKDPVTKRSRGFGFITYSESKMVDEAMSNRPHEIDGRVVETKRAVPREVKVRRVTKVQIALEQMDYFGQYGTIESVNMVTNKETGAKRGFAFIEFddydvvdkivldkvvvlevdqeviNGEDHRTHGTHQEAKVDGVTTTNQTHGTIREVVGMDNSKVVAGEIKEvgvvslvvdgvvakvatvgvdkMLIQSFILLLSIRDLLSYFMcfllylsyykclclGHGNCQSYA
***VMQYIFKLVPGLEVAGTVVPLAMIINKAM*********SLRKLFIGGLDYRTNDDSLKAFFEQWGEIVDVVVMKDPVTKRSRGFGFITYS*******************VVETKRAVPREVKVRRVTKVQIALEQMDYFGQYGTIESVNMVTNKETGAKRGFAFIEFDDYDVVDKIVLDKVVVLEVDQEVINGE**************GVTTTNQTHGTIREVVGMDNSKVVAGEIKEVGVVSLVVDGVVAKVATVGVDKMLIQSFILLLSIRDLLSYFMCFLLYLSYYKCLCLGHGNC****
MKGVMQYIFKLVPGLEVAGTVVP***********************FIGGLDYRTNDDSLKAFFEQWGEIVDVVVMKDPVTKRSRGFGFITYSESKMVDEAMSNRPHEIDGRVVETKRA***************ALEQMDYFGQYGTIESVNMVTNKETGAKRGFAFIEFDDYDVVDKIVLDKVVVLEVD*E**************************************************GVVSLVVDGVVAKVATVGVDKMLIQSFILLLSIRDLLSYFMCFLLYLSYYKCLCLGHGNC****
MKGVMQYIFKLVPGLEVAGTVVPLAMIINKAMEDSQCSEPESLRKLFIGGLDYRTNDDSLKAFFEQWGEIVDVVVMKDPVTKRSRGFGFITYSESKMVDEAMSNRPHEIDGRVVETKRAVPREVKVRRVTKVQIALEQMDYFGQYGTIESVNMVTNKETGAKRGFAFIEFDDYDVVDKIVLDKVVVLEVDQEVINGEDHRTHGTHQEAKVDGVTTTNQTHGTIREVVGMDNSKVVAGEIKEVGVVSLVVDGVVAKVATVGVDKMLIQSFILLLSIRDLLSYFMCFLLYLSYYKCLCLGHGNCQSYA
*****************AGTVVPLAMIIN********SEPESLRKLFIGGLDYRTNDDSLKAFFEQWGEIVDVVVMKDPVTKRSRGFGFITYSESKMVDEAMSNRPHEIDGRVVETKRAVPREVKVRRVTKVQIALEQMDYFGQYGTIESVNMVTNKETGAKRGFAFIEFDDYDVVDKIVLDKVVVLEVDQEVINGEDH**************TTTNQTHGTIREVVGMDNSKVVAGEIKEVGVVSLVVDGVVAKVATVGVDKMLIQSFILLLSIRDLLSYFMCFLLYLSYYKCLCLGHGNCQS**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKGVMQYIFKLVPGLEVAGTVVPLAMIINKAMEDSQCSEPESLRKLFIGGLDYRTNDDSLKAFFEQWGEIVDVVVMKDPVTKRSRGFGFITYSESKMVDEAMSNRPHEIDGRVVETKRAVPREVKVRRVTKVQIALEQMDYFGQYGTIESVNMVTNKETGAKRGFAFIEFDDYDVVDKIVLDKVVVLEVDQEVINGEDHRTHGTHQEAKVDGVTTTNQTHGTIREVVGMDNSKVVAGEIKEVGVVSLVVDGVVAKVATVGVDKMLIQSFILLLSIRDLLSYFMCFLLYLSYYKCLCLGHGNCQSYA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query306 2.2.26 [Sep-21-2011]
P07909365 Heterogeneous nuclear rib yes N/A 0.503 0.421 0.586 7e-50
P48810385 Heterogeneous nuclear rib no N/A 0.486 0.387 0.617 4e-49
P21522342 Heterogeneous nuclear rib N/A N/A 0.490 0.438 0.613 1e-48
P51992385 Heterogeneous nuclear rib N/A N/A 0.493 0.392 0.524 4e-42
P04256320 Heterogeneous nuclear rib no N/A 0.473 0.453 0.544 8e-42
P09651372 Heterogeneous nuclear rib yes N/A 0.473 0.389 0.544 8e-42
Q02926 471 Ribonucleoprotein RB97D O no N/A 0.490 0.318 0.536 8e-42
A5A6H4320 Heterogeneous nuclear rib yes N/A 0.473 0.453 0.544 8e-42
P49312320 Heterogeneous nuclear rib no N/A 0.473 0.453 0.544 8e-42
P09867320 Heterogeneous nuclear rib yes N/A 0.473 0.453 0.544 8e-42
>sp|P07909|ROA1_DROME Heterogeneous nuclear ribonucleoprotein A1 OS=Drosophila melanogaster GN=Hrb98DE PE=2 SV=1 Back     alignment and function desciption
 Score =  197 bits (501), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 102/174 (58%), Positives = 123/174 (70%), Gaps = 20/174 (11%)

Query: 37  CSEPESLRKLFIGGLDYRTNDDSLKAFFEQWGEIVDVVVMKDPVTKRSRGFGFITYSESK 96
            +EPE +RKLFIGGLDYRT D++LKA FE+WG IVDVVVMKDP TKRSRGFGFITYS S 
Sbjct: 24  ITEPEHMRKLFIGGLDYRTTDENLKAHFEKWGNIVDVVVMKDPRTKRSRGFGFITYSHSS 83

Query: 97  MVDEAMSNRPHEIDGRVVETKRAVPRE----------VKVRRVTKVQIALEQM---DYFG 143
           M+DEA  +RPH+IDGRVVE KRAVPR+          VK   V  ++   ++    DYF 
Sbjct: 84  MIDEAQKSRPHKIDGRVVEPKRAVPRQDIDSPNAGATVKKLFVGALKDDHDEQSIRDYFQ 143

Query: 144 QYGTIESVNMVTNKETGAKRGFAFIEFDDYDVVDKIVLDKVVVLEVDQEVINGE 197
            +G I  +N+V +KETG KRGFAF+EFDDYD VDK+VL K       Q  +NG+
Sbjct: 144 HFGNIVDINIVIDKETGKKRGFAFVEFDDYDPVDKVVLQK-------QHQLNGK 190




This protein is a component of ribonucleosomes.
Drosophila melanogaster (taxid: 7227)
>sp|P48810|RB87F_DROME Heterogeneous nuclear ribonucleoprotein 87F OS=Drosophila melanogaster GN=Hrb87F PE=2 SV=2 Back     alignment and function description
>sp|P21522|ROA1_SCHAM Heterogeneous nuclear ribonucleoprotein A1, A2/B1 homolog OS=Schistocerca americana GN=HNRNP PE=2 SV=1 Back     alignment and function description
>sp|P51992|RO32_XENLA Heterogeneous nuclear ribonucleoprotein A3 homolog 2 OS=Xenopus laevis PE=2 SV=1 Back     alignment and function description
>sp|P04256|ROA1_RAT Heterogeneous nuclear ribonucleoprotein A1 OS=Rattus norvegicus GN=Hnrnpa1 PE=1 SV=3 Back     alignment and function description
>sp|P09651|ROA1_HUMAN Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens GN=HNRNPA1 PE=1 SV=5 Back     alignment and function description
>sp|Q02926|RB97D_DROME Ribonucleoprotein RB97D OS=Drosophila melanogaster GN=Rb97D PE=2 SV=1 Back     alignment and function description
>sp|A5A6H4|ROA1_PANTR Heterogeneous nuclear ribonucleoprotein A1 OS=Pan troglodytes GN=HNRNPA1 PE=2 SV=1 Back     alignment and function description
>sp|P49312|ROA1_MOUSE Heterogeneous nuclear ribonucleoprotein A1 OS=Mus musculus GN=Hnrnpa1 PE=1 SV=2 Back     alignment and function description
>sp|P09867|ROA1_BOVIN Heterogeneous nuclear ribonucleoprotein A1 OS=Bos taurus GN=HNRNPA1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query306
195113003359 GI10577 [Drosophila mojavensis] gi|19391 0.529 0.451 0.593 1e-50
195391065355 GJ22934 [Drosophila virilis] gi|19415227 0.529 0.456 0.587 2e-50
195055059379 GH17116 [Drosophila grimshawi] gi|193892 0.529 0.427 0.587 3e-50
195158385 431 GL13791 [Drosophila persimilis] gi|19411 0.529 0.375 0.576 2e-49
198450175368 GA26796 [Drosophila pseudoobscura pseudo 0.529 0.440 0.576 2e-49
195574505 2951 GD21374 [Drosophila simulans] gi|1942011 0.607 0.063 0.514 4e-49
332017443 407 Heterogeneous nuclear ribonucleoprotein 0.575 0.432 0.559 4e-49
195503537356 GE23791 [Drosophila yakuba] gi|194184795 0.516 0.443 0.584 4e-49
195445835385 GK12096 [Drosophila willistoni] gi|19416 0.516 0.410 0.578 5e-49
194745154357 GF18582 [Drosophila ananassae] gi|190628 0.506 0.434 0.601 8e-49
>gi|195113003|ref|XP_002001061.1| GI10577 [Drosophila mojavensis] gi|193917655|gb|EDW16522.1| GI10577 [Drosophila mojavensis] Back     alignment and taxonomy information
 Score =  206 bits (523), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 108/182 (59%), Positives = 126/182 (69%), Gaps = 20/182 (10%)

Query: 29  NKAMEDSQCSEPESLRKLFIGGLDYRTNDDSLKAFFEQWGEIVDVVVMKDPVTKRSRGFG 88
           N   +D   SEPE +RKLFIGGLDYRT DD+LKA FE+WG+IVDVVVMKDP TKRSRGFG
Sbjct: 12  NGQHDDDSISEPEHMRKLFIGGLDYRTTDDNLKAHFEKWGQIVDVVVMKDPRTKRSRGFG 71

Query: 89  FITYSESKMVDEAMSNRPHEIDGRVVETKRAVPRE----------VKVRRVTKVQIALEQ 138
           FITYS S MVDEA   RPH+IDGRVVE KRAVPR+          VK   V  ++   ++
Sbjct: 72  FITYSHSSMVDEAQKARPHKIDGRVVEPKRAVPRQDIDSPNAGATVKKLFVGALKDDHDE 131

Query: 139 M---DYFGQYGTIESVNMVTNKETGAKRGFAFIEFDDYDVVDKIVLDKVVVLEVDQEVIN 195
               DYF  YG I  +N+V +KETG KRGFAF+EFDDYD VDK+VL K       Q  +N
Sbjct: 132 QSLRDYFQHYGNIVDINIVMDKETGKKRGFAFVEFDDYDPVDKVVLQK-------QHQLN 184

Query: 196 GE 197
           G+
Sbjct: 185 GK 186




Source: Drosophila mojavensis

Species: Drosophila mojavensis

Genus: Drosophila

Family: Drosophilidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|195391065|ref|XP_002054186.1| GJ22934 [Drosophila virilis] gi|194152272|gb|EDW67706.1| GJ22934 [Drosophila virilis] Back     alignment and taxonomy information
>gi|195055059|ref|XP_001994440.1| GH17116 [Drosophila grimshawi] gi|193892203|gb|EDV91069.1| GH17116 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|195158385|ref|XP_002020072.1| GL13791 [Drosophila persimilis] gi|194116841|gb|EDW38884.1| GL13791 [Drosophila persimilis] Back     alignment and taxonomy information
>gi|198450175|ref|XP_002137048.1| GA26796 [Drosophila pseudoobscura pseudoobscura] gi|198130926|gb|EDY67606.1| GA26796 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|195574505|ref|XP_002105229.1| GD21374 [Drosophila simulans] gi|194201156|gb|EDX14732.1| GD21374 [Drosophila simulans] Back     alignment and taxonomy information
>gi|332017443|gb|EGI58166.1| Heterogeneous nuclear ribonucleoprotein A1, A2/B1-like protein [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|195503537|ref|XP_002098694.1| GE23791 [Drosophila yakuba] gi|194184795|gb|EDW98406.1| GE23791 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|195445835|ref|XP_002070507.1| GK12096 [Drosophila willistoni] gi|194166592|gb|EDW81493.1| GK12096 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|194745154|ref|XP_001955057.1| GF18582 [Drosophila ananassae] gi|190628094|gb|EDV43618.1| GF18582 [Drosophila ananassae] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query306
FB|FBgn0001215365 Hrb98DE "Heterogeneous nuclear 0.447 0.375 0.622 9.6e-41
FB|FBgn0004237385 Hrb87F "Heterogeneous nuclear 0.450 0.358 0.596 6.8e-40
UNIPROTKB|F8VZ49231 HNRNPA1 "Heterogeneous nuclear 0.470 0.623 0.506 6.5e-35
ZFIN|ZDB-GENE-030912-14 422 hnrnpa1 "heterogeneous nuclear 0.470 0.341 0.509 6.5e-35
UNIPROTKB|F1Q3G7384 HNRNPA1 "Uncharacterized prote 0.486 0.388 0.5 8.3e-35
UNIPROTKB|E7EWI9322 HNRNPA3 "Heterogeneous nuclear 0.454 0.431 0.519 1.1e-34
UNIPROTKB|F1LNG4357 Hnrnpa3 "Heterogeneous nuclear 0.454 0.389 0.519 1.1e-34
UNIPROTKB|Q28521320 HNRNPA1 "Heterogeneous nuclear 0.431 0.412 0.537 1.3e-34
UNIPROTKB|P09867320 HNRNPA1 "Heterogeneous nuclear 0.431 0.412 0.537 1.7e-34
UNIPROTKB|E2QYP1373 HNRNPA1 "Uncharacterized prote 0.431 0.353 0.537 1.7e-34
FB|FBgn0001215 Hrb98DE "Heterogeneous nuclear ribonucleoprotein at 98DE" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 433 (157.5 bits), Expect = 9.6e-41, P = 9.6e-41
 Identities = 94/151 (62%), Positives = 111/151 (73%)

Query:    33 EDSQCSEPESLRKLFIGGLDYRTNDDSLKAFFEQWGEIVDVVVMKDPVTKRSRGFGFITY 92
             +DS  +EPE +RKLFIGGLDYRT D++LKA FE+WG IVDVVVMKDP TKRSRGFGFITY
Sbjct:    21 QDS-ITEPEHMRKLFIGGLDYRTTDENLKAHFEKWGNIVDVVVMKDPRTKRSRGFGFITY 79

Query:    93 SESKMVDEAMSNRPHEIDGRVVETKRAVPREV-----KVRRVTKVQI-AL-----EQM-- 139
             S S M+DEA  +RPH+IDGRVVE KRAVPR+          V K+ + AL     EQ   
Sbjct:    80 SHSSMIDEAQKSRPHKIDGRVVEPKRAVPRQDIDSPNAGATVKKLFVGALKDDHDEQSIR 139

Query:   140 DYFGQYGTIESVNMVTNKETGAKRGFAFIEF 170
             DYF  +G I  +N+V +KETG KRGFAF+EF
Sbjct:   140 DYFQHFGNIVDINIVIDKETGKKRGFAFVEF 170


GO:0030529 "ribonucleoprotein complex" evidence=ISS;NAS;IDA;IPI
GO:0003729 "mRNA binding" evidence=ISS;NAS
GO:0000166 "nucleotide binding" evidence=IEA
GO:0001745 "compound eye morphogenesis" evidence=IGI
GO:0043565 "sequence-specific DNA binding" evidence=IDA
GO:0000381 "regulation of alternative mRNA splicing, via spliceosome" evidence=IMP
GO:0005703 "polytene chromosome puff" evidence=IDA
GO:0033119 "negative regulation of RNA splicing" evidence=IMP
GO:0005634 "nucleus" evidence=IDA
GO:0045727 "positive regulation of translation" evidence=IMP
GO:0048477 "oogenesis" evidence=IMP
GO:0036099 "female germ-line stem cell maintenance" evidence=IMP
GO:0048027 "mRNA 5'-UTR binding" evidence=IDA
FB|FBgn0004237 Hrb87F "Heterogeneous nuclear ribonucleoprotein at 87F" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F8VZ49 HNRNPA1 "Heterogeneous nuclear ribonucleoprotein A1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030912-14 hnrnpa1 "heterogeneous nuclear ribonucleoprotein A1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1Q3G7 HNRNPA1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E7EWI9 HNRNPA3 "Heterogeneous nuclear ribonucleoprotein A3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1LNG4 Hnrnpa3 "Heterogeneous nuclear ribonucleoprotein A3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q28521 HNRNPA1 "Heterogeneous nuclear ribonucleoprotein A1" [Macaca mulatta (taxid:9544)] Back     alignment and assigned GO terms
UNIPROTKB|P09867 HNRNPA1 "Heterogeneous nuclear ribonucleoprotein A1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2QYP1 HNRNPA1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q28521ROA1_MACMUNo assigned EC number0.53790.47380.4531yesN/A
P09867ROA1_BOVINNo assigned EC number0.54430.47380.4531yesN/A
A5A6H4ROA1_PANTRNo assigned EC number0.54430.47380.4531yesN/A
P09651ROA1_HUMANNo assigned EC number0.54430.47380.3897yesN/A
Q8BG05ROA3_MOUSENo assigned EC number0.53790.47380.3825yesN/A
P07909ROA1_DROMENo assigned EC number0.58620.50320.4219yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query306
cd1257878 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 2e-48
cd1276181 cd12761, RRM1_hnRNPA1, RNA recognition motif 1 in 3e-35
cd1276381 cd12763, RRM1_hnRNPA3, RNA recognition motif 1 in 1e-33
cd1276281 cd12762, RRM1_hnRNPA2B1, RNA recognition motif 1 i 2e-33
cd1232572 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition 5e-32
cd1232679 cd12326, RRM1_hnRNPA0, RNA recognition motif 1 fou 2e-28
cd1257482 cd12574, RRM1_DAZAP1, RNA recognition motif 1 in D 4e-27
cd1257776 cd12577, RRM1_Hrp1p, RNA recognition motif 1 in ye 5e-27
cd1257675 cd12576, RRM1_MSI, RNA recognition motif 1 in RNA- 2e-26
cd1232780 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in D 1e-22
cd1276076 cd12760, RRM1_MSI2, RNA recognition motif 1 in RNA 1e-21
cd1233075 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in ye 1e-20
cd1257574 cd12575, RRM1_hnRNPD_like, RNA recognition motif 1 2e-20
cd1275977 cd12759, RRM1_MSI1, RNA recognition motif 1 in RNA 1e-19
cd1238280 cd12382, RRM_RBMX_like, RNA recognition motif in h 4e-19
cd1275775 cd12757, RRM1_hnRNPAB, RNA recognition motif 1 in 5e-19
cd1275674 cd12756, RRM1_hnRNPD, RNA recognition motif 1 in h 7e-19
cd1238476 cd12384, RRM_RBM24_RBM38_like, RNA recognition mot 2e-18
smart0036073 smart00360, RRM, RNA recognition motif 2e-18
cd1232873 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 2e-18
cd1275876 cd12758, RRM1_hnRPDL, RNA recognition motif 1 in h 2e-17
cd1232177 cd12321, RRM1_TDP43, RNA recognition motif 1 in TA 2e-17
cd1244980 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in 3e-17
cd1232374 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA- 3e-16
cd1232975 cd12329, RRM2_hnRNPD_like, RNA recognition motif 2 5e-16
cd1239978 cd12399, RRM_HP0827_like, RNA recognition motif in 5e-16
pfam0007670 pfam00076, RRM_1, RNA recognition motif 1e-14
cd1257379 cd12573, RRM2_MSI2, RNA recognition motif 2 in RNA 2e-13
cd1257274 cd12572, RRM2_MSI1, RNA recognition motif 2 in RNA 4e-13
COG0724306 COG0724, COG0724, RNA-binding proteins (RRM domain 4e-13
cd1244776 cd12447, RRM1_gar2, RNA recognition motif 1 in yea 4e-13
PLN03134144 PLN03134, PLN03134, glycine-rich RNA-binding prote 5e-13
cd1258077 cd12580, RRM2_hnRNPA1, RNA recognition motif 2 in 1e-12
cd1228473 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 2e-12
cd1258180 cd12581, RRM2_hnRNPA2B1, RNA recognition motif 2 i 2e-12
cd1232873 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 3e-12
cd1258280 cd12582, RRM2_hnRNPA3, RNA recognition motif 2 in 4e-12
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 7e-12
cd1231173 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in 7e-12
cd1257980 cd12579, RRM2_hnRNPA0, RNA recognition motif 2 in 8e-12
cd1258480 cd12584, RRM2_hnRNPAB, RNA recognition motif 2 in 2e-11
cd1258180 cd12581, RRM2_hnRNPA2B1, RNA recognition motif 2 i 3e-11
cd1258280 cd12582, RRM2_hnRNPA3, RNA recognition motif 2 in 3e-11
cd1241189 cd12411, RRM_ist3_like, RNA recognition motif in i 7e-11
TIGR01622457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 9e-11
cd1234773 cd12347, RRM_PPIE, RNA recognition motif in cyclop 1e-10
cd1232271 cd12322, RRM2_TDP43, RNA recognition motif 2 in TA 1e-10
cd1236177 cd12361, RRM1_2_CELF1-6_like, RNA recognition moti 1e-10
cd1258077 cd12580, RRM2_hnRNPA1, RNA recognition motif 2 in 2e-10
cd1231384 cd12313, RRM1_RRM2_RBM5_like, RNA recognition moti 2e-10
cd1231674 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition mot 2e-10
TIGR01628562 TIGR01628, PABP-1234, polyadenylate binding protei 2e-10
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 4e-10
cd1223691 cd12236, RRM_snRNP70, RNA recognition motif in U1 4e-10
cd1267479 cd12674, RRM1_Nop4p, RNA recognition motif 1 in ye 5e-10
cd1258575 cd12585, RRM2_hnRPDL, RNA recognition motif 2 in h 1e-09
cd1238080 cd12380, RRM3_I_PABPs, RNA recognition motif 3 fou 1e-09
smart0036073 smart00360, RRM, RNA recognition motif 2e-09
cd1232975 cd12329, RRM2_hnRNPD_like, RNA recognition motif 2 2e-09
cd1241280 cd12412, RRM_DAZL_BOULE, RNA recognition motif in 2e-09
cd1222981 cd12229, RRM_G3BP, RNA recognition motif (RRM) in 2e-09
cd1245077 cd12450, RRM1_NUCLs, RNA recognition motif 1 found 2e-09
cd1241582 cd12415, RRM3_RBM28_like, RNA recognition motif 3 2e-09
cd1239978 cd12399, RRM_HP0827_like, RNA recognition motif in 4e-09
cd1244873 cd12448, RRM2_gar2, RNA recognition motif 2 in yea 4e-09
cd1235375 cd12353, RRM2_TIA1_like, RNA recognition motif 2 i 4e-09
cd1232572 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition 6e-09
TIGR01622457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 6e-09
cd1238383 cd12383, RRM_RBM42, RNA recognition motif in RNA-b 6e-09
cd1229878 cd12298, RRM3_Prp24, RNA recognition motif 3 in fu 8e-09
cd1257980 cd12579, RRM2_hnRNPA0, RNA recognition motif 2 in 2e-08
cd1239172 cd12391, RRM1_SART3, RNA recognition motif 1 in sq 2e-08
cd1241379 cd12413, RRM1_RBM28_like, RNA recognition motif 1 2e-08
cd1239875 cd12398, RRM_CSTF2_RNA15_like, RNA recognition mot 3e-08
pfam0007670 pfam00076, RRM_1, RNA recognition motif 4e-08
cd1233583 cd12335, RRM2_SF3B4, RNA recognition motif 2 in sp 4e-08
cd1240074 cd12400, RRM_Nop6, RNA recognition motif in Saccha 6e-08
cd1258375 cd12583, RRM2_hnRNPD, RNA recognition motif 2 in h 7e-08
cd1223793 cd12237, RRM_snRNP35, RNA recognition motif found 7e-08
cd1236378 cd12363, RRM_TRA2, RNA recognition motif in transf 8e-08
cd1237177 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U 8e-08
cd1256779 cd12567, RRM3_RBM19, RNA recognition motif 3 in RN 1e-07
cd1239573 cd12395, RRM2_RBM34, RNA recognition motif 2 in RN 1e-07
TIGR01659346 TIGR01659, sex-lethal, sex-lethal family splicing 1e-07
TIGR01628 562 TIGR01628, PABP-1234, polyadenylate binding protei 2e-07
cd1238179 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in 2e-07
cd1240776 cd12407, RRM_FOX1_like, RNA recognition motif in v 2e-07
cd1261975 cd12619, RRM2_PUB1, RNA recognition motif 2 in yea 3e-07
cd12676107 cd12676, RRM3_Nop4p, RNA recognition motif 3 in ye 3e-07
cd1263287 cd12632, RRM1_CELF3_4_5_6, RNA recognition motif 1 4e-07
cd1230774 cd12307, RRM_NIFK_like, RNA recognition motif in n 4e-07
cd1223691 cd12236, RRM_snRNP70, RNA recognition motif in U1 6e-07
cd1233675 cd12336, RRM_RBM7_like, RNA recognition motif in R 7e-07
cd1234672 cd12346, RRM3_NGR1_NAM8_like, RNA recognition moti 7e-07
cd1256679 cd12566, RRM2_MRD1, RNA recognition motif 2 in yea 7e-07
TIGR01661352 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing f 7e-07
TIGR01628562 TIGR01628, PABP-1234, polyadenylate binding protei 8e-07
cd1236273 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in 8e-07
cd1237679 cd12376, RRM2_Hu_like, RNA recognition motif 2 in 9e-07
TIGR01628 562 TIGR01628, PABP-1234, polyadenylate binding protei 1e-06
cd1256576 cd12565, RRM1_MRD1, RNA recognition motif 1 in yea 1e-06
cd1224273 cd12242, RRM_SLIRP, RNA recognition motif found in 1e-06
cd1241476 cd12414, RRM2_RBM28_like, RNA recognition motif 2 1e-06
cd1231284 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif 1e-06
cd1241189 cd12411, RRM_ist3_like, RNA recognition motif in i 2e-06
cd1236573 cd12365, RRM_RNPS1, RNA recognition motif in RNA-b 2e-06
cd1267381 cd12673, RRM_BOULE, RNA recognition motif in prote 2e-06
cd1231882 cd12318, RRM5_RBM19_like, RNA recognition motif 5 2e-06
cd1239773 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 3e-06
cd1263380 cd12633, RRM1_FCA, RNA recognition motif 1 in plan 3e-06
cd1263780 cd12637, RRM2_FCA, RNA recognition motif 2 in plan 4e-06
cd1245179 cd12451, RRM2_NUCLs, RNA recognition motif 2 in nu 4e-06
cd1240877 cd12408, RRM_eIF3G_like, RNA recognition motif in 4e-06
cd1246380 cd12463, RRM_G3BP1, RNA recognition motif found in 4e-06
cd1267079 cd12670, RRM2_Nop12p_like, RNA recognition motif 2 4e-06
cd1264189 cd12641, RRM_TRA2B, RNA recognition motif in Trans 4e-06
cd1224273 cd12242, RRM_SLIRP, RNA recognition motif found in 5e-06
cd1230673 cd12306, RRM_II_PABPs, RNA recognition motif in ty 5e-06
cd1235074 cd12350, RRM3_SHARP, RNA recognition motif 3 in SM 5e-06
cd1238280 cd12382, RRM_RBMX_like, RNA recognition motif in h 6e-06
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 6e-06
TIGR01642509 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la 6e-06
cd1255277 cd12552, RRM_Nop15p, RNA recognition motif in yeas 6e-06
cd1232780 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in D 7e-06
COG0724306 COG0724, COG0724, RNA-binding proteins (RRM domain 7e-06
cd1223177 cd12231, RRM2_U2AF65, RNA recognition motif 2 foun 7e-06
cd1239875 cd12398, RRM_CSTF2_RNA15_like, RNA recognition mot 8e-06
cd1236573 cd12365, RRM_RNPS1, RNA recognition motif in RNA-b 8e-06
cd1248279 cd12482, RRM1_hnRNPR, RNA recognition motif 1 in v 8e-06
TIGR01645 612 TIGR01645, half-pint, poly-U binding splicing fact 9e-06
cd1238476 cd12384, RRM_RBM24_RBM38_like, RNA recognition mot 1e-05
cd1232374 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA- 1e-05
cd1252477 cd12524, RRM1_MEI2_like, RNA recognition motif 1 i 1e-05
cd1248379 cd12483, RRM1_hnRNPQ, RNA recognition motif 1 in v 1e-05
cd1237577 cd12375, RRM1_Hu_like, RNA recognition motif 1 in 1e-05
cd1261880 cd12618, RRM2_TIA1, RNA recognition motif 2 in nuc 1e-05
cd1257776 cd12577, RRM1_Hrp1p, RNA recognition motif 1 in ye 2e-05
cd1233075 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in ye 2e-05
cd1230673 cd12306, RRM_II_PABPs, RNA recognition motif in ty 2e-05
cd1223583 cd12235, RRM_PPIL4, RNA recognition motif in pepti 2e-05
cd1267282 cd12672, RRM_DAZL, RNA recognition motif in verteb 2e-05
cd1261780 cd12617, RRM2_TIAR, RNA recognition motif 2 in nuc 2e-05
cd1236774 cd12367, RRM2_RBM45, RNA recognition motif 2 in RN 2e-05
cd1267175 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif i 2e-05
cd1263481 cd12634, RRM2_CELF1_2, RNA recognition motif 2 in 2e-05
cd1237880 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in 2e-05
cd1256084 cd12560, RRM_SRSF12, RNA recognition motif in seri 2e-05
cd1258575 cd12585, RRM2_hnRPDL, RNA recognition motif 2 in h 3e-05
cd1239378 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc 3e-05
cd1258375 cd12583, RRM2_hnRNPD, RNA recognition motif 2 in h 4e-05
cd1227272 cd12272, RRM2_PHIP1, RNA recognition motif 2 in Ar 4e-05
cd1255277 cd12552, RRM_Nop15p, RNA recognition motif in yeas 6e-05
cd1224678 cd12246, RRM1_U1A_like, RNA recognition motif 1 in 6e-05
cd1255984 cd12559, RRM_SRSF10, RNA recognition motif in seri 6e-05
cd1258480 cd12584, RRM2_hnRNPAB, RNA recognition motif 2 in 7e-05
cd1228373 cd12283, RRM1_RBM39_like, RNA recognition motif 1 7e-05
cd1263681 cd12636, RRM2_Bruno_like, RNA recognition motif 2 7e-05
cd1230774 cd12307, RRM_NIFK_like, RNA recognition motif in n 8e-05
TIGR01645 612 TIGR01645, half-pint, poly-U binding splicing fact 8e-05
cd1234481 cd12344, RRM1_SECp43_like, RNA recognition motif 1 8e-05
TIGR01659346 TIGR01659, sex-lethal, sex-lethal family splicing 1e-04
cd1240877 cd12408, RRM_eIF3G_like, RNA recognition motif in 1e-04
cd1267079 cd12670, RRM2_Nop12p_like, RNA recognition motif 2 1e-04
cd1260667 cd12606, RRM1_RBM4, RNA recognition motif 1 in ver 1e-04
cd1246483 cd12464, RRM_G3BP2, RNA recognition motif in ras G 1e-04
cd1265179 cd12651, RRM2_SXL, RNA recognition motif 2 in Dros 1e-04
cd1227172 cd12271, RRM1_PHIP1, RNA recognition motif 1 in Ar 1e-04
cd1234580 cd12345, RRM2_SECp43_like, RNA recognition motif 2 1e-04
cd1237373 cd12373, RRM_SRSF3_like, RNA recognition motif in 1e-04
cd1259375 cd12593, RRM_RBM11, RNA recognition motif in verte 1e-04
cd1257379 cd12573, RRM2_MSI2, RNA recognition motif 2 in RNA 2e-04
cd1240074 cd12400, RRM_Nop6, RNA recognition motif in Saccha 2e-04
cd1236378 cd12363, RRM_TRA2, RNA recognition motif in transf 2e-04
TIGR01661352 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing f 2e-04
cd1237577 cd12375, RRM1_Hu_like, RNA recognition motif 1 in 2e-04
cd1258671 cd12586, RRM1_PSP1, RNA recognition motif 1 in ver 2e-04
cd1277590 cd12775, RRM2_HuB, RNA recognition motif 2 in vert 2e-04
cd1236681 cd12366, RRM1_RBM45, RNA recognition motif 1 in RN 2e-04
cd1235580 cd12355, RRM_RBM18, RNA recognition motif in eukar 2e-04
cd1264279 cd12642, RRM_TRA2A, RNA recognition motif in trans 2e-04
cd1257675 cd12576, RRM1_MSI, RNA recognition motif 1 in RNA- 3e-04
cd1232177 cd12321, RRM1_TDP43, RNA recognition motif 1 in TA 3e-04
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 3e-04
cd1233271 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 3e-04
cd1277481 cd12774, RRM2_HuD, RNA recognition motif 2 in vert 3e-04
cd1240678 cd12406, RRM4_NCL, RNA recognition motif 4 in vert 3e-04
cd1277681 cd12776, RRM2_HuC, RNA recognition motif 2 in vert 3e-04
cd1277284 cd12772, RRM1_HuC, RNA recognition motif 1 in vert 3e-04
cd1238977 cd12389, RRM2_RAVER, RNA recognition motif 2 in ri 3e-04
cd1234366 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 3e-04
cd1237679 cd12376, RRM2_Hu_like, RNA recognition motif 2 in 4e-04
cd1227172 cd12271, RRM1_PHIP1, RNA recognition motif 1 in Ar 4e-04
cd1222384 cd12223, RRM_SR140, RNA recognition motif (RRM) in 4e-04
cd1235473 cd12354, RRM3_TIA1_like, RNA recognition motif 2 i 4e-04
cd1233770 cd12337, RRM1_SRSF4_like, RNA recognition motif 1 4e-04
cd1224371 cd12243, RRM1_MSSP, RNA recognition motif 1 in the 4e-04
cd1257274 cd12572, RRM2_MSI1, RNA recognition motif 2 in RNA 5e-04
cd1241582 cd12415, RRM3_RBM28_like, RNA recognition motif 3 5e-04
cd1238674 cd12386, RRM2_hnRNPM_like, RNA recognition motif 2 5e-04
cd1261474 cd12614, RRM1_PUB1, RNA recognition motif 1 in yea 5e-04
cd1275775 cd12757, RRM1_hnRNPAB, RNA recognition motif 1 in 6e-04
cd1233583 cd12335, RRM2_SF3B4, RNA recognition motif 2 in sp 6e-04
cd1261380 cd12613, RRM2_NGR1_NAM8_like, RNA recognition moti 6e-04
cd1267976 cd12679, RRM_SAFB1_SAFB2, RNA recognition motif in 6e-04
cd1232076 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition mot 6e-04
cd1233474 cd12334, RRM1_SF3B4, RNA recognition motif 1 in sp 6e-04
cd1223177 cd12231, RRM2_U2AF65, RNA recognition motif 2 foun 7e-04
cd1234481 cd12344, RRM1_SECp43_like, RNA recognition motif 1 7e-04
cd1255685 cd12556, RRM2_RBM15B, RNA recognition motif 2 in p 7e-04
cd1237076 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U 7e-04
cd1231674 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition mot 8e-04
cd1223793 cd12237, RRM_snRNP35, RNA recognition motif found 8e-04
cd1245480 cd12454, RRM2_RIM4_like, RNA recognition motif 2 i 8e-04
cd1235789 cd12357, RRM_PPARGC1A_like, RNA recognition motif 8e-04
cd1255177 cd12551, RRM_II_PABPN1L, RNA recognition motif in 8e-04
cd1257482 cd12574, RRM1_DAZAP1, RNA recognition motif 1 in D 0.001
cd1244980 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in 0.001
cd1256679 cd12566, RRM2_MRD1, RNA recognition motif 2 in yea 0.001
cd1236273 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in 0.001
cd1223583 cd12235, RRM_PPIL4, RNA recognition motif in pepti 0.001
cd1236774 cd12367, RRM2_RBM45, RNA recognition motif 2 in RN 0.001
cd1227272 cd12272, RRM2_PHIP1, RNA recognition motif 2 in Ar 0.001
cd1260869 cd12608, RRM1_CoAA, RNA recognition motif 1 in ver 0.001
cd1238772 cd12387, RRM3_hnRNPM_like, RNA recognition motif 3 0.001
cd1247086 cd12470, RRM1_MSSP1, RNA recognition motif 1 in ve 0.001
cd1263581 cd12635, RRM2_CELF3_4_5_6, RNA recognition motif 2 0.001
cd1237778 cd12377, RRM3_Hu, RNA recognition motif 3 in the H 0.001
cd1277183 cd12771, RRM1_HuB, RNA recognition motif 1 in vert 0.001
cd1258771 cd12587, RRM1_PSF, RNA recognition motif 1 in vert 0.001
cd1230979 cd12309, RRM2_Spen, RNA recognition motif 2 in the 0.001
cd1255076 cd12550, RRM_II_PABPN1, RNA recognition motif in t 0.001
cd1240477 cd12404, RRM2_NCL, RNA recognition motif 2 in vert 0.001
cd1241280 cd12412, RRM_DAZL_BOULE, RNA recognition motif in 0.002
cd1255076 cd12550, RRM_II_PABPN1, RNA recognition motif in t 0.002
cd1263184 cd12631, RRM1_CELF1_2_Bruno, RNA recognition motif 0.002
cd1241774 cd12417, RRM_SAFB_like, RNA recognition motif in t 0.002
cd1259570 cd12595, RRM1_SRSF5, RNA recognition motif 1 in ve 0.002
cd1245386 cd12453, RRM1_RIM4_like, RNA recognition motif 1 i 0.002
cd1276076 cd12760, RRM1_MSI2, RNA recognition motif 1 in RNA 0.003
PLN03134144 PLN03134, PLN03134, glycine-rich RNA-binding prote 0.003
cd1234773 cd12347, RRM_PPIE, RNA recognition motif in cyclop 0.003
cd1236177 cd12361, RRM1_2_CELF1-6_like, RNA recognition moti 0.003
cd1264279 cd12642, RRM_TRA2A, RNA recognition motif in trans 0.003
cd1236078 cd12360, RRM_cwf2, RNA recognition motif in yeast 0.003
cd1265279 cd12652, RRM2_Hu, RNA recognition motif 2 in the H 0.003
cd1259474 cd12594, RRM1_SRSF4, RNA recognition motif 1 in ve 0.003
cd1239281 cd12392, RRM2_SART3, RNA recognition motif 2 in sq 0.003
cd1257574 cd12575, RRM1_hnRNPD_like, RNA recognition motif 1 0.004
cd1275876 cd12758, RRM1_hnRPDL, RNA recognition motif 1 in h 0.004
cd1244873 cd12448, RRM2_gar2, RNA recognition motif 2 in yea 0.004
cd1261084 cd12610, RRM1_SECp43, RNA recognition motif 1 in t 0.004
cd1276981 cd12769, RRM1_HuR, RNA recognition motif 1 in vert 0.004
cd1222577 cd12225, RRM1_2_CID8_like, RNA recognition motif 1 0.004
>gnl|CDD|241022 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
 Score =  155 bits (395), Expect = 2e-48
 Identities = 55/78 (70%), Positives = 63/78 (80%)

Query: 45  KLFIGGLDYRTNDDSLKAFFEQWGEIVDVVVMKDPVTKRSRGFGFITYSESKMVDEAMSN 104
           KLFIGGL Y T DDSLK +F QWGEI D VVMKDP TKRSRGFGF+T++ +  VD AM+ 
Sbjct: 1   KLFIGGLSYETTDDSLKNYFSQWGEITDCVVMKDPNTKRSRGFGFVTFASASEVDAAMNA 60

Query: 105 RPHEIDGRVVETKRAVPR 122
           RPH++DGR VE KRAVPR
Sbjct: 61  RPHKVDGREVEPKRAVPR 78


This subfamily corresponds to the RRM1 in hnRNP A0, hnRNP A1, hnRNP A2/B1, hnRNP A3 and similar proteins. hnRNP A0 is a low abundance hnRNP protein that has been implicated in mRNA stability in mammalian cells. It has been identified as the substrate for MAPKAP-K2 and may be involved in the lipopolysaccharide (LPS)-induced post-transcriptional regulation of tumor necrosis factor-alpha (TNF-alpha), cyclooxygenase 2 (COX-2) and macrophage inflammatory protein 2 (MIP-2). hnRNP A1 is an abundant eukaryotic nuclear RNA-binding protein that may modulate splice site selection in pre-mRNA splicing. hnRNP A2/B1 is an RNA trafficking response element-binding protein that interacts with the hnRNP A2 response element (A2RE). Many mRNAs, such as myelin basic protein (MBP), myelin-associated oligodendrocytic basic protein (MOBP), carboxyanhydrase II (CAII), microtubule-associated protein tau, and amyloid precursor protein (APP) are trafficked by hnRNP A2/B1. hnRNP A3 is also a RNA trafficking response element-binding protein that participates in the trafficking of A2RE-containing RNA. The hnRNP A subfamily is characterized by two RNA recognition motifs (RRMs), also termed RBDs (RNA binding domains) or RNPs (ribonucleoprotein domains), followed by a long glycine-rich region at the C-terminus. . Length = 78

>gnl|CDD|241205 cd12761, RRM1_hnRNPA1, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) and similar proteins Back     alignment and domain information
>gnl|CDD|241207 cd12763, RRM1_hnRNPA3, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A3 (hnRNP A3) and similar proteins Back     alignment and domain information
>gnl|CDD|241206 cd12762, RRM1_hnRNPA2B1, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A2/B1 (hnRNP A2/B1) and similar proteins Back     alignment and domain information
>gnl|CDD|240771 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP A and hnRNP D subfamilies and similar proteins Back     alignment and domain information
>gnl|CDD|240772 cd12326, RRM1_hnRNPA0, RNA recognition motif 1 found in heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) and similar proteins Back     alignment and domain information
>gnl|CDD|241018 cd12574, RRM1_DAZAP1, RNA recognition motif 1 in Deleted in azoospermia-associated protein 1 (DAZAP1) and similar proteins Back     alignment and domain information
>gnl|CDD|241021 cd12577, RRM1_Hrp1p, RNA recognition motif 1 in yeast nuclear polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p) and similar proteins Back     alignment and domain information
>gnl|CDD|241020 cd12576, RRM1_MSI, RNA recognition motif 1 in RNA-binding protein Musashi homolog Musashi-1, Musashi-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240773 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in Deleted in azoospermia-associated protein 1 (DAZAP1) and similar proteins Back     alignment and domain information
>gnl|CDD|241204 cd12760, RRM1_MSI2, RNA recognition motif 1 in RNA-binding protein Musashi homolog 2 (Musashi-2 ) and similar proteins Back     alignment and domain information
>gnl|CDD|240776 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in yeast nuclear polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p) and similar proteins Back     alignment and domain information
>gnl|CDD|241019 cd12575, RRM1_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP D0, hnRNP A/B, hnRNP DL and similar proteins Back     alignment and domain information
>gnl|CDD|241203 cd12759, RRM1_MSI1, RNA recognition motif 1 in RNA-binding protein Musashi homolog 1 (Musashi-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins Back     alignment and domain information
>gnl|CDD|241201 cd12757, RRM1_hnRNPAB, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A/B (hnRNP A/B) and similar proteins Back     alignment and domain information
>gnl|CDD|241200 cd12756, RRM1_hnRNPD, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein D0 (hnRNP D0) and similar proteins Back     alignment and domain information
>gnl|CDD|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in eukaryotic RNA-binding protein RBM24, RBM38 and similar proteins Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240774 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|241202 cd12758, RRM1_hnRPDL, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein D-like (hnRNP D-like or hnRNP DL) and similar proteins Back     alignment and domain information
>gnl|CDD|240767 cd12321, RRM1_TDP43, RNA recognition motif 1 in TAR DNA-binding protein 43 (TDP-43) and similar proteins Back     alignment and domain information
>gnl|CDD|240895 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in cold inducible RNA binding protein (CIRBP), RNA binding motif protein 3 (RBM3) and similar proteins Back     alignment and domain information
>gnl|CDD|240769 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA-binding protein Musashi homologs Musashi-1, Musashi-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240775 cd12329, RRM2_hnRNPD_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein hnRNP D0, hnRNP A/B, hnRNP DL and similar proteins Back     alignment and domain information
>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|241017 cd12573, RRM2_MSI2, RNA recognition motif 2 in RNA-binding protein Musashi homolog 2 (Musashi-2) and similar proteins Back     alignment and domain information
>gnl|CDD|241016 cd12572, RRM2_MSI1, RNA recognition motif 2 in RNA-binding protein Musashi homolog 1 (Musashi-1) and similar proteins Back     alignment and domain information
>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>gnl|CDD|240893 cd12447, RRM1_gar2, RNA recognition motif 1 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|178680 PLN03134, PLN03134, glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>gnl|CDD|241024 cd12580, RRM2_hnRNPA1, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) and similar proteins Back     alignment and domain information
>gnl|CDD|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate RNA-binding protein RBM23, RBM39 and similar proteins Back     alignment and domain information
>gnl|CDD|241025 cd12581, RRM2_hnRNPA2B1, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A2/B1 (hnRNP A2/B1) and similar proteins Back     alignment and domain information
>gnl|CDD|240774 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|241026 cd12582, RRM2_hnRNPA3, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A3 (hnRNP A3) and similar proteins Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|240757 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in serine/arginine-rich splicing factor SRSF2, SRSF8 and similar proteins Back     alignment and domain information
>gnl|CDD|241023 cd12579, RRM2_hnRNPA0, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) and similar proteins Back     alignment and domain information
>gnl|CDD|241028 cd12584, RRM2_hnRNPAB, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A/B (hnRNP A/B) and similar proteins Back     alignment and domain information
>gnl|CDD|241025 cd12581, RRM2_hnRNPA2B1, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A2/B1 (hnRNP A2/B1) and similar proteins Back     alignment and domain information
>gnl|CDD|241026 cd12582, RRM2_hnRNPA3, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A3 (hnRNP A3) and similar proteins Back     alignment and domain information
>gnl|CDD|240857 cd12411, RRM_ist3_like, RNA recognition motif in ist3 family Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|240793 cd12347, RRM_PPIE, RNA recognition motif in cyclophilin-33 (Cyp33) and similar proteins Back     alignment and domain information
>gnl|CDD|240768 cd12322, RRM2_TDP43, RNA recognition motif 2 in TAR DNA-binding protein 43 (TDP-43) and similar proteins Back     alignment and domain information
>gnl|CDD|240807 cd12361, RRM1_2_CELF1-6_like, RNA recognition motif 1 and 2 in CELF/Bruno-like family of RNA binding proteins and plant flowering time control protein FCA Back     alignment and domain information
>gnl|CDD|241024 cd12580, RRM2_hnRNPA1, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) and similar proteins Back     alignment and domain information
>gnl|CDD|240759 cd12313, RRM1_RRM2_RBM5_like, RNA recognition motif 1 and 2 in RNA-binding protein 5 (RBM5) and similar proteins Back     alignment and domain information
>gnl|CDD|240762 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and RNA recognition motif 2 found in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|240682 cd12236, RRM_snRNP70, RNA recognition motif in U1 small nuclear ribonucleoprotein 70 kDa (U1-70K) and similar proteins Back     alignment and domain information
>gnl|CDD|241118 cd12674, RRM1_Nop4p, RNA recognition motif 1 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|241029 cd12585, RRM2_hnRPDL, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein D-like (hnRNP DL) and similar proteins Back     alignment and domain information
>gnl|CDD|240826 cd12380, RRM3_I_PABPs, RNA recognition motif 3 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240775 cd12329, RRM2_hnRNPD_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein hnRNP D0, hnRNP A/B, hnRNP DL and similar proteins Back     alignment and domain information
>gnl|CDD|240858 cd12412, RRM_DAZL_BOULE, RNA recognition motif in AZoospermia (DAZ) autosomal homologs, DAZL (DAZ-like) and BOULE Back     alignment and domain information
>gnl|CDD|240675 cd12229, RRM_G3BP, RNA recognition motif (RRM) in ras GTPase-activating protein-binding protein G3BP1, G3BP2 and similar proteins Back     alignment and domain information
>gnl|CDD|240896 cd12450, RRM1_NUCLs, RNA recognition motif 1 found in nucleolin-like proteins mainly from plants Back     alignment and domain information
>gnl|CDD|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins Back     alignment and domain information
>gnl|CDD|240894 cd12448, RRM2_gar2, RNA recognition motif 2 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|240799 cd12353, RRM2_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|240771 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP A and hnRNP D subfamilies and similar proteins Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|240829 cd12383, RRM_RBM42, RNA recognition motif in RNA-binding protein 42 (RBM42) and similar proteins Back     alignment and domain information
>gnl|CDD|240744 cd12298, RRM3_Prp24, RNA recognition motif 3 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|241023 cd12579, RRM2_hnRNPA0, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) and similar proteins Back     alignment and domain information
>gnl|CDD|240837 cd12391, RRM1_SART3, RNA recognition motif 1 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|240859 cd12413, RRM1_RBM28_like, RNA recognition motif 1 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240844 cd12398, RRM_CSTF2_RNA15_like, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), yeast ortholog mRNA 3'-end-processing protein RNA15 and similar proteins Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240781 cd12335, RRM2_SF3B4, RNA recognition motif 2 in splicing factor 3B subunit 4 (SF3B4) and similar proteins Back     alignment and domain information
>gnl|CDD|240846 cd12400, RRM_Nop6, RNA recognition motif in Saccharomyces cerevisiae nucleolar protein 6 (Nop6) and similar proteins Back     alignment and domain information
>gnl|CDD|241027 cd12583, RRM2_hnRNPD, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein D0 (hnRNP D0) and similar proteins Back     alignment and domain information
>gnl|CDD|240683 cd12237, RRM_snRNP35, RNA recognition motif found in U11/U12 small nuclear ribonucleoprotein 35 kDa protein (U11/U12-35K) and similar proteins Back     alignment and domain information
>gnl|CDD|240809 cd12363, RRM_TRA2, RNA recognition motif in transformer-2 protein homolog TRA2-alpha, TRA2-beta and similar proteins Back     alignment and domain information
>gnl|CDD|240817 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|241011 cd12567, RRM3_RBM19, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|240841 cd12395, RRM2_RBM34, RNA recognition motif 2 in RNA-binding protein 34 (RBM34) and similar proteins Back     alignment and domain information
>gnl|CDD|233515 TIGR01659, sex-lethal, sex-lethal family splicing factor Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|240827 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240853 cd12407, RRM_FOX1_like, RNA recognition motif in vertebrate RNA binding protein fox-1 homologs and similar proteins Back     alignment and domain information
>gnl|CDD|241063 cd12619, RRM2_PUB1, RNA recognition motif 2 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|241120 cd12676, RRM3_Nop4p, RNA recognition motif 3 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|241076 cd12632, RRM1_CELF3_4_5_6, RNA recognition motif 1 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins Back     alignment and domain information
>gnl|CDD|240753 cd12307, RRM_NIFK_like, RNA recognition motif in nucleolar protein interacting with the FHA domain of pKI-67 (NIFK) and similar proteins Back     alignment and domain information
>gnl|CDD|240682 cd12236, RRM_snRNP70, RNA recognition motif in U1 small nuclear ribonucleoprotein 70 kDa (U1-70K) and similar proteins Back     alignment and domain information
>gnl|CDD|240782 cd12336, RRM_RBM7_like, RNA recognition motif in RNA-binding protein 7 (RBM7) and similar proteins Back     alignment and domain information
>gnl|CDD|240792 cd12346, RRM3_NGR1_NAM8_like, RNA recognition motif 3 in yeast negative growth regulatory protein NGR1 (RBP1), yeast protein NAM8 and similar proteins Back     alignment and domain information
>gnl|CDD|241010 cd12566, RRM2_MRD1, RNA recognition motif 2 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|240808 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in CELF/Bruno-like family of RNA binding proteins CELF1, CELF2, CELF3, CELF4, CELF5, CELF6 and similar proteins Back     alignment and domain information
>gnl|CDD|240822 cd12376, RRM2_Hu_like, RNA recognition motif 2 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|241009 cd12565, RRM1_MRD1, RNA recognition motif 1 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240688 cd12242, RRM_SLIRP, RNA recognition motif found in SRA stem-loop-interacting RNA-binding protein (SLIRP) and similar proteins Back     alignment and domain information
>gnl|CDD|240860 cd12414, RRM2_RBM28_like, RNA recognition motif 2 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240758 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif in serine/arginine-rich splicing factor SRSF10, SRSF12 and similar proteins Back     alignment and domain information
>gnl|CDD|240857 cd12411, RRM_ist3_like, RNA recognition motif in ist3 family Back     alignment and domain information
>gnl|CDD|240811 cd12365, RRM_RNPS1, RNA recognition motif in RNA-binding protein with serine-rich domain 1 (RNPS1) and similar proteins Back     alignment and domain information
>gnl|CDD|241117 cd12673, RRM_BOULE, RNA recognition motif in protein BOULE Back     alignment and domain information
>gnl|CDD|240764 cd12318, RRM5_RBM19_like, RNA recognition motif 5 in RNA-binding protein 19 (RBM19 or RBD-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240843 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 2 in yeast nucleolar protein 13 (Nop13p) and similar proteins Back     alignment and domain information
>gnl|CDD|241077 cd12633, RRM1_FCA, RNA recognition motif 1 in plant flowering time control protein FCA and similar proteins Back     alignment and domain information
>gnl|CDD|241081 cd12637, RRM2_FCA, RNA recognition motif 2 in plant flowering time control protein FCA and similar proteins Back     alignment and domain information
>gnl|CDD|240897 cd12451, RRM2_NUCLs, RNA recognition motif 2 in nucleolin-like proteins mainly from plants Back     alignment and domain information
>gnl|CDD|240854 cd12408, RRM_eIF3G_like, RNA recognition motif in eukaryotic translation initiation factor 3 subunit G (eIF-3G) and similar proteins Back     alignment and domain information
>gnl|CDD|240909 cd12463, RRM_G3BP1, RNA recognition motif found in ras GTPase-activating protein-binding protein 1 (G3BP1) and similar proteins Back     alignment and domain information
>gnl|CDD|241114 cd12670, RRM2_Nop12p_like, RNA recognition motif 2 in yeast nucleolar protein 12 (Nop12p) and similar proteins Back     alignment and domain information
>gnl|CDD|241085 cd12641, RRM_TRA2B, RNA recognition motif in Transformer-2 protein homolog beta (TRA-2 beta) and similar proteins Back     alignment and domain information
>gnl|CDD|240688 cd12242, RRM_SLIRP, RNA recognition motif found in SRA stem-loop-interacting RNA-binding protein (SLIRP) and similar proteins Back     alignment and domain information
>gnl|CDD|240752 cd12306, RRM_II_PABPs, RNA recognition motif in type II polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240796 cd12350, RRM3_SHARP, RNA recognition motif 3 in SMART/HDAC1-associated repressor protein (SHARP) and similar proteins Back     alignment and domain information
>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>gnl|CDD|240996 cd12552, RRM_Nop15p, RNA recognition motif in yeast ribosome biogenesis protein 15 (Nop15p) and similar proteins Back     alignment and domain information
>gnl|CDD|240773 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in Deleted in azoospermia-associated protein 1 (DAZAP1) and similar proteins Back     alignment and domain information
>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>gnl|CDD|240677 cd12231, RRM2_U2AF65, RNA recognition motif 2 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins Back     alignment and domain information
>gnl|CDD|240844 cd12398, RRM_CSTF2_RNA15_like, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), yeast ortholog mRNA 3'-end-processing protein RNA15 and similar proteins Back     alignment and domain information
>gnl|CDD|240811 cd12365, RRM_RNPS1, RNA recognition motif in RNA-binding protein with serine-rich domain 1 (RNPS1) and similar proteins Back     alignment and domain information
>gnl|CDD|240926 cd12482, RRM1_hnRNPR, RNA recognition motif 1 in vertebrate heterogeneous nuclear ribonucleoprotein R (hnRNP R) Back     alignment and domain information
>gnl|CDD|130706 TIGR01645, half-pint, poly-U binding splicing factor, half-pint family Back     alignment and domain information
>gnl|CDD|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in eukaryotic RNA-binding protein RBM24, RBM38 and similar proteins Back     alignment and domain information
>gnl|CDD|240769 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA-binding protein Musashi homologs Musashi-1, Musashi-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240968 cd12524, RRM1_MEI2_like, RNA recognition motif 1 in plant Mei2-like proteins Back     alignment and domain information
>gnl|CDD|240927 cd12483, RRM1_hnRNPQ, RNA recognition motif 1 in vertebrate heterogeneous nuclear ribonucleoprotein Q (hnRNP Q) Back     alignment and domain information
>gnl|CDD|240821 cd12375, RRM1_Hu_like, RNA recognition motif 1 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|241062 cd12618, RRM2_TIA1, RNA recognition motif 2 in nucleolysin TIA-1 isoform p40 (p40-TIA-1) and similar proteins Back     alignment and domain information
>gnl|CDD|241021 cd12577, RRM1_Hrp1p, RNA recognition motif 1 in yeast nuclear polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240776 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in yeast nuclear polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240752 cd12306, RRM_II_PABPs, RNA recognition motif in type II polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240681 cd12235, RRM_PPIL4, RNA recognition motif in peptidyl-prolyl cis-trans isomerase-like 4 (PPIase) and similar proteins Back     alignment and domain information
>gnl|CDD|241116 cd12672, RRM_DAZL, RNA recognition motif in vertebrate deleted in azoospermia-like (DAZL) proteins Back     alignment and domain information
>gnl|CDD|241061 cd12617, RRM2_TIAR, RNA recognition motif 2 in nucleolysin TIAR and similar proteins Back     alignment and domain information
>gnl|CDD|240813 cd12367, RRM2_RBM45, RNA recognition motif 2 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|241115 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), cleavage stimulation factor subunit 2 tau variant (CSTF2T) and similar proteins Back     alignment and domain information
>gnl|CDD|241078 cd12634, RRM2_CELF1_2, RNA recognition motif 2 in CUGBP Elav-like family member CELF-1, CELF-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240824 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|241004 cd12560, RRM_SRSF12, RNA recognition motif in serine/arginine-rich splicing factor 12 (SRSF12) and similar proteins Back     alignment and domain information
>gnl|CDD|241029 cd12585, RRM2_hnRPDL, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein D-like (hnRNP DL) and similar proteins Back     alignment and domain information
>gnl|CDD|240839 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc finger CCHC-type and RNA-binding motif-containing protein 1 (ZCRB1) and similar proteins Back     alignment and domain information
>gnl|CDD|241027 cd12583, RRM2_hnRNPD, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein D0 (hnRNP D0) and similar proteins Back     alignment and domain information
>gnl|CDD|240718 cd12272, RRM2_PHIP1, RNA recognition motif 2 in Arabidopsis thaliana phragmoplastin interacting protein 1 (PHIP1) and similar proteins Back     alignment and domain information
>gnl|CDD|240996 cd12552, RRM_Nop15p, RNA recognition motif in yeast ribosome biogenesis protein 15 (Nop15p) and similar proteins Back     alignment and domain information
>gnl|CDD|240692 cd12246, RRM1_U1A_like, RNA recognition motif 1 in the U1A/U2B"/SNF protein family Back     alignment and domain information
>gnl|CDD|241003 cd12559, RRM_SRSF10, RNA recognition motif in serine/arginine-rich splicing factor 10 (SRSF10) and similar proteins Back     alignment and domain information
>gnl|CDD|241028 cd12584, RRM2_hnRNPAB, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A/B (hnRNP A/B) and similar proteins Back     alignment and domain information
>gnl|CDD|240729 cd12283, RRM1_RBM39_like, RNA recognition motif 1 in vertebrate RNA-binding protein 39 (RBM39) and similar proteins Back     alignment and domain information
>gnl|CDD|241080 cd12636, RRM2_Bruno_like, RNA recognition motif 2 in Drosophila melanogaster Bruno protein and similar proteins Back     alignment and domain information
>gnl|CDD|240753 cd12307, RRM_NIFK_like, RNA recognition motif in nucleolar protein interacting with the FHA domain of pKI-67 (NIFK) and similar proteins Back     alignment and domain information
>gnl|CDD|130706 TIGR01645, half-pint, poly-U binding splicing factor, half-pint family Back     alignment and domain information
>gnl|CDD|240790 cd12344, RRM1_SECp43_like, RNA recognition motif 1 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins Back     alignment and domain information
>gnl|CDD|233515 TIGR01659, sex-lethal, sex-lethal family splicing factor Back     alignment and domain information
>gnl|CDD|240854 cd12408, RRM_eIF3G_like, RNA recognition motif in eukaryotic translation initiation factor 3 subunit G (eIF-3G) and similar proteins Back     alignment and domain information
>gnl|CDD|241114 cd12670, RRM2_Nop12p_like, RNA recognition motif 2 in yeast nucleolar protein 12 (Nop12p) and similar proteins Back     alignment and domain information
>gnl|CDD|241050 cd12606, RRM1_RBM4, RNA recognition motif 1 in vertebrate RNA-binding protein 4 (RBM4) Back     alignment and domain information
>gnl|CDD|240910 cd12464, RRM_G3BP2, RNA recognition motif in ras GTPase-activating protein-binding protein 2 (G3BP2) and similar proteins Back     alignment and domain information
>gnl|CDD|241095 cd12651, RRM2_SXL, RNA recognition motif 2 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|240717 cd12271, RRM1_PHIP1, RNA recognition motif 1 in Arabidopsis thaliana phragmoplastin interacting protein 1 (PHIP1) and similar proteins Back     alignment and domain information
>gnl|CDD|240791 cd12345, RRM2_SECp43_like, RNA recognition motif 2 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins Back     alignment and domain information
>gnl|CDD|240819 cd12373, RRM_SRSF3_like, RNA recognition motif in serine/arginine-rich splicing factor 3 (SRSF3) and similar proteins Back     alignment and domain information
>gnl|CDD|241037 cd12593, RRM_RBM11, RNA recognition motif in vertebrate RNA-binding protein 11 (RBM11) Back     alignment and domain information
>gnl|CDD|241017 cd12573, RRM2_MSI2, RNA recognition motif 2 in RNA-binding protein Musashi homolog 2 (Musashi-2) and similar proteins Back     alignment and domain information
>gnl|CDD|240846 cd12400, RRM_Nop6, RNA recognition motif in Saccharomyces cerevisiae nucleolar protein 6 (Nop6) and similar proteins Back     alignment and domain information
>gnl|CDD|240809 cd12363, RRM_TRA2, RNA recognition motif in transformer-2 protein homolog TRA2-alpha, TRA2-beta and similar proteins Back     alignment and domain information
>gnl|CDD|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor Back     alignment and domain information
>gnl|CDD|240821 cd12375, RRM1_Hu_like, RNA recognition motif 1 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|241030 cd12586, RRM1_PSP1, RNA recognition motif 1 in vertebrate paraspeckle protein 1 (PSP1) Back     alignment and domain information
>gnl|CDD|241219 cd12775, RRM2_HuB, RNA recognition motif 2 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|240812 cd12366, RRM1_RBM45, RNA recognition motif 1 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|240801 cd12355, RRM_RBM18, RNA recognition motif in eukaryotic RNA-binding protein 18 and similar proteins Back     alignment and domain information
>gnl|CDD|241086 cd12642, RRM_TRA2A, RNA recognition motif in transformer-2 protein homolog alpha (TRA-2 alpha) and similar proteins Back     alignment and domain information
>gnl|CDD|241020 cd12576, RRM1_MSI, RNA recognition motif 1 in RNA-binding protein Musashi homolog Musashi-1, Musashi-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240767 cd12321, RRM1_TDP43, RNA recognition motif 1 in TAR DNA-binding protein 43 (TDP-43) and similar proteins Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|240778 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 in the p54nrb/PSF/PSP1 family Back     alignment and domain information
>gnl|CDD|241218 cd12774, RRM2_HuD, RNA recognition motif 2 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|240852 cd12406, RRM4_NCL, RNA recognition motif 4 in vertebrate nucleolin Back     alignment and domain information
>gnl|CDD|241220 cd12776, RRM2_HuC, RNA recognition motif 2 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|241216 cd12772, RRM1_HuC, RNA recognition motif 1 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|240835 cd12389, RRM2_RAVER, RNA recognition motif 2 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240789 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 and 2 in RRM-containing coactivator activator/modulator (CoAA) and similar proteins Back     alignment and domain information
>gnl|CDD|240822 cd12376, RRM2_Hu_like, RNA recognition motif 2 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|240717 cd12271, RRM1_PHIP1, RNA recognition motif 1 in Arabidopsis thaliana phragmoplastin interacting protein 1 (PHIP1) and similar proteins Back     alignment and domain information
>gnl|CDD|240669 cd12223, RRM_SR140, RNA recognition motif (RRM) in U2-associated protein SR140 and similar proteins Back     alignment and domain information
>gnl|CDD|240800 cd12354, RRM3_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins (p40-TIA-1 and TIAR), and yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 Back     alignment and domain information
>gnl|CDD|240783 cd12337, RRM1_SRSF4_like, RNA recognition motif 1 in serine/arginine-rich splicing factor 4 (SRSF4) and similar proteins Back     alignment and domain information
>gnl|CDD|240689 cd12243, RRM1_MSSP, RNA recognition motif 1 in the c-myc gene single-strand binding proteins (MSSP) family Back     alignment and domain information
>gnl|CDD|241016 cd12572, RRM2_MSI1, RNA recognition motif 2 in RNA-binding protein Musashi homolog 1 (Musashi-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240832 cd12386, RRM2_hnRNPM_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein M (hnRNP M) and similar proteins Back     alignment and domain information
>gnl|CDD|241058 cd12614, RRM1_PUB1, RNA recognition motif 1 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|241201 cd12757, RRM1_hnRNPAB, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A/B (hnRNP A/B) and similar proteins Back     alignment and domain information
>gnl|CDD|240781 cd12335, RRM2_SF3B4, RNA recognition motif 2 in splicing factor 3B subunit 4 (SF3B4) and similar proteins Back     alignment and domain information
>gnl|CDD|241057 cd12613, RRM2_NGR1_NAM8_like, RNA recognition motif 2 in yeast negative growth regulatory protein NGR1, yeast protein NAM8 and similar proteins Back     alignment and domain information
>gnl|CDD|241123 cd12679, RRM_SAFB1_SAFB2, RNA recognition motif in scaffold attachment factor B1 (SAFB1), scaffold attachment factor B2 (SAFB2), and similar proteins Back     alignment and domain information
>gnl|CDD|240766 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition motif 6 in RNA-binding protein 19 (RBM19 or RBD-1) and RNA recognition motif 5 in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|240780 cd12334, RRM1_SF3B4, RNA recognition motif 1 in splicing factor 3B subunit 4 (SF3B4) and similar proteins Back     alignment and domain information
>gnl|CDD|240677 cd12231, RRM2_U2AF65, RNA recognition motif 2 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins Back     alignment and domain information
>gnl|CDD|240790 cd12344, RRM1_SECp43_like, RNA recognition motif 1 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins Back     alignment and domain information
>gnl|CDD|241000 cd12556, RRM2_RBM15B, RNA recognition motif 2 in putative RNA binding motif protein 15B (RBM15B) from vertebrate Back     alignment and domain information
>gnl|CDD|240816 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|240762 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and RNA recognition motif 2 found in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|240683 cd12237, RRM_snRNP35, RNA recognition motif found in U11/U12 small nuclear ribonucleoprotein 35 kDa protein (U11/U12-35K) and similar proteins Back     alignment and domain information
>gnl|CDD|240900 cd12454, RRM2_RIM4_like, RNA recognition motif 2 in yeast meiotic activator RIM4 and similar proteins Back     alignment and domain information
>gnl|CDD|240803 cd12357, RRM_PPARGC1A_like, RNA recognition motif in the peroxisome proliferator-activated receptor gamma coactivator 1A (PGC-1alpha) family of regulated coactivators Back     alignment and domain information
>gnl|CDD|240995 cd12551, RRM_II_PABPN1L, RNA recognition motif in vertebrate type II embryonic polyadenylate-binding protein 2 (ePABP-2) Back     alignment and domain information
>gnl|CDD|241018 cd12574, RRM1_DAZAP1, RNA recognition motif 1 in Deleted in azoospermia-associated protein 1 (DAZAP1) and similar proteins Back     alignment and domain information
>gnl|CDD|240895 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in cold inducible RNA binding protein (CIRBP), RNA binding motif protein 3 (RBM3) and similar proteins Back     alignment and domain information
>gnl|CDD|241010 cd12566, RRM2_MRD1, RNA recognition motif 2 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240808 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in CELF/Bruno-like family of RNA binding proteins CELF1, CELF2, CELF3, CELF4, CELF5, CELF6 and similar proteins Back     alignment and domain information
>gnl|CDD|240681 cd12235, RRM_PPIL4, RNA recognition motif in peptidyl-prolyl cis-trans isomerase-like 4 (PPIase) and similar proteins Back     alignment and domain information
>gnl|CDD|240813 cd12367, RRM2_RBM45, RNA recognition motif 2 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|240718 cd12272, RRM2_PHIP1, RNA recognition motif 2 in Arabidopsis thaliana phragmoplastin interacting protein 1 (PHIP1) and similar proteins Back     alignment and domain information
>gnl|CDD|241052 cd12608, RRM1_CoAA, RNA recognition motif 1 in vertebrate RRM-containing coactivator activator/modulator (CoAA) Back     alignment and domain information
>gnl|CDD|240833 cd12387, RRM3_hnRNPM_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein M (hnRNP M) and similar proteins Back     alignment and domain information
>gnl|CDD|240914 cd12470, RRM1_MSSP1, RNA recognition motif 1 in vertebrate single-stranded DNA-binding protein MSSP-1 Back     alignment and domain information
>gnl|CDD|241079 cd12635, RRM2_CELF3_4_5_6, RNA recognition motif 2 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins Back     alignment and domain information
>gnl|CDD|240823 cd12377, RRM3_Hu, RNA recognition motif 3 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|241215 cd12771, RRM1_HuB, RNA recognition motif 1 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|241031 cd12587, RRM1_PSF, RNA recognition motif 1 in vertebrate polypyrimidine tract-binding protein (PTB)-associated-splicing factor (PSF) Back     alignment and domain information
>gnl|CDD|240755 cd12309, RRM2_Spen, RNA recognition motif 2 in the Spen (split end) protein family Back     alignment and domain information
>gnl|CDD|240994 cd12550, RRM_II_PABPN1, RNA recognition motif in type II polyadenylate-binding protein 2 (PABP-2) and similar proteins Back     alignment and domain information
>gnl|CDD|240850 cd12404, RRM2_NCL, RNA recognition motif 2 in vertebrate nucleolin Back     alignment and domain information
>gnl|CDD|240858 cd12412, RRM_DAZL_BOULE, RNA recognition motif in AZoospermia (DAZ) autosomal homologs, DAZL (DAZ-like) and BOULE Back     alignment and domain information
>gnl|CDD|240994 cd12550, RRM_II_PABPN1, RNA recognition motif in type II polyadenylate-binding protein 2 (PABP-2) and similar proteins Back     alignment and domain information
>gnl|CDD|241075 cd12631, RRM1_CELF1_2_Bruno, RNA recognition motif 1 in CUGBP Elav-like family member CELF-1, CELF-2, Drosophila melanogaster Bruno protein and similar proteins Back     alignment and domain information
>gnl|CDD|240863 cd12417, RRM_SAFB_like, RNA recognition motif in the scaffold attachment factor (SAFB) family Back     alignment and domain information
>gnl|CDD|241039 cd12595, RRM1_SRSF5, RNA recognition motif 1 in vertebrate serine/arginine-rich splicing factor 5 (SRSF5) Back     alignment and domain information
>gnl|CDD|240899 cd12453, RRM1_RIM4_like, RNA recognition motif 1 in yeast meiotic activator RIM4 and similar proteins Back     alignment and domain information
>gnl|CDD|241204 cd12760, RRM1_MSI2, RNA recognition motif 1 in RNA-binding protein Musashi homolog 2 (Musashi-2 ) and similar proteins Back     alignment and domain information
>gnl|CDD|178680 PLN03134, PLN03134, glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>gnl|CDD|240793 cd12347, RRM_PPIE, RNA recognition motif in cyclophilin-33 (Cyp33) and similar proteins Back     alignment and domain information
>gnl|CDD|240807 cd12361, RRM1_2_CELF1-6_like, RNA recognition motif 1 and 2 in CELF/Bruno-like family of RNA binding proteins and plant flowering time control protein FCA Back     alignment and domain information
>gnl|CDD|241086 cd12642, RRM_TRA2A, RNA recognition motif in transformer-2 protein homolog alpha (TRA-2 alpha) and similar proteins Back     alignment and domain information
>gnl|CDD|240806 cd12360, RRM_cwf2, RNA recognition motif in yeast pre-mRNA-splicing factor Cwc2 and similar proteins Back     alignment and domain information
>gnl|CDD|241096 cd12652, RRM2_Hu, RNA recognition motif 2 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|241038 cd12594, RRM1_SRSF4, RNA recognition motif 1 in vertebrate serine/arginine-rich splicing factor 4 (SRSF4) Back     alignment and domain information
>gnl|CDD|240838 cd12392, RRM2_SART3, RNA recognition motif 2 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|241019 cd12575, RRM1_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP D0, hnRNP A/B, hnRNP DL and similar proteins Back     alignment and domain information
>gnl|CDD|241202 cd12758, RRM1_hnRPDL, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein D-like (hnRNP D-like or hnRNP DL) and similar proteins Back     alignment and domain information
>gnl|CDD|240894 cd12448, RRM2_gar2, RNA recognition motif 2 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|241054 cd12610, RRM1_SECp43, RNA recognition motif 1 in tRNA selenocysteine-associated protein 1 (SECp43) Back     alignment and domain information
>gnl|CDD|241213 cd12769, RRM1_HuR, RNA recognition motif 1 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|240671 cd12225, RRM1_2_CID8_like, RNA recognition motif 1 and 2 (RRM1, RRM2) in Arabidopsis thaliana CTC-interacting domain protein CID8, CID9, CID10, CID11, CID12, CID 13 and similar proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query306
2lyv_A197 Solution Structure Of The Two Rrm Domains Of Hnrnp 9e-38
1l3k_A196 Up1, The Two Rna-Recognition Motif Domain Of Hnrnp 9e-38
1pgz_A195 Crystal Structure Of Up1 Complexed With D(Ttagggtta 9e-38
2up1_A183 Structure Of Up1-Telomeric Dna Complex Length = 183 1e-37
1ha1_A184 Hnrnp A1 (Rbd1,2) From Homo Sapiens Length = 184 1e-37
1up1_A182 Up1, The Two Rna-Recognition Motif Domain Of Hnrnp 1e-37
1x4b_A116 Solution Structure Of Rrm Domain In Heterogeneous N 6e-28
2cjk_A167 Structure Of The Rna Binding Domain Of Hrp1 In Comp 5e-23
2dh8_A105 Solution Structure Of The N-Terminal Rna Binding Do 1e-19
2rs2_A109 1h, 13c, And 15n Chemical Shift Assignments For Mus 7e-18
1uaw_A77 Solution Structure Of The N-Terminal Rna-Binding Do 4e-16
1hd0_A75 Heterogeneous Nuclear Ribonucleoprotein D0 (Hnrnp D 4e-16
3s7r_A87 Crystal Structure Of A Heterogeneous Nuclear Ribonu 1e-14
2dgs_A99 Solution Structure Of The Second Rna Binding Domain 3e-13
2mss_A75 Musashi1 Rbd2, Nmr Length = 75 8e-12
1x5s_A102 Solution Structure Of Rrm Domain In A18 Hnrnp Lengt 1e-11
2cqd_A116 Solution Structure Of The Rna Recognition Motif In 1e-10
1fnx_H174 Solution Structure Of The Huc Rbd1-Rbd2 Complexed W 8e-09
2dnz_A95 Solution Structure Of The Second Rna Binding Domain 2e-08
2cqg_A103 Solution Structure Of The Rna Binding Domain Of Tar 4e-08
2lea_A135 Solution Structure Of Human Srsf2 (Sc35) Rrm Length 6e-08
2jrs_A108 Solution Nmr Structure Of Caper Rrm2 Domain. Northe 9e-08
2kn4_A158 The Structure Of The Rrm Domain Of Sc35 Length = 15 1e-07
2fy1_A116 A Dual Mode Of Rna Recognition By The Rbmy Protein 2e-07
1fxl_A167 Crystal Structure Of Hud And Au-Rich Element Of The 2e-07
2yh0_A198 Solution Structure Of The Closed Conformation Of Hu 1e-06
2dnm_A103 Solution Structure Of Rna Binding Domain In Srp46 S 1e-06
2qfj_A216 Crystal Structure Of First Two Rrm Domains Of Fir B 2e-06
2qfj_A216 Crystal Structure Of First Two Rrm Domains Of Fir B 4e-05
2kxf_A199 Solution Structure Of The First Two Rrm Domains Of 2e-06
2kxf_A199 Solution Structure Of The First Two Rrm Domains Of 6e-05
1wtb_A79 Complex Structure Of The C-Terminal Rna-Binding Dom 2e-06
3uwt_A200 Crystal Structure Of A Rna Binding Domain Of Poly-U 2e-06
3uwt_A200 Crystal Structure Of A Rna Binding Domain Of Poly-U 4e-05
2ki2_A90 Solution Structure Of Ss-Dna Binding Protein 12rnp2 8e-06
4egl_A177 Crystal Structure Of Two Tandem Rna Recognition Mot 1e-05
1p1t_A104 Nmr Structure Of The N-Terminal Rrm Domain Of Cleav 1e-05
4ed5_A177 Crystal Structure Of The Two N-Terminal Rrm Domains 2e-05
1iqt_A75 Solution Structure Of The C-Terminal Rna-Binding Do 2e-05
2dgp_A106 Solution Structure Of The N-Terminal Rna Binding Do 2e-05
2cqb_A102 Solution Structure Of The Rna Recognition Motif In 2e-05
3md3_A166 Crystal Structure Of The First Two Rrm Domains Of Y 3e-05
3vaf_A174 Structure Of U2af65 Variant With Bru3 Dna Length = 4e-05
2g4b_A172 Structure Of U2af65 Variant With Polyuridine Tract 4e-05
2u2f_A85 Solution Structure Of The Second Rna-Binding Domain 6e-05
1u6f_A139 Nmr Solution Structure Of Tcubp1, A Single Rbd-Unit 6e-05
3sde_A261 Crystal Structure Of A Paraspeckle-Protein Heterodi 6e-05
2kxn_B129 Nmr Structure Of Human Tra2beta1 Rrm In Complex Wit 7e-05
2dnk_A105 Solution Structure Of Rna Binding Domain In Bruno-L 7e-05
2rra_A99 Solution Structure Of Rna Binding Domain In Human T 7e-05
2err_A109 Nmr Structure Of The Rna Binding Domain Of Human Fo 9e-05
2cqc_A95 Solution Structure Of The Rna Recognition Motif In 9e-05
3nnc_A175 Crystal Structure Of Cugbp1 Rrm12-Rna Complex Lengt 1e-04
2dhs_A187 Solution Structure Of Nucleic Acid Binding Protein 2e-04
2rrb_A96 Refinement Of Rna Binding Domain In Human Tra2 Beta 2e-04
2cq3_A103 Solution Structure Of Rna Binding Domain In Rna Bin 2e-04
2ku7_A140 Solution Structure Of Mll1 Phd3-Cyp33 Rrm Chimeric 2e-04
3mdf_A85 Crystal Structure Of The Rrm Domain Of Cyclophilin 2e-04
3lpy_A79 Crystal Structure Of The Rrm Domain Of Cyp33 Length 2e-04
2dgq_A108 Solution Structure Of The N-Terminal Rna Binding Do 3e-04
1b7f_A168 Sxl-Lethal ProteinRNA COMPLEX Length = 168 3e-04
2jwn_A124 Solution Nmr Structure Of The Protease-Resistent Do 3e-04
2d9p_A103 Solution Structure Of Rna Binding Domain 4 In Polya 3e-04
2kyx_A83 Solution Structure Of The Rrm Domain Of Cyp33 Lengt 5e-04
2e5h_A94 Solution Structure Of Rna Binding Domain In Zinc Fi 5e-04
1whw_A99 Solution Structure Of The N-Terminal Rna Binding Do 5e-04
3md1_A83 Crystal Structure Of The Second Rrm Domain Of Yeast 9e-04
>pdb|2LYV|A Chain A, Solution Structure Of The Two Rrm Domains Of Hnrnp A1 (up1) Using Segmental Isotope Labeling Length = 197 Back     alignment and structure

Iteration: 1

Score = 154 bits (388), Expect = 9e-38, Method: Compositional matrix adjust. Identities = 78/145 (53%), Positives = 100/145 (68%), Gaps = 13/145 (8%) Query: 39 EPESLRKLFIGGLDYRTNDDSLKAFFEQWGEIVDVVVMKDPVTKRSRGFGFITYSESKMV 98 EPE LRKLFIGGL + T D+SL++ FEQWG + D VVM+DP TKRSRGFGF+TY+ + V Sbjct: 10 EPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEV 69 Query: 99 DEAMSNRPHEIDGRVVETKRAVPRE----------VKVRRVTKVQIALEQ---MDYFGQY 145 D AM+ RPH++DGRVVE KRAV RE VK V ++ E+ DYF QY Sbjct: 70 DAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQY 129 Query: 146 GTIESVNMVTNKETGAKRGFAFIEF 170 G IE + ++T++ +G KRGFAF+ F Sbjct: 130 GKIEVIEIMTDRGSGKKRGFAFVTF 154
>pdb|1L3K|A Chain A, Up1, The Two Rna-Recognition Motif Domain Of Hnrnp A1 Length = 196 Back     alignment and structure
>pdb|1PGZ|A Chain A, Crystal Structure Of Up1 Complexed With D(Ttagggttag(6-Mi) G); A Human Telomeric Repeat Containing 6-Methyl-8-(2- Deoxy-Beta-Ribofuranosyl)isoxanthopteridine (6-Mi) Length = 195 Back     alignment and structure
>pdb|2UP1|A Chain A, Structure Of Up1-Telomeric Dna Complex Length = 183 Back     alignment and structure
>pdb|1HA1|A Chain A, Hnrnp A1 (Rbd1,2) From Homo Sapiens Length = 184 Back     alignment and structure
>pdb|1UP1|A Chain A, Up1, The Two Rna-Recognition Motif Domain Of Hnrnp A1 Length = 182 Back     alignment and structure
>pdb|1X4B|A Chain A, Solution Structure Of Rrm Domain In Heterogeneous Nuclear Ribonucleaoproteins A2B1 Length = 116 Back     alignment and structure
>pdb|2CJK|A Chain A, Structure Of The Rna Binding Domain Of Hrp1 In Complex With Rna Length = 167 Back     alignment and structure
>pdb|2DH8|A Chain A, Solution Structure Of The N-Terminal Rna Binding Domain In Daz-Associated Protein 1 Length = 105 Back     alignment and structure
>pdb|2RS2|A Chain A, 1h, 13c, And 15n Chemical Shift Assignments For Musashi1 Rbd1:r(Guagu) Complex Length = 109 Back     alignment and structure
>pdb|1UAW|A Chain A, Solution Structure Of The N-Terminal Rna-Binding Domain Of Mouse Musashi1 Length = 77 Back     alignment and structure
>pdb|1HD0|A Chain A, Heterogeneous Nuclear Ribonucleoprotein D0 (Hnrnp D0 Rbd1), Nmr Length = 75 Back     alignment and structure
>pdb|3S7R|A Chain A, Crystal Structure Of A Heterogeneous Nuclear Ribonucleoprotein AB (Hnrpab) From Homo Sapiens At 2.15 A Resolution Length = 87 Back     alignment and structure
>pdb|2DGS|A Chain A, Solution Structure Of The Second Rna Binding Domain In Daz- Associated Protein 1 Length = 99 Back     alignment and structure
>pdb|2MSS|A Chain A, Musashi1 Rbd2, Nmr Length = 75 Back     alignment and structure
>pdb|1X5S|A Chain A, Solution Structure Of Rrm Domain In A18 Hnrnp Length = 102 Back     alignment and structure
>pdb|2CQD|A Chain A, Solution Structure Of The Rna Recognition Motif In Rna- Binding Region Containing Protein 1 Length = 116 Back     alignment and structure
>pdb|1FNX|H Chain H, Solution Structure Of The Huc Rbd1-Rbd2 Complexed With The Au-Rich Element Length = 174 Back     alignment and structure
>pdb|2DNZ|A Chain A, Solution Structure Of The Second Rna Binding Domain Of Rna Binding Motif Protein 23 Length = 95 Back     alignment and structure
>pdb|2CQG|A Chain A, Solution Structure Of The Rna Binding Domain Of Tar Dna- Binding Protein-43 Length = 103 Back     alignment and structure
>pdb|2LEA|A Chain A, Solution Structure Of Human Srsf2 (Sc35) Rrm Length = 135 Back     alignment and structure
>pdb|2JRS|A Chain A, Solution Nmr Structure Of Caper Rrm2 Domain. Northeast Structural Genomics Target Hr4730a Length = 108 Back     alignment and structure
>pdb|2KN4|A Chain A, The Structure Of The Rrm Domain Of Sc35 Length = 158 Back     alignment and structure
>pdb|2FY1|A Chain A, A Dual Mode Of Rna Recognition By The Rbmy Protein Length = 116 Back     alignment and structure
>pdb|1FXL|A Chain A, Crystal Structure Of Hud And Au-Rich Element Of The C-Fos Rna Length = 167 Back     alignment and structure
>pdb|2YH0|A Chain A, Solution Structure Of The Closed Conformation Of Human U2af65 Tandem Rrm1 And Rrm2 Domains Length = 198 Back     alignment and structure
>pdb|2DNM|A Chain A, Solution Structure Of Rna Binding Domain In Srp46 Splicing Factor Length = 103 Back     alignment and structure
>pdb|2QFJ|A Chain A, Crystal Structure Of First Two Rrm Domains Of Fir Bound To Ssdna From A Portion Of Fuse Length = 216 Back     alignment and structure
>pdb|2QFJ|A Chain A, Crystal Structure Of First Two Rrm Domains Of Fir Bound To Ssdna From A Portion Of Fuse Length = 216 Back     alignment and structure
>pdb|2KXF|A Chain A, Solution Structure Of The First Two Rrm Domains Of Fbp-Interacting Repressor (Fir) Length = 199 Back     alignment and structure
>pdb|2KXF|A Chain A, Solution Structure Of The First Two Rrm Domains Of Fbp-Interacting Repressor (Fir) Length = 199 Back     alignment and structure
>pdb|1WTB|A Chain A, Complex Structure Of The C-Terminal Rna-Binding Domain Of Hnrnp D (Auf1) With Telomere Dna Length = 79 Back     alignment and structure
>pdb|3UWT|A Chain A, Crystal Structure Of A Rna Binding Domain Of Poly-U Binding Splicing Factor 60kda (Puf60) From Homo Sapiens At 2.50 A Resolution Length = 200 Back     alignment and structure
>pdb|3UWT|A Chain A, Crystal Structure Of A Rna Binding Domain Of Poly-U Binding Splicing Factor 60kda (Puf60) From Homo Sapiens At 2.50 A Resolution Length = 200 Back     alignment and structure
>pdb|2KI2|A Chain A, Solution Structure Of Ss-Dna Binding Protein 12rnp2 Precursor, Hp0827(O25501_helpy) Form Helicobacter Pylori Length = 90 Back     alignment and structure
>pdb|4EGL|A Chain A, Crystal Structure Of Two Tandem Rna Recognition Motifs Of Human Antigen R Length = 177 Back     alignment and structure
>pdb|1P1T|A Chain A, Nmr Structure Of The N-Terminal Rrm Domain Of Cleavage Stimulation Factor 64 Kda Subunit Length = 104 Back     alignment and structure
>pdb|4ED5|A Chain A, Crystal Structure Of The Two N-Terminal Rrm Domains Of Hur Complexed With Rna Length = 177 Back     alignment and structure
>pdb|1IQT|A Chain A, Solution Structure Of The C-Terminal Rna-Binding Domain Of Heterogeneous Nuclear Ribonucleoprotein D0 (Auf1) Length = 75 Back     alignment and structure
>pdb|2DGP|A Chain A, Solution Structure Of The N-Terminal Rna Binding Domain In Bruno-Like 4 Rna-Binding Protein Length = 106 Back     alignment and structure
>pdb|2CQB|A Chain A, Solution Structure Of The Rna Recognition Motif In Peptidyl- Prolyl Cis-Trans Isomerase E Length = 102 Back     alignment and structure
>pdb|3MD3|A Chain A, Crystal Structure Of The First Two Rrm Domains Of Yeast Poly Binding Protein (Pub1) Length = 166 Back     alignment and structure
>pdb|3VAF|A Chain A, Structure Of U2af65 Variant With Bru3 Dna Length = 174 Back     alignment and structure
>pdb|2G4B|A Chain A, Structure Of U2af65 Variant With Polyuridine Tract Length = 172 Back     alignment and structure
>pdb|2U2F|A Chain A, Solution Structure Of The Second Rna-Binding Domain Of Hu2af65 Length = 85 Back     alignment and structure
>pdb|1U6F|A Chain A, Nmr Solution Structure Of Tcubp1, A Single Rbd-Unit From Trypanosoma Cruzi Length = 139 Back     alignment and structure
>pdb|3SDE|A Chain A, Crystal Structure Of A Paraspeckle-Protein Heterodimer, Pspc1NONO Length = 261 Back     alignment and structure
>pdb|2KXN|B Chain B, Nmr Structure Of Human Tra2beta1 Rrm In Complex With Aagaac Rna Length = 129 Back     alignment and structure
>pdb|2DNK|A Chain A, Solution Structure Of Rna Binding Domain In Bruno-Like 4 Rna Binding Protein Length = 105 Back     alignment and structure
>pdb|2RRA|A Chain A, Solution Structure Of Rna Binding Domain In Human Tra2 Beta Protein In Complex With Rna (Gaagaa) Length = 99 Back     alignment and structure
>pdb|2ERR|A Chain A, Nmr Structure Of The Rna Binding Domain Of Human Fox-1 In Complex With Ugcaugu Length = 109 Back     alignment and structure
>pdb|2CQC|A Chain A, Solution Structure Of The Rna Recognition Motif In ArginineSERINE-Rich Splicing Factor 10 Length = 95 Back     alignment and structure
>pdb|3NNC|A Chain A, Crystal Structure Of Cugbp1 Rrm12-Rna Complex Length = 175 Back     alignment and structure
>pdb|2DHS|A Chain A, Solution Structure Of Nucleic Acid Binding Protein Cugbp1ab And Its Binding Study With Dna And Rna Length = 187 Back     alignment and structure
>pdb|2RRB|A Chain A, Refinement Of Rna Binding Domain In Human Tra2 Beta Protein Length = 96 Back     alignment and structure
>pdb|2CQ3|A Chain A, Solution Structure Of Rna Binding Domain In Rna Binding Motif Protein 9 Length = 103 Back     alignment and structure
>pdb|2KU7|A Chain A, Solution Structure Of Mll1 Phd3-Cyp33 Rrm Chimeric Protein Length = 140 Back     alignment and structure
>pdb|3MDF|A Chain A, Crystal Structure Of The Rrm Domain Of Cyclophilin 33 Length = 85 Back     alignment and structure
>pdb|3LPY|A Chain A, Crystal Structure Of The Rrm Domain Of Cyp33 Length = 79 Back     alignment and structure
>pdb|2DGQ|A Chain A, Solution Structure Of The N-Terminal Rna Binding Domain In Bruno-Like 6 Rna-Binding Protein Length = 108 Back     alignment and structure
>pdb|1B7F|A Chain A, Sxl-Lethal ProteinRNA COMPLEX Length = 168 Back     alignment and structure
>pdb|2JWN|A Chain A, Solution Nmr Structure Of The Protease-Resistent Domain Of Xenopus Laevis Epabp2 Length = 124 Back     alignment and structure
>pdb|2D9P|A Chain A, Solution Structure Of Rna Binding Domain 4 In Polyadenylation Binding Protein 3 Length = 103 Back     alignment and structure
>pdb|2KYX|A Chain A, Solution Structure Of The Rrm Domain Of Cyp33 Length = 83 Back     alignment and structure
>pdb|2E5H|A Chain A, Solution Structure Of Rna Binding Domain In Zinc Finger Cchc-Type And Rna Binding Motif 1 Length = 94 Back     alignment and structure
>pdb|1WHW|A Chain A, Solution Structure Of The N-Terminal Rna Binding Domain From Hypothetical Protein Bab23448 Length = 99 Back     alignment and structure
>pdb|3MD1|A Chain A, Crystal Structure Of The Second Rrm Domain Of Yeast Poly(U)-Binding Protein (Pub1) Length = 83 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query306
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 2e-63
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 3e-31
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 3e-60
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 6e-31
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 8e-49
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 1e-09
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 2e-48
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 1e-11
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 5e-48
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 2e-10
2cqd_A116 RNA-binding region containing protein 1; RNA recog 2e-45
2cqd_A116 RNA-binding region containing protein 1; RNA recog 1e-10
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 7e-44
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 1e-13
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 2e-43
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 6e-10
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 1e-42
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 3e-12
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 5e-42
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 9e-10
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 3e-40
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 5e-22
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 7e-39
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 7e-13
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 1e-34
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 1e-14
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 2e-34
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 2e-06
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 2e-33
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 3e-22
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 1e-32
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 2e-07
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 8e-30
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 3e-20
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 4e-29
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 2e-09
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 2e-28
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 6e-16
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 4e-28
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 2e-15
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 2e-27
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 1e-09
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 3e-27
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 3e-11
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 7e-27
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 8e-15
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 1e-26
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 3e-16
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 1e-26
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 2e-16
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 2e-26
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 3e-06
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 1e-25
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 7e-10
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 1e-24
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 2e-17
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 2e-12
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 2e-24
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 6e-09
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 1e-23
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 1e-19
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 5e-13
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 2e-04
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 2e-23
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 3e-09
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 3e-23
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 1e-09
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 1e-22
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 3e-09
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 1e-22
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 1e-08
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 1e-22
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 3e-08
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 1e-22
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 1e-07
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 2e-22
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 3e-09
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 4e-22
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 3e-08
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 4e-22
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 6e-06
3n9u_C156 Cleavage and polyadenylation specificity factor S; 7e-22
3n9u_C156 Cleavage and polyadenylation specificity factor S; 2e-06
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 1e-21
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 6e-06
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 2e-21
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 4e-09
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} Len 2e-21
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} Len 9e-07
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 2e-21
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 3e-08
3q2s_C229 Cleavage and polyadenylation specificity factor S; 3e-21
3q2s_C229 Cleavage and polyadenylation specificity factor S; 2e-06
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 4e-21
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 2e-06
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 4e-21
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 3e-09
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 5e-21
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 9e-09
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 6e-21
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 2e-09
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 8e-21
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 1e-09
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 1e-20
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 4e-08
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 1e-20
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 4e-09
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 2e-20
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 5e-10
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 3e-20
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 4e-05
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 4e-20
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 4e-06
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 4e-20
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 4e-05
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 6e-20
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 8e-14
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 9e-20
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 1e-07
1x4e_A85 RNA binding motif, single-stranded interacting pro 1e-19
1x4e_A85 RNA binding motif, single-stranded interacting pro 3e-08
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 1e-19
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 6e-10
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 2e-19
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 1e-05
3p5t_L90 Cleavage and polyadenylation specificity factor S; 2e-19
3p5t_L90 Cleavage and polyadenylation specificity factor S; 1e-06
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 3e-19
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 9e-09
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 4e-19
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 4e-06
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 5e-19
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 8e-08
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 6e-19
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 4e-11
2cph_A107 RNA binding motif protein 19; RNA recognition moti 6e-19
2cph_A107 RNA binding motif protein 19; RNA recognition moti 2e-07
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 6e-19
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 4e-08
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 7e-19
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 1e-05
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 7e-19
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 2e-13
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 8e-19
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 6e-11
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 1e-18
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 2e-07
2dnl_A114 Cytoplasmic polyadenylation element binding protei 1e-18
2dnl_A114 Cytoplasmic polyadenylation element binding protei 9e-04
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 2e-18
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 4e-10
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 2e-18
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 4e-04
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 2e-18
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 8e-08
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 6e-18
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 4e-05
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 2e-17
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 2e-17
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 3e-04
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 3e-17
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 6e-06
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 3e-17
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 3e-10
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 3e-17
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 1e-04
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 4e-17
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 2e-09
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 5e-17
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 4e-04
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 6e-17
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 2e-07
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 8e-17
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 3e-07
2kt5_A124 RNA and export factor-binding protein 2; chaperone 1e-16
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 2e-16
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 2e-16
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 8e-04
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 3e-16
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 1e-06
1x5o_A114 RNA binding motif, single-stranded interacting pro 4e-16
1x5o_A114 RNA binding motif, single-stranded interacting pro 4e-05
2cpj_A99 Non-POU domain-containing octamer-binding protein; 4e-16
2cpj_A99 Non-POU domain-containing octamer-binding protein; 5e-04
2dis_A109 Unnamed protein product; structural genomics, RRM 1e-15
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 2e-15
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 1e-07
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 2e-15
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 2e-15
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 6e-07
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 3e-15
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 7e-08
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 3e-15
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 3e-15
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 4e-04
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 4e-15
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 6e-15
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 1e-05
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 7e-15
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 2e-05
2f3j_A177 RNA and export factor binding protein 2; RRM domai 7e-15
2f3j_A177 RNA and export factor binding protein 2; RRM domai 7e-04
2div_A99 TRNA selenocysteine associated protein; structural 1e-14
2div_A99 TRNA selenocysteine associated protein; structural 4e-06
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 2e-14
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 2e-14
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 2e-14
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 2e-04
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 3e-14
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 3e-05
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 3e-14
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 3e-14
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 5e-07
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 4e-14
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 3e-06
2i2y_A150 Fusion protein consists of immunoglobin G- binding 4e-14
2i2y_A150 Fusion protein consists of immunoglobin G- binding 1e-04
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 4e-14
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 3e-05
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 4e-14
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 9e-05
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 1e-13
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 8e-06
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 4e-13
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 2e-04
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 5e-13
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 5e-13
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 6e-13
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 1e-05
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 1e-12
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 5e-04
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 2e-12
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 5e-04
2la6_A99 RNA-binding protein FUS; structural genomics, nort 3e-12
2la6_A99 RNA-binding protein FUS; structural genomics, nort 3e-07
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 4e-12
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 4e-12
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 7e-04
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 5e-12
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 6e-12
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 6e-04
1x5p_A97 Negative elongation factor E; structure genomics, 6e-12
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 9e-12
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 6e-05
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 1e-11
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 2e-11
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 3e-04
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 6e-11
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 4e-04
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 1e-10
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 1e-10
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 2e-10
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 2e-10
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 7e-04
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 3e-10
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 4e-04
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 6e-10
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 9e-10
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 4e-04
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 9e-10
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 6e-06
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 1e-09
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 2e-09
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 3e-09
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 3e-09
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 3e-09
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 2e-04
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 3e-09
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 5e-09
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 5e-05
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 7e-09
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 8e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-08
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 1e-08
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 1e-04
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 2e-08
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 3e-08
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 6e-06
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 3e-08
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 2e-04
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 4e-08
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 4e-08
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 1e-04
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 5e-08
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 8e-08
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 2e-07
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 4e-07
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 4e-04
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 6e-07
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 7e-07
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 7e-07
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 1e-06
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 2e-06
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 3e-06
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 4e-06
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 5e-06
2krb_A81 Eukaryotic translation initiation factor 3 subunit 4e-05
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
 Score =  197 bits (504), Expect = 2e-63
 Identities = 87/158 (55%), Positives = 110/158 (69%), Gaps = 13/158 (8%)

Query: 39  EPESLRKLFIGGLDYRTNDDSLKAFFEQWGEIVDVVVMKDPVTKRSRGFGFITYSESKMV 98
           EPE LRKLFIGGL + T D+SL++ FEQWG + D VVM+DP TKRSRGFGF+TY+  + V
Sbjct: 9   EPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEV 68

Query: 99  DEAMSNRPHEIDGRVVETKRAVPREVKVR-----RVTKVQI------ALEQM--DYFGQY 145
           D AM+ RPH++DGRVVE KRAV RE   R      V K+ +        E    DYF QY
Sbjct: 69  DAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQY 128

Query: 146 GTIESVNMVTNKETGAKRGFAFIEFDDYDVVDKIVLDK 183
           G IE + ++T++ +G KRGFAF+ FDD+D VDKIV+ K
Sbjct: 129 GKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQK 166


>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Length = 109 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Length = 109 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Length = 87 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Length = 87 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Length = 77 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Length = 77 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Length = 75 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Length = 75 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Length = 75 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Length = 75 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Length = 89 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Length = 89 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 88 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 88 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Length = 102 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Length = 102 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Length = 135 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Length = 135 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Length = 106 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Length = 106 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Length = 158 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Length = 158 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} Length = 83 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} Length = 83 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Length = 156 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Length = 156 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Length = 115 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Length = 115 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Length = 87 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Length = 87 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Length = 139 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Length = 139 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 85 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 85 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Length = 126 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Length = 126 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Length = 90 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Length = 90 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Length = 90 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Length = 90 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Length = 89 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Length = 89 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 107 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 107 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Length = 124 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Length = 124 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Length = 106 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Length = 106 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 93 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 93 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Length = 115 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Length = 115 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Length = 118 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Length = 118 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Length = 115 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Length = 92 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Length = 92 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 103 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 103 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Length = 103 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Length = 126 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 113 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 113 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Length = 150 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Length = 150 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 124 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Length = 97 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Length = 97 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Length = 139 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Length = 87 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Length = 100 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 108 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Length = 110 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Length = 110 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Length = 115 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 119 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Length = 143 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Length = 100 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Length = 100 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Length = 97 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Length = 97 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Length = 111 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Length = 96 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Length = 96 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Length = 107 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 118 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Length = 193 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Length = 193 Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Length = 240 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Length = 136 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Length = 88 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Length = 81 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query306
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 100.0
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 100.0
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 100.0
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 100.0
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 100.0
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 100.0
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 100.0
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 100.0
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 100.0
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 100.0
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 100.0
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.98
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.98
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.97
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.97
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.97
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.97
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.97
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.96
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.96
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.86
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.86
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.86
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.83
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.83
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.83
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.82
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.82
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.82
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.82
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 99.82
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.81
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.81
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.81
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.81
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.81
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.81
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.8
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.8
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.8
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.8
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.8
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.8
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.8
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.8
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.8
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.8
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.8
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.8
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.8
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.8
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.8
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.8
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.8
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.8
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.79
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.79
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.79
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.79
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.79
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.79
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.79
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.79
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.79
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.79
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.79
2div_A99 TRNA selenocysteine associated protein; structural 99.79
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.79
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.79
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.79
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.79
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.79
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.79
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.79
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.79
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.79
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.79
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.78
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.78
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.78
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.78
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.78
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.78
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.78
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.78
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.78
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.78
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.78
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.78
3n9u_C156 Cleavage and polyadenylation specificity factor S; 99.78
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.77
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.77
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.77
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.77
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.77
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.77
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.77
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.77
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.77
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.77
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.77
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.77
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.77
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.77
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.77
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.77
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.76
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.76
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.76
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 99.76
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.76
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.76
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.76
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.76
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.76
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 99.76
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.76
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 99.76
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.76
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.76
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.76
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.76
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.75
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.75
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.75
2dis_A109 Unnamed protein product; structural genomics, RRM 99.75
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.75
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 99.75
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.75
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.75
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.75
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.75
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.74
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.74
2krb_A81 Eukaryotic translation initiation factor 3 subunit 99.74
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 99.74
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.74
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.74
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.74
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 99.73
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 99.73
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.73
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.73
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.73
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 99.72
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 99.72
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 99.72
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 99.72
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 99.72
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.72
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.72
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 99.71
3q2s_C229 Cleavage and polyadenylation specificity factor S; 99.71
2cpj_A99 Non-POU domain-containing octamer-binding protein; 99.71
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 99.71
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.7
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.7
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 99.54
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.7
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 99.7
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 99.7
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 99.7
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 99.7
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 99.7
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 99.7
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 99.7
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.69
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 99.69
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.69
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 99.69
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.69
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 99.68
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.68
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 99.68
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 99.68
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.68
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 99.68
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 99.68
2f3j_A177 RNA and export factor binding protein 2; RRM domai 99.68
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 99.68
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 99.68
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.67
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 99.67
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.67
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 99.67
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 99.67
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.67
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.67
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.67
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.67
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 99.66
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.66
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 99.66
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.66
2div_A99 TRNA selenocysteine associated protein; structural 99.66
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.66
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.66
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.66
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 99.66
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.66
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.66
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.66
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.66
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.65
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.65
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.65
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.65
2dnl_A114 Cytoplasmic polyadenylation element binding protei 99.65
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.65
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 99.65
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.65
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.65
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.65
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 99.65
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.64
1x5p_A97 Negative elongation factor E; structure genomics, 99.64
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.64
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.64
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.64
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.64
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.64
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 99.64
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.64
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.64
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.64
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.64
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.63
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.63
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 99.63
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 99.63
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.63
3n9u_C156 Cleavage and polyadenylation specificity factor S; 99.63
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.63
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.63
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.63
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.63
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.63
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.62
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.62
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.62
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.62
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 99.62
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.62
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.62
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 99.62
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 99.62
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 99.62
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.62
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.62
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.61
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.61
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.61
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 99.61
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 99.61
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 99.61
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.61
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.61
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.61
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.61
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 99.61
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.61
2krb_A81 Eukaryotic translation initiation factor 3 subunit 99.61
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.61
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.61
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.61
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.61
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.6
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.6
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.6
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.6
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.6
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.6
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 99.6
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.59
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.59
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 99.59
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.59
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.59
2dis_A109 Unnamed protein product; structural genomics, RRM 99.59
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 99.58
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.58
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 99.58
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.58
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.58
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.58
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.58
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.58
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.57
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 99.56
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.56
3q2s_C229 Cleavage and polyadenylation specificity factor S; 99.56
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.56
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.56
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.55
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.55
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 99.55
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.54
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.54
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.54
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.54
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.53
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 99.53
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 99.53
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.53
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 99.52
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.52
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 99.52
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 99.51
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 99.27
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 99.51
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 99.51
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 99.51
2dit_A112 HIV TAT specific factor 1 variant; structural geno 99.51
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.5
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 99.5
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 99.5
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 99.5
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 99.5
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 99.5
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.49
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 99.49
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 99.48
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.48
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 99.48
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 99.48
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 99.48
2cpj_A99 Non-POU domain-containing octamer-binding protein; 99.47
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 99.47
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 99.46
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.46
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 99.46
2f3j_A177 RNA and export factor binding protein 2; RRM domai 99.45
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 99.45
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 99.45
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 99.45
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 99.45
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 99.45
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 99.45
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 99.44
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 99.44
2dnl_A114 Cytoplasmic polyadenylation element binding protei 99.44
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 99.44
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 99.44
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 99.43
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 99.43
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 99.43
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 99.42
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 99.42
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 99.42
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 99.41
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 99.41
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 99.41
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 99.41
1x5p_A97 Negative elongation factor E; structure genomics, 99.4
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 99.4
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 99.4
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 99.38
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 99.38
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 99.37
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 99.36
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 99.34
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 99.33
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 99.33
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 99.29
3tht_A345 Alkylated DNA repair protein ALKB homolog 8; struc 99.29
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 99.28
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 99.27
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 99.25
2dit_A112 HIV TAT specific factor 1 variant; structural geno 99.24
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 99.19
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 99.07
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 99.07
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 99.04
3tht_A 345 Alkylated DNA repair protein ALKB homolog 8; struc 99.01
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 98.88
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 98.87
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 98.82
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 98.72
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 98.64
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 98.42
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 98.27
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 98.1
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 97.85
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 97.5
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 97.48
1uw4_A91 UPF3X; nonsense mediated mRNA decay protein, RNA-b 97.27
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 97.09
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 97.07
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 96.32
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 96.32
3pq1_A 464 Poly(A) RNA polymerase; nucleotidyl transferase, R 96.25
3p3d_A132 Nucleoporin 53; structural genomics, PSI-2, protei 96.2
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 96.17
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 95.86
1uw4_A91 UPF3X; nonsense mediated mRNA decay protein, RNA-b 95.65
2l08_A97 Regulator of nonsense transcripts 3A; NESG, nonsen 95.56
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 95.05
3pq1_A 464 Poly(A) RNA polymerase; nucleotidyl transferase, R 93.13
2l08_A97 Regulator of nonsense transcripts 3A; NESG, nonsen 92.64
2ljs_A30 Trypsin inhibitor 3; beta strand, helix, cyclic ba 92.52
3d45_A507 Poly(A)-specific ribonuclease PARN; CAP analogue, 90.95
3p3d_A132 Nucleoporin 53; structural genomics, PSI-2, protei 88.52
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
Probab=100.00  E-value=2e-35  Score=248.80  Aligned_cols=167  Identities=50%  Similarity=0.870  Sum_probs=151.0

Q ss_pred             CCCCCCCCeEEEcCCCCCCCHHHHHHHhhccCCEEEEEEeeCCCCCCcceEEEEEecChHHHHHHHHcCCCccCCcEEEE
Q psy14686         37 CSEPESLRKLFIGGLDYRTNDDSLKAFFEQWGEIVDVVVMKDPVTKRSRGFGFITYSESKMVDEAMSNRPHEIDGRVVET  116 (306)
Q Consensus        37 ~~~~~~~~~l~V~nLp~~~te~~L~~~F~~~G~i~~v~i~~~~~~g~~kg~afV~f~~~~~a~~Al~~~~~~~~g~~i~v  116 (306)
                      +.++...++|||+|||+++|+++|+++|++||+|.+|++++++.+|+++|||||+|.++++|.+|++.++..+.|+.|.|
T Consensus         7 ~~~~~~~~~l~V~nLp~~~te~~l~~~F~~~G~i~~v~i~~~~~~g~~~g~afV~f~~~~~A~~A~~~~~~~~~g~~l~v   86 (196)
T 1l3k_A            7 PKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEP   86 (196)
T ss_dssp             -CCCGGGGEEEEESCCTTCCHHHHHHHHGGGSCEEEEEEEECTTTCCEEEEEEEEESSHHHHHHHHHTCSCEETTEECEE
T ss_pred             CCCCCCCCEEEEeCCCCCCCHHHHHHHHHhCCCEEEEEEEEcCCCCCccceEEEEeCCHHHHHHHHhcCCCEECCEEeee
Confidence            45566789999999999999999999999999999999999998999999999999999999999999999999999999


Q ss_pred             eeccc-------------cceeecccccccchHHHHHHhccCCCeeEEEEEecCCCCCceEEEEEEeCCHHHHHHHHhcC
Q psy14686        117 KRAVP-------------REVKVRRVTKVQIALEQMDYFGQYGTIESVNMVTNKETGAKRGFAFIEFDDYDVVDKIVLDK  183 (306)
Q Consensus       117 ~~~~~-------------~~~~v~nl~~~~~e~~l~~~F~~~G~I~~v~v~~d~~~g~~kG~aFV~F~~~e~A~~Al~~~  183 (306)
                      .++.+             ++++|+|||..+++++|+++|++||.|.++++++++.+|.++|||||+|.+.++|++|+.  
T Consensus        87 ~~~~~~~~~~~~~~~~~~~~l~V~nLp~~~t~~~l~~~F~~~G~i~~v~i~~~~~~g~~~g~afV~F~~~~~A~~A~~--  164 (196)
T 1l3k_A           87 KRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVI--  164 (196)
T ss_dssp             EECCC-----------CCSEEEEECCTTTCCHHHHHHHHTTTSCEEEEEEEECTTTCCEEEEEEEEESSHHHHHHHHH--
T ss_pred             ecccCcccccccccCCCcceEEEeCCCCCCCHHHHHHHHhcCCCeEEEEEeecCCCCCccceEEEEECCHHHHHHHHH--
Confidence            88753             469999999999999999999999999999999999899999999999999999999995  


Q ss_pred             cceeccCceEecCcccccccCcccccc
Q psy14686        184 VVVLEVDQEVINGEDHRTHGTHQEAKV  210 (306)
Q Consensus       184 ~~~~~~~~~~i~g~~i~v~~~~~~~~~  210 (306)
                           .++..+.|+.+.+.++..+...
T Consensus       165 -----~~~~~~~G~~i~v~~a~~k~~~  186 (196)
T 1l3k_A          165 -----QKYHTVNGHNCEVRKALSKQEM  186 (196)
T ss_dssp             -----CSCCEETTEECEEEECC-----
T ss_pred             -----hCCcEECCEEEEEEecCChhHh
Confidence                 3678899999999877655443



>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure
>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 Back     alignment and structure
>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure
>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ljs_A Trypsin inhibitor 3; beta strand, helix, cyclic backbone, hydrolase inhibitor; HET: PCA; NMR {Momordica cochinchinensis} Back     alignment and structure
>3d45_A Poly(A)-specific ribonuclease PARN; CAP analogue, exonuclease, hydrolase, magnesium, metal nonsense-mediated mRNA decay, nucleus; HET: 7MG GDP; 3.00A {Mus musculus} Back     alignment and structure
>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 306
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 2e-23
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 4e-15
d1l3ka184 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN 4e-23
d1l3ka184 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN 0.004
d1x4ba1103 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle 5e-23
d1x0fa175 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 2e-19
d1hd0a_75 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 3e-19
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 4e-19
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 7e-19
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 6e-04
d2cq4a1101 d.58.7.1 (A:132-232) RNA binding protein 23 {Human 2e-17
d1u2fa_90 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 9e-17
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 1e-16
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 0.002
d2cqda1103 d.58.7.1 (A:1-103) RNA-binding region containing p 3e-15
d1l3ka279 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 2e-14
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 2e-14
d2msta_75 d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 3e-14
d1wf0a_88 d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 { 3e-14
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 5e-14
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 1e-13
d1x5ta183 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu 2e-13
d1fjeb191 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesoc 3e-13
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 4e-13
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 0.004
d2disa196 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { 1e-12
d1wi8a_104 d.58.7.1 (A:) Eukaryotic translation initiation fa 1e-12
d1x5sa190 d.58.7.1 (A:8-97) Cold-inducible RNA-binding prote 2e-12
d2cqha180 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 is 3e-12
d2cqpa186 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous 4e-12
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 5e-12
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 5e-12
d1x4ha198 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse ( 6e-12
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 8e-12
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 9e-12
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 9e-12
d2cq3a193 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human 1e-11
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 2e-11
d1wg5a_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 2e-11
d2cq0a190 d.58.7.1 (A:231-320) Eukaryotic translation initia 2e-11
d2cpza1102 d.58.7.1 (A:383-484) CUG triplet repeat RNA-bindin 3e-11
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 4e-11
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 5e-11
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 0.004
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 5e-11
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 8e-11
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 1e-10
d1wela1112 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human 1e-10
d2cpda186 d.58.7.1 (A:223-308) APOBEC1 stimulating protein { 1e-10
d2cpea1101 d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma 1e-10
d2ghpa386 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splici 1e-10
d1u6fa1139 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypa 2e-10
d2cpya1103 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human 2e-10
d1x4aa195 d.58.7.1 (A:9-103) Splicing factor, arginine/serin 4e-10
d2cpxa1102 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 8e-10
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 9e-10
d1rk8a_88 d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr 2e-09
d1p1ta_104 d.58.7.1 (A:) Cleavage stimulation factor, 64 kda 2e-09
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 3e-09
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 3e-09
d1weza_102 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 3e-09
d2cqia190 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa 4e-09
d2ghpa181 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splici 1e-08
d2adba1108 d.58.7.1 (A:177-284) Polypyrimidine tract-binding 2e-08
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 3e-08
d1wwha181 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus mu 3e-08
d2bz2a179 d.58.7.1 (A:35-113) Negative elongation factor E, 9e-08
d1nu4a_91 d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo 1e-07
d2ghpa275 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicin 1e-07
d2cq2a1101 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 1e-06
d1zh5a285 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo 1e-06
d2cpia189 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase C 2e-06
d1x5oa1101 d.58.7.1 (A:8-108) RNA-binding motif, single-stran 4e-06
d1x4ea172 d.58.7.1 (A:8-79) RNA-binding motif, single-strand 1e-05
d1wg4a_98 d.58.7.1 (A:) Splicing factor, arginine/serine-ric 1e-05
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 d.58.7.3 (A:) 1e-05
d1owxa_113 d.58.7.1 (A:) Lupus LA protein {Human (Homo sapien 2e-05
d1weya_104 d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) 7e-05
d1wexa_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 2e-04
d1wg1a_88 d.58.7.1 (A:) Probable RNA-binding protein KIAA157 4e-04
d1whya_97 d.58.7.1 (A:) Putative RNA-binding protein 15B, Rb 6e-04
d2adca288 d.58.7.1 (A:444-531) Polypyrimidine tract-binding 0.001
d2cq1a188 d.58.7.1 (A:51-138) Polypyrimidine tract-binding p 0.002
d2dita199 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Huma 0.002
d3begb187 d.58.7.1 (B:121-207) Splicing factor, arginine/ser 0.002
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Nuclear ribonucleoprotein A1 (RNP A1, UP1)
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 92.4 bits (228), Expect = 2e-23
 Identities = 82/155 (52%), Positives = 106/155 (68%), Gaps = 13/155 (8%)

Query: 39  EPESLRKLFIGGLDYRTNDDSLKAFFEQWGEIVDVVVMKDPVTKRSRGFGFITYSESKMV 98
           EPE LRKLFIGGL + T D+SL++ FEQWG + D VVM+DP TKRSRGFGF+TY+  + V
Sbjct: 2   EPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEV 61

Query: 99  DEAMSNRPHEIDGRVVETKRAVPR-------------EVKVRRVTKVQIALEQMDYFGQY 145
           D AM+ RPH++DGRVVE KRAV R             ++ V  + +        DYF QY
Sbjct: 62  DAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQY 121

Query: 146 GTIESVNMVTNKETGAKRGFAFIEFDDYDVVDKIV 180
           G IE + ++T++ +G KRGFAF+ FDD+D VDKIV
Sbjct: 122 GKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIV 156


>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 91 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 112 Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Length = 139 Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 75 Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 87 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query306
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 100.0
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.87
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.86
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.86
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.86
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.86
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.86
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.85
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.85
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.85
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.85
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.85
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.85
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.85
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.85
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.85
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.84
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.84
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.84
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.84
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.84
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.84
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.84
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.83
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.83
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.83
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.83
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.82
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.82
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.82
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.82
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.82
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.81
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.81
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.81
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.81
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.81
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.8
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.8
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.79
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.79
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.79
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.79
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.78
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.77
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.77
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.77
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.76
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.76
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.75
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.75
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.75
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.75
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.75
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.75
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.75
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.74
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.74
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.74
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.74
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.74
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.73
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.73
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.73
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.73
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.73
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.73
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.73
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.73
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.73
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.73
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 99.73
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.73
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.73
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.72
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 99.72
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.72
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.72
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.72
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.72
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.72
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.72
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.72
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.72
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.72
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.71
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.71
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.71
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.71
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.71
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.71
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.71
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.71
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.7
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.7
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.7
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.7
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.7
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.7
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.7
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.7
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.69
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.69
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.68
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.67
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.67
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.67
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.67
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.67
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 99.67
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.66
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.66
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.66
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.66
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.66
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 99.66
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.65
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.65
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 99.65
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.64
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.63
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.62
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.6
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.6
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.59
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.59
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.59
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.58
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.58
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.56
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.56
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.56
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.55
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.55
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.54
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 99.54
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.54
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 99.54
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.54
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.53
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.52
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.52
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.52
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.52
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 99.51
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.51
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 99.51
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.51
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.51
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 99.5
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.48
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 99.48
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 99.47
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.47
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 99.47
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.47
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 99.45
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.44
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.44
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 99.43
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.4
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 99.37
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.36
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 99.34
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.34
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.33
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.27
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.21
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 99.17
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 99.14
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 99.1
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.06
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 97.54
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 97.31
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 96.91
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 96.53
d1whva_100 Poly(A)-specific ribonuclease PARN {Mouse (Mus mus 95.87
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 95.81
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 95.35
d1whva_100 Poly(A)-specific ribonuclease PARN {Mouse (Mus mus 90.72
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Nuclear ribonucleoprotein A1 (RNP A1, UP1)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=1.8e-33  Score=233.03  Aligned_cols=160  Identities=52%  Similarity=0.894  Sum_probs=146.0

Q ss_pred             CCCCCCeEEEcCCCCCCCHHHHHHHhhccCCEEEEEEeeCCCCCCcceEEEEEecChHHHHHHHHcCCCccCCcEEEEee
Q psy14686         39 EPESLRKLFIGGLDYRTNDDSLKAFFEQWGEIVDVVVMKDPVTKRSRGFGFITYSESKMVDEAMSNRPHEIDGRVVETKR  118 (306)
Q Consensus        39 ~~~~~~~l~V~nLp~~~te~~L~~~F~~~G~i~~v~i~~~~~~g~~kg~afV~f~~~~~a~~Al~~~~~~~~g~~i~v~~  118 (306)
                      +++..|+|||+|||+++|+++|+++|++||+|.++.++++..+|+++|||||+|.++++|.+|+...+..+.++.+.+.+
T Consensus         2 ep~~~r~lfV~nLp~~~te~~L~~~F~~~G~v~~~~~~~~~~~~~~~g~afv~f~~~~~a~~a~~~~~~~~~~~~~~~~~   81 (183)
T d1u1qa_           2 EPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKR   81 (183)
T ss_dssp             CCHHHHEEEEESCCTTCCHHHHHHHHGGGSCEEEEEEEECTTTCCEEEEEEEEESSHHHHHHHHHTCSCEETTEECEEEE
T ss_pred             CCCCCCEEEEECCCCCCCHHHHHHHHHHcCCEEEEEeeecccCCCccCceecccCCHHHHHHHHHhcCCcccccchhhhh
Confidence            34556899999999999999999999999999999999999999999999999999999999999988888888887765


Q ss_pred             ccc-------------cceeecccccccchHHHHHHhccCCCeeEEEEEecCCCCCceEEEEEEeCCHHHHHHHHhcCcc
Q psy14686        119 AVP-------------REVKVRRVTKVQIALEQMDYFGQYGTIESVNMVTNKETGAKRGFAFIEFDDYDVVDKIVLDKVV  185 (306)
Q Consensus       119 ~~~-------------~~~~v~nl~~~~~e~~l~~~F~~~G~I~~v~v~~d~~~g~~kG~aFV~F~~~e~A~~Al~~~~~  185 (306)
                      ..+             ++++|+|||..+++++|+++|+.||.|..+.+++|..+|.++|||||+|.++++|++|+     
T Consensus        82 ~~~~~~~~~~~~~~~~~~i~V~~lp~~~te~~L~~~f~~~G~v~~~~i~~~~~~~~~~g~~fV~f~~~e~A~~Al-----  156 (183)
T d1u1qa_          82 AVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIV-----  156 (183)
T ss_dssp             CCCTTGGGSTTTTCCCSEEEEECCCTTCCHHHHHHHHGGGSCEEEEEEEECTTTCCEEEEEEEEESCHHHHHHHH-----
T ss_pred             hhhcccccccccccccceeEEccCCCcCCHHHHhhhhccCCceeeeeeecccccCccceeEEEEECCHHHHHHHH-----
Confidence            432             46899999999999999999999999999999999999999999999999999999998     


Q ss_pred             eeccCceEecCcccccccCc
Q psy14686        186 VLEVDQEVINGEDHRTHGTH  205 (306)
Q Consensus       186 ~~~~~~~~i~g~~i~v~~~~  205 (306)
                        .+++..+.|+.++|.++.
T Consensus       157 --~~~~~~~~G~~i~V~~A~  174 (183)
T d1u1qa_         157 --IQKYHTVNGHNCEVRKAL  174 (183)
T ss_dssp             --TSSCEEETTEEEEEEECC
T ss_pred             --HhCCCeECCEEEEEEecC
Confidence              456677889999988653



>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure