Psyllid ID: psy14722

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80-------
MHNETLHLAINYVDRFLSLMSVVRSKLQLLGTTALFVASIIEVAEEYKMHNETLHLAINYVDRFLSLMSVVRSKLQLLGTTALFVAS
ccccccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHcc
ccHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHH
MHNETLHLAINYVDRFLSLMSVVRSKLQLLGTTALFVASIIEVAEEYKMHNETLHLAINYVDRFLSLMSVVRSKLQLLGTTALFVAS
mhnetlhlAINYVDRFLSLMSVVRSKLQLLGTTALFVASIIEVAEEYKMHNETLHLAINYVDRFLSLMSVVRSKLqllgttalfvas
MHNETLHLAINYVDRFLSLMSVVRSKLQLLGTTALFVASIIEVAEEYKMHNETLHLAINYVDRFLSLMSVVRSKLQLLGTTALFVAS
*****LHLAINYVDRFLSLMSVVRSKLQLLGTTALFVASIIEVAEEYKMHNETLHLAINYVDRFLSLMSVVRSKLQLLGTTALFV**
MHNETLHLAINYVDRFLSLMSVVRSKLQLLGTTALFVASIIEVAEEYKMHNETLHLAINYVDRFLSLMSVVRSKLQLLGTTALFVAS
MHNETLHLAINYVDRFLSLMSVVRSKLQLLGTTALFVASIIEVAEEYKMHNETLHLAINYVDRFLSLMSVVRSKLQLLGTTALFVAS
MHNETLHLAINYVDRFLSLMSVVRSKLQLLGTTALFVASIIEVAEEYKMHNETLHLAINYVDRFLSLMSVVRSKLQLLGTTALFVAS
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhoo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHNETLHLAINYVDRFLSLMSVVRSKLQLLGTTALFVASIIEVAEEYKMHNETLHLAINYVDRFLSLMSVVRSKLQLLGTTALFVAS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query87 2.2.26 [Sep-21-2011]
P30274 430 Cyclin-A2 OS=Bos taurus G yes N/A 0.620 0.125 0.648 9e-15
P20248 432 Cyclin-A2 OS=Homo sapiens yes N/A 0.620 0.125 0.648 1e-14
P37881 421 Cyclin-A2 OS=Mesocricetus N/A N/A 0.620 0.128 0.648 2e-14
P51943 422 Cyclin-A2 OS=Mus musculus yes N/A 0.620 0.127 0.648 2e-14
P43449 395 Cyclin-A2 OS=Gallus gallu yes N/A 0.620 0.136 0.648 2e-14
P47827 415 Cyclin-A2 OS=Xenopus laev N/A N/A 0.620 0.130 0.629 3e-14
P18606 418 Cyclin-A1 OS=Xenopus laev N/A N/A 0.471 0.098 0.622 2e-13
P24861 426 G2/mitotic-specific cycli N/A N/A 0.620 0.126 0.611 4e-13
Q6AY13 421 Cyclin-A1 OS=Rattus norve no N/A 0.655 0.135 0.578 8e-13
Q61456 421 Cyclin-A1 OS=Mus musculus no N/A 0.655 0.135 0.578 9e-13
>sp|P30274|CCNA2_BOVIN Cyclin-A2 OS=Bos taurus GN=CCNA2 PE=1 SV=2 Back     alignment and function desciption
 Score = 79.0 bits (193), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 35/54 (64%), Positives = 45/54 (83%)

Query: 34  ALFVASIIEVAEEYKMHNETLHLAINYVDRFLSLMSVVRSKLQLLGTTALFVAS 87
           A+ V  ++EV EEYK+ NETLHLA+NY+DRFLS MSV+R KLQL+GT A+ +AS
Sbjct: 210 AILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLAS 263
Essential for the control of the cell cycle at the G1/S (start) and the G2/M (mitosis) transitions.
Bos taurus (taxid: 9913)
>sp|P20248|CCNA2_HUMAN Cyclin-A2 OS=Homo sapiens GN=CCNA2 PE=1 SV=2 Back     alignment and function description
>sp|P37881|CCNA2_MESAU Cyclin-A2 OS=Mesocricetus auratus GN=CCNA2 PE=2 SV=1 Back     alignment and function description
>sp|P51943|CCNA2_MOUSE Cyclin-A2 OS=Mus musculus GN=Ccna2 PE=1 SV=2 Back     alignment and function description
>sp|P43449|CCNA2_CHICK Cyclin-A2 OS=Gallus gallus GN=CCNA2 PE=2 SV=1 Back     alignment and function description
>sp|P47827|CCNA2_XENLA Cyclin-A2 OS=Xenopus laevis GN=ccna2 PE=2 SV=1 Back     alignment and function description
>sp|P18606|CCNA1_XENLA Cyclin-A1 OS=Xenopus laevis GN=ccna1 PE=2 SV=1 Back     alignment and function description
>sp|P24861|CCNA_PATVU G2/mitotic-specific cyclin-A OS=Patella vulgata PE=2 SV=1 Back     alignment and function description
>sp|Q6AY13|CCNA1_RAT Cyclin-A1 OS=Rattus norvegicus GN=Ccna1 PE=2 SV=1 Back     alignment and function description
>sp|Q61456|CCNA1_MOUSE Cyclin-A1 OS=Mus musculus GN=Ccna1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query87
328712300 469 PREDICTED: cyclin-A2-like [Acyrthosiphon 0.620 0.115 0.685 3e-14
260806975 320 hypothetical protein BRAFLDRAFT_69715 [B 0.620 0.168 0.666 6e-14
334330877 609 PREDICTED: cyclin-A2-like [Monodelphis d 0.620 0.088 0.648 2e-13
302746225 463 cyclin A [Tachypleus tridentatus] gi|316 0.655 0.123 0.596 2e-13
345307429 377 PREDICTED: cyclin-A2-like [Ornithorhynch 0.620 0.143 0.648 3e-13
444721921 416 Cyclin-A2 [Tupaia chinensis] 0.620 0.129 0.648 3e-13
426232099 508 PREDICTED: cyclin-A2 [Ovis aries] 0.620 0.106 0.648 3e-13
48686579 380 cyclin A2 variant [Rattus norvegicus] 0.620 0.142 0.648 3e-13
395545189 419 PREDICTED: cyclin-A2 [Sarcophilus harris 0.620 0.128 0.648 3e-13
380708520 424 cyclin A2 [Oryctolagus cuniculus] 0.620 0.127 0.648 3e-13
>gi|328712300|ref|XP_001942828.2| PREDICTED: cyclin-A2-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score = 82.4 bits (202), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 37/54 (68%), Positives = 49/54 (90%)

Query: 34  ALFVASIIEVAEEYKMHNETLHLAINYVDRFLSLMSVVRSKLQLLGTTALFVAS 87
           A+ V  ++EVA+EYK+ NETL+LA++++DRFLSLMSVVR+KLQLLGT A+FVAS
Sbjct: 228 AILVDWLVEVAQEYKLQNETLYLAVSFIDRFLSLMSVVRAKLQLLGTAAMFVAS 281

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|260806975|ref|XP_002598359.1| hypothetical protein BRAFLDRAFT_69715 [Branchiostoma floridae] gi|229283631|gb|EEN54371.1| hypothetical protein BRAFLDRAFT_69715 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|334330877|ref|XP_001370768.2| PREDICTED: cyclin-A2-like [Monodelphis domestica] Back     alignment and taxonomy information
>gi|302746225|gb|ADL62716.1| cyclin A [Tachypleus tridentatus] gi|316936741|gb|ADU60363.1| cyclin A transcript variant 2 [Tachypleus tridentatus] gi|316936743|gb|ADU60364.1| cyclin A transcript variant 3 [Tachypleus tridentatus] gi|316936745|gb|ADU60365.1| cyclin A transcript variant 4 [Tachypleus tridentatus] Back     alignment and taxonomy information
>gi|345307429|ref|XP_001513040.2| PREDICTED: cyclin-A2-like [Ornithorhynchus anatinus] Back     alignment and taxonomy information
>gi|444721921|gb|ELW62628.1| Cyclin-A2 [Tupaia chinensis] Back     alignment and taxonomy information
>gi|426232099|ref|XP_004010072.1| PREDICTED: cyclin-A2 [Ovis aries] Back     alignment and taxonomy information
>gi|48686579|gb|AAT46045.1| cyclin A2 variant [Rattus norvegicus] Back     alignment and taxonomy information
>gi|395545189|ref|XP_003774487.1| PREDICTED: cyclin-A2 [Sarcophilus harrisii] Back     alignment and taxonomy information
>gi|380708520|gb|AFD97971.1| cyclin A2 [Oryctolagus cuniculus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query87
UNIPROTKB|F1LRT7 380 Ccna2 "Protein Ccna2" [Rattus 0.620 0.142 0.648 7.1e-14
UNIPROTKB|P43449 395 CCNA2 "Cyclin-A2" [Gallus gall 0.620 0.136 0.648 7.9e-14
UNIPROTKB|F1NJI2 398 CCNA2 "Cyclin-A2" [Gallus gall 0.620 0.135 0.648 8.1e-14
UNIPROTKB|G3V802 418 Ccna2 "Protein Ccna2" [Rattus 0.620 0.129 0.648 9.2e-14
MGI|MGI:108069 422 Ccna2 "cyclin A2" [Mus musculu 0.620 0.127 0.648 9.4e-14
UNIPROTKB|G8JKW1 429 CCNA2 "Cyclin-A2" [Bos taurus 0.620 0.125 0.648 9.8e-14
UNIPROTKB|P30274 430 CCNA2 "Cyclin-A2" [Bos taurus 0.620 0.125 0.648 9.9e-14
UNIPROTKB|F1NQG1 432 CCNA2 "Cyclin-A2" [Gallus gall 0.620 0.125 0.648 1e-13
UNIPROTKB|E2RQA2 432 CCNA2 "Uncharacterized protein 0.620 0.125 0.648 1e-13
UNIPROTKB|P20248 432 CCNA2 "Cyclin-A2" [Homo sapien 0.620 0.125 0.648 1e-13
UNIPROTKB|F1LRT7 Ccna2 "Protein Ccna2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
 Score = 185 (70.2 bits), Expect = 7.1e-14, P = 7.1e-14
 Identities = 35/54 (64%), Positives = 45/54 (83%)

Query:    34 ALFVASIIEVAEEYKMHNETLHLAINYVDRFLSLMSVVRSKLQLLGTTALFVAS 87
             A+ V  ++EV EEYK+ NETLHLA+NY+DRFLS MSV+R KLQL+GT A+ +AS
Sbjct:   160 AILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLAS 213
GO:0000079 "regulation of cyclin-dependent protein serine/threonine kinase activity" evidence=IEA
GO:0005634 "nucleus" evidence=IEA
GO:0007049 "cell cycle" evidence=IEA
GO:0019901 "protein kinase binding" evidence=IEA
GO:0051301 "cell division" evidence=IEA
UNIPROTKB|P43449 CCNA2 "Cyclin-A2" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NJI2 CCNA2 "Cyclin-A2" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|G3V802 Ccna2 "Protein Ccna2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:108069 Ccna2 "cyclin A2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|G8JKW1 CCNA2 "Cyclin-A2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P30274 CCNA2 "Cyclin-A2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1NQG1 CCNA2 "Cyclin-A2" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E2RQA2 CCNA2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P20248 CCNA2 "Cyclin-A2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P51943CCNA2_MOUSENo assigned EC number0.64810.62060.1279yesN/A
Q75I54CCA31_ORYSJNo assigned EC number0.51850.62060.1447yesN/A
Q9FMH5CCA31_ARATHNo assigned EC number0.51850.62060.1521yesN/A
P43449CCNA2_CHICKNo assigned EC number0.64810.62060.1367yesN/A
P30274CCNA2_BOVINNo assigned EC number0.64810.62060.1255yesN/A
P20248CCNA2_HUMANNo assigned EC number0.64810.62060.125yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query87
pfam00134127 pfam00134, Cyclin_N, Cyclin, N-terminal domain 6e-19
pfam00134127 pfam00134, Cyclin_N, Cyclin, N-terminal domain 5e-14
smart0038583 smart00385, CYCLIN, domain present in cyclins, TFI 7e-10
cd0004388 cd00043, CYCLIN, Cyclin box fold 1e-09
COG5024 440 COG5024, COG5024, Cyclin [Cell division and chromo 3e-08
smart0038583 smart00385, CYCLIN, domain present in cyclins, TFI 1e-07
cd0004388 cd00043, CYCLIN, Cyclin box fold 2e-07
COG5024 440 COG5024, COG5024, Cyclin [Cell division and chromo 2e-07
>gnl|CDD|215740 pfam00134, Cyclin_N, Cyclin, N-terminal domain Back     alignment and domain information 
 Score = 74.5 bits (184), Expect = 6e-19
 Identities = 27/48 (56%), Positives = 38/48 (79%)

Query: 40 IIEVAEEYKMHNETLHLAINYVDRFLSLMSVVRSKLQLLGTTALFVAS 87
          ++EV EE+K+  ETL+LA+NY+DRFLS   V R+KLQL+G T L +A+
Sbjct: 38 LVEVHEEFKLLPETLYLAVNYLDRFLSKQPVPRTKLQLVGVTCLLIAA 85

Cyclins regulate cyclin dependent kinases (CDKs). Human cyclin-O is a Uracil-DNA glycosylase that is related to other cyclins. Cyclins contain two domains of similar all-alpha fold, of which this family corresponds with the N-terminal domain. Length = 127
>gnl|CDD|215740 pfam00134, Cyclin_N, Cyclin, N-terminal domain Back     alignment and domain information
>gnl|CDD|214641 smart00385, CYCLIN, domain present in cyclins, TFIIB and Retinoblastoma Back     alignment and domain information
>gnl|CDD|238003 cd00043, CYCLIN, Cyclin box fold Back     alignment and domain information
>gnl|CDD|227357 COG5024, COG5024, Cyclin [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|214641 smart00385, CYCLIN, domain present in cyclins, TFIIB and Retinoblastoma Back     alignment and domain information
>gnl|CDD|238003 cd00043, CYCLIN, Cyclin box fold Back     alignment and domain information
>gnl|CDD|227357 COG5024, COG5024, Cyclin [Cell division and chromosome partitioning] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 87
KOG0655|consensus 408 99.82
KOG0653|consensus 391 99.76
KOG0656|consensus 335 99.76
COG5024 440 Cyclin [Cell division and chromosome partitioning] 99.69
PF00134127 Cyclin_N: Cyclin, N-terminal domain; InterPro: IPR 99.57
cd0004388 CYCLIN Cyclin box fold. Protein binding domain fun 99.16
KOG0654|consensus 359 99.12
smart0038583 CYCLIN domain present in cyclins, TFIIB and Retino 99.03
KOG0656|consensus 335 98.8
KOG0655|consensus 408 98.66
TIGR00569 305 ccl1 cyclin ccl1. University). 98.51
KOG0653|consensus 391 98.1
COG5024 440 Cyclin [Cell division and chromosome partitioning] 97.85
KOG0834|consensus 323 97.71
COG5333 297 CCL1 Cdk activating kinase (CAK)/RNA polymerase II 97.68
KOG0794|consensus 264 97.34
PF00134127 Cyclin_N: Cyclin, N-terminal domain; InterPro: IPR 97.13
KOG0654|consensus 359 96.52
PF0038271 TFIIB: Transcription factor TFIIB repeat; InterPro 96.1
KOG0835|consensus 367 96.1
cd0004388 CYCLIN Cyclin box fold. Protein binding domain fun 95.11
PF08613149 Cyclin: Cyclin; InterPro: IPR013922 Cyclins are eu 94.97
smart0038583 CYCLIN domain present in cyclins, TFIIB and Retino 93.8
PRK00423 310 tfb transcription initiation factor IIB; Reviewed 93.71
KOG2496|consensus 325 92.95
KOG4164|consensus497 92.21
PRK00423310 tfb transcription initiation factor IIB; Reviewed 91.14
COG1405285 SUA7 Transcription initiation factor TFIIIB, Brf1 91.09
TIGR00569 305 ccl1 cyclin ccl1. University). 89.69
PF02984118 Cyclin_C: Cyclin, C-terminal domain; InterPro: IPR 87.54
>KOG0655|consensus Back     alignment and domain information 
Probab=99.82  E-value=1.3e-20  Score=128.04  Aligned_cols=85  Identities=33%  Similarity=0.545  Sum_probs=77.0

Q ss_pred             cchhHHHHHHHHHHhcccccccc-cccChhhHHHHHHHHHHHHHhhhcchhHHHHHHHHHHHHhcc-CCCCccchHHHHH
Q psy14722          3 NETLHLAINYVDRFLSLMSVVRS-KLQLLGTTALFVASIIEVAEEYKMHNETLHLAINYVDRFLSL-MSVVRSKLQLLGT   80 (87)
Q Consensus         3 ~e~~~l~~~~~d~~l~~~~~~~~-~~~~~~~r~~li~w~~ev~~~~~l~~~tl~lav~~~Dr~L~~-~~~~~~~lqll~~   80 (87)
                      .|++-+..+-.++|+....+..| +...+.+|++++||++|||+-+++-.||||+|++|+||||.. .++.++++||+|+
T Consensus       114 ~eVW~lM~kkee~~l~~~~~l~qHpdlqp~mRaILlDWlmEVCEvykLHRETFyLAvDy~DRyl~t~~~v~kt~lQLIGi  193 (408)
T KOG0655|consen  114 KEVWLLMLKKEERYLRDKHFLEQHPDLQPQMRAILLDWLMEVCEVYKLHRETFYLAVDYFDRYLETQVEVSKTNLQLIGI  193 (408)
T ss_pred             HHHHHHHHccchhhhhhhHHHhhCCCCCHHHHHHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHHHHHHHhhhhhHHHhhH
Confidence            47788888999999988877654 557799999999999999999999999999999999999988 5788999999999


Q ss_pred             HHHHhcC
Q psy14722         81 TALFVAS   87 (87)
Q Consensus        81 ~~l~iAs   87 (87)
                      +||||||
T Consensus       194 tsLFIAA  200 (408)
T KOG0655|consen  194 TSLFIAA  200 (408)
T ss_pred             HHHHHHH
Confidence            9999996

>KOG0653|consensus Back     alignment and domain information
>KOG0656|consensus Back     alignment and domain information
>COG5024 Cyclin [Cell division and chromosome partitioning] Back     alignment and domain information
>PF00134 Cyclin_N: Cyclin, N-terminal domain; InterPro: IPR006671 Cyclins are eukaryotic proteins that play an active role in controlling nuclear cell division cycles [], and regulate cyclin dependent kinases (CDKs) Back     alignment and domain information
>cd00043 CYCLIN Cyclin box fold Back     alignment and domain information
>KOG0654|consensus Back     alignment and domain information
>smart00385 CYCLIN domain present in cyclins, TFIIB and Retinoblastoma Back     alignment and domain information
>KOG0656|consensus Back     alignment and domain information
>KOG0655|consensus Back     alignment and domain information
>TIGR00569 ccl1 cyclin ccl1 Back     alignment and domain information
>KOG0653|consensus Back     alignment and domain information
>COG5024 Cyclin [Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0834|consensus Back     alignment and domain information
>COG5333 CCL1 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, cyclin H subunit [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0794|consensus Back     alignment and domain information
>PF00134 Cyclin_N: Cyclin, N-terminal domain; InterPro: IPR006671 Cyclins are eukaryotic proteins that play an active role in controlling nuclear cell division cycles [], and regulate cyclin dependent kinases (CDKs) Back     alignment and domain information
>KOG0654|consensus Back     alignment and domain information
>PF00382 TFIIB: Transcription factor TFIIB repeat; InterPro: IPR013150 Cyclins are eukaryotic proteins that play an active role in controlling nuclear cell division cycles [], and regulate cyclin dependent kinases (CDKs) Back     alignment and domain information
>KOG0835|consensus Back     alignment and domain information
>cd00043 CYCLIN Cyclin box fold Back     alignment and domain information
>PF08613 Cyclin: Cyclin; InterPro: IPR013922 Cyclins are eukaryotic proteins that play an active role in controlling nuclear cell division cycles [], and regulate cyclin dependent kinases (CDKs) Back     alignment and domain information
>smart00385 CYCLIN domain present in cyclins, TFIIB and Retinoblastoma Back     alignment and domain information
>PRK00423 tfb transcription initiation factor IIB; Reviewed Back     alignment and domain information
>KOG2496|consensus Back     alignment and domain information
>KOG4164|consensus Back     alignment and domain information
>PRK00423 tfb transcription initiation factor IIB; Reviewed Back     alignment and domain information
>COG1405 SUA7 Transcription initiation factor TFIIIB, Brf1 subunit/Transcription initiation factor TFIIB [Transcription] Back     alignment and domain information
>TIGR00569 ccl1 cyclin ccl1 Back     alignment and domain information
>PF02984 Cyclin_C: Cyclin, C-terminal domain; InterPro: IPR004367 Cyclins are eukaryotic proteins that play an active role in controlling nuclear cell division cycles [], and regulate cyclin dependent kinases (CDKs) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query87
1vyw_B 265 Structure Of Cdk2CYCLIN A WITH PNU-292137 Length = 6e-16
4bcq_B 262 Structure Of Cdk2 In Complex With Cyclin A And A 2- 6e-16
1jst_B 258 Phosphorylated Cyclin-Dependent Kinase-2 Bound To C 6e-16
1ogu_B 260 Structure Of Human Thr160-phospho Cdk2/cyclin A Com 6e-16
1fin_B 260 Cyclin A-Cyclin-Dependent Kinase 2 Complex Length = 6e-16
1e9h_B 261 Thr 160 Phosphorylated Cdk2-Human Cyclin A3 Complex 6e-16
1qmz_B 259 Phosphorylated Cdk2-Cyclyin A-Substrate Peptide Com 6e-16
2x1n_B 261 Truncation And Optimisation Of Peptide Inhibitors O 6e-16
3f5x_B 256 Cdk-2-Cyclin Complex With Indazole Inhibitor 9 Boun 6e-16
3qhr_B 261 Structure Of A Pcdk2CYCLINA TRANSITION-State Mimic 6e-16
4i3z_B 257 Structure Of Pcdk2CYCLINA BOUND TO ADP AND 2 MAGNES 7e-16
4bco_B 262 Structure Of Cdk2 In Complex With Cyclin A And A 2- 7e-16
4ii5_B 258 Structure Of Pcdk2/cyclina Bound To Adp And 1 Magne 7e-16
3ddq_B 269 Structure Of Phosphorylated Thr160 Cdk2CYCLIN A IN 7e-16
3ddp_B 268 Structure Of Phosphorylated Thr160 Cdk2CYCLIN A IN 7e-16
3bht_B 262 Structure Of Phosphorylated Thr160 Cdk2CYCLIN A IN 7e-16
4bcq_D 262 Structure Of Cdk2 In Complex With Cyclin A And A 2- 7e-16
2g9x_B 262 Structure Of Thr 160 Phosphorylated Cdk2CYCLIN A IN 7e-16
1vin_A 268 Bovine Cyclin A3 Length = 268 7e-16
3dog_B 264 Structure Of Thr 160 Phosphorylated Cdk2CYCLIN A IN 7e-16
2w9z_A 257 Crystal Structure Of Cdk4 In Complex With A D-Type 5e-11
2w96_A 271 Crystal Structure Of Cdk4 In Complex With A D-Type 2e-09
1w98_B 283 The Structural Basis Of Cdk2 Activation By Cyclin E 2e-06
3g33_B 306 Crystal Structure Of Cdk4CYCLIN D3 Length = 306 3e-06
2b9r_A 269 Crystal Structure Of Human Cyclin B1 Length = 269 4e-06
2jgz_B 260 Crystal Structure Of Phospho-Cdk2 In Complex With C 2e-05
>pdb|1VYW|B Chain B, Structure Of Cdk2CYCLIN A WITH PNU-292137 Length = 265 Back     alignment and structure 
Iteration: 1

 Score = 79.0 bits (193), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 35/54 (64%), Positives = 45/54 (83%)
Query: 34 ALFVASIIEVAEEYKMHNETLHLAINYVDRFLSLMSVVRSKLQLLGTTALFVAS 87
          A+ V  ++EV EEYK+ NETLHLA+NY+DRFLS MSV+R KLQL+GT A+ +AS
Sbjct: 45 AILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLAS 98
>pdb|4BCQ|B Chain B, Structure Of Cdk2 In Complex With Cyclin A And A 2-amino-4- Heteroaryl-pyrimidine Inhibitor Length = 262 Back     alignment and structure
>pdb|1JST|B Chain B, Phosphorylated Cyclin-Dependent Kinase-2 Bound To Cyclin A Length = 258 Back     alignment and structure
>pdb|1OGU|B Chain B, Structure Of Human Thr160-phospho Cdk2/cyclin A Complexed With A 2-arylamino-4-cyclohexylmethyl-5-nitroso-6- aminopyrimidine Inhibitor Length = 260 Back     alignment and structure
>pdb|1FIN|B Chain B, Cyclin A-Cyclin-Dependent Kinase 2 Complex Length = 260 Back     alignment and structure
>pdb|1E9H|B Chain B, Thr 160 Phosphorylated Cdk2-Human Cyclin A3 Complex With The Inhibitor Indirubin-5-Sulphonate Bound Length = 261 Back     alignment and structure
>pdb|1QMZ|B Chain B, Phosphorylated Cdk2-Cyclyin A-Substrate Peptide Complex Length = 259 Back     alignment and structure
>pdb|2X1N|B Chain B, Truncation And Optimisation Of Peptide Inhibitors Of Cdk2, Cyclin A Through Structure Guided Design Length = 261 Back     alignment and structure
>pdb|3F5X|B Chain B, Cdk-2-Cyclin Complex With Indazole Inhibitor 9 Bound At Its Active Site Length = 256 Back     alignment and structure
>pdb|3QHR|B Chain B, Structure Of A Pcdk2CYCLINA TRANSITION-State Mimic Length = 261 Back     alignment and structure
>pdb|4I3Z|B Chain B, Structure Of Pcdk2CYCLINA BOUND TO ADP AND 2 MAGNESIUM IONS Length = 257 Back     alignment and structure
>pdb|4BCO|B Chain B, Structure Of Cdk2 In Complex With Cyclin A And A 2-amino-4- Heteroaryl-pyrimidine Inhibitor Length = 262 Back     alignment and structure
>pdb|4II5|B Chain B, Structure Of Pcdk2/cyclina Bound To Adp And 1 Magnesium Ion Length = 258 Back     alignment and structure
>pdb|3DDQ|B Chain B, Structure Of Phosphorylated Thr160 Cdk2CYCLIN A IN COMPLEX With The Inhibitor Roscovitine Length = 269 Back     alignment and structure
>pdb|3DDP|B Chain B, Structure Of Phosphorylated Thr160 Cdk2CYCLIN A IN COMPLEX With The Inhibitor Cr8 Length = 268 Back     alignment and structure
>pdb|3BHT|B Chain B, Structure Of Phosphorylated Thr160 Cdk2CYCLIN A IN COMPLEX WITH THE Inhibitor Meriolin 3 Length = 262 Back     alignment and structure
>pdb|4BCQ|D Chain D, Structure Of Cdk2 In Complex With Cyclin A And A 2-amino-4- Heteroaryl-pyrimidine Inhibitor Length = 262 Back     alignment and structure
>pdb|2G9X|B Chain B, Structure Of Thr 160 Phosphorylated Cdk2CYCLIN A IN COMPLEX WITH THE Inhibitor Nu6271 Length = 262 Back     alignment and structure
>pdb|1VIN|A Chain A, Bovine Cyclin A3 Length = 268 Back     alignment and structure
>pdb|3DOG|B Chain B, Structure Of Thr 160 Phosphorylated Cdk2CYCLIN A IN Complex With The Inhibitor N-&-N1 Length = 264 Back     alignment and structure
>pdb|2W9Z|A Chain A, Crystal Structure Of Cdk4 In Complex With A D-Type Cyclin Length = 257 Back     alignment and structure
>pdb|2W96|A Chain A, Crystal Structure Of Cdk4 In Complex With A D-Type Cyclin Length = 271 Back     alignment and structure
>pdb|1W98|B Chain B, The Structural Basis Of Cdk2 Activation By Cyclin E Length = 283 Back     alignment and structure
>pdb|3G33|B Chain B, Crystal Structure Of Cdk4CYCLIN D3 Length = 306 Back     alignment and structure
>pdb|2B9R|A Chain A, Crystal Structure Of Human Cyclin B1 Length = 269 Back     alignment and structure
>pdb|2JGZ|B Chain B, Crystal Structure Of Phospho-Cdk2 In Complex With Cyclin B Length = 260 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query87
2f2c_A 254 Cyclin homolog, V-cyclin; small molecule inhibitor 3e-21
2f2c_A254 Cyclin homolog, V-cyclin; small molecule inhibitor 5e-16
2w96_A 271 G1/S-specific cyclin-D1; serine/threonine-protein 3e-21
2w96_A 271 G1/S-specific cyclin-D1; serine/threonine-protein 5e-16
3g33_B 306 CCND3 protein; Ser/Thr protein kinase, cell cycle, 5e-21
3g33_B 306 CCND3 protein; Ser/Thr protein kinase, cell cycle, 7e-16
2cch_B 260 Cyclin A2, cyclin-A; complex(transferase/cell divi 6e-21
2cch_B 260 Cyclin A2, cyclin-A; complex(transferase/cell divi 7e-16
1g3n_C 257 V-cyclin; cyclin-dependent kinase, INK4 inhibitor, 1e-20
1g3n_C 257 V-cyclin; cyclin-dependent kinase, INK4 inhibitor, 1e-15
2b9r_A 269 Human cyclin B1; cell cycle; 2.90A {Homo sapiens} 3e-20
2b9r_A 269 Human cyclin B1; cell cycle; 2.90A {Homo sapiens} 2e-15
1w98_B 283 Cyclin E, G1/S-specific cyclin E1; cell cycle, tra 5e-19
1w98_B 283 Cyclin E, G1/S-specific cyclin E1; cell cycle, tra 5e-14
1f5q_B 252 Gamma herpesvirus cyclin; herpesviral cyclin, cycl 6e-19
1f5q_B 252 Gamma herpesvirus cyclin; herpesviral cyclin, cycl 6e-15
2i53_A 258 Cyclin K; cell cycle, transcription, cyclin BOX, C 8e-05
2pk2_A 358 Cyclin-T1, protein TAT; TAR, twinning, transcripti 1e-04
>2f2c_A Cyclin homolog, V-cyclin; small molecule inhibitor bound between N-terminal and C-TERM domain of kinase, cell cycle-transferase complex; HET: AP9; 2.80A {Herpesvirus saimiri} SCOP: a.74.1.1 a.74.1.1 PDB: 1jow_A* 2euf_A* 1xo2_A* 1bu2_A Length = 254 Back     alignment and structure
 Score = 82.8 bits (205), Expect = 3e-21
 Identities = 9/48 (18%), Positives = 23/48 (47%)

Query: 40  IIEVAEEYKMHNETLHLAINYVDRFLSLMSVVRSKLQLLGTTALFVAS 87
           +  + E +++      L+++ +DR+L      +  LQ +G   + + S
Sbjct: 59  MHLLCESFELDKSVFPLSVSILDRYLCKKQGTKKTLQKIGAACVLIGS 106
>2f2c_A Cyclin homolog, V-cyclin; small molecule inhibitor bound between N-terminal and C-TERM domain of kinase, cell cycle-transferase complex; HET: AP9; 2.80A {Herpesvirus saimiri} SCOP: a.74.1.1 a.74.1.1 PDB: 1jow_A* 2euf_A* 1xo2_A* 1bu2_A Length = 254 Back     alignment and structure
>2w96_A G1/S-specific cyclin-D1; serine/threonine-protein kinase, chromosomal rearrangement, ATP-binding, transferase, polymorphism, cell division; 2.30A {Homo sapiens} PDB: 2w99_A 2w9f_A 2w9z_A Length = 271 Back     alignment and structure
>2w96_A G1/S-specific cyclin-D1; serine/threonine-protein kinase, chromosomal rearrangement, ATP-binding, transferase, polymorphism, cell division; 2.30A {Homo sapiens} PDB: 2w99_A 2w9f_A 2w9z_A Length = 271 Back     alignment and structure
>3g33_B CCND3 protein; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Length = 306 Back     alignment and structure
>3g33_B CCND3 protein; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Length = 306 Back     alignment and structure
>2cch_B Cyclin A2, cyclin-A; complex(transferase/cell division), ATP-binding, CDK2, cell cycle, cyclin, mitosis, nuclear protein; HET: TPO ATP; 1.7A {Homo sapiens} SCOP: a.74.1.1 a.74.1.1 PDB: 1fvv_B* 1jsu_B* 1okv_B 1okw_B* 1ol1_B* 1ol2_B* 1urc_B 1fin_B* 2c5p_B* 2c5o_B* 2i40_B* 2wev_B* 2wfy_B 2whb_B* 3eid_B* 3ej1_B* 3eoc_B* 2wha_B* 2x1n_B* 1vyw_B* ... Length = 260 Back     alignment and structure
>2cch_B Cyclin A2, cyclin-A; complex(transferase/cell division), ATP-binding, CDK2, cell cycle, cyclin, mitosis, nuclear protein; HET: TPO ATP; 1.7A {Homo sapiens} SCOP: a.74.1.1 a.74.1.1 PDB: 1fvv_B* 1jsu_B* 1okv_B 1okw_B* 1ol1_B* 1ol2_B* 1urc_B 1fin_B* 2c5p_B* 2c5o_B* 2i40_B* 2wev_B* 2wfy_B 2whb_B* 3eid_B* 3ej1_B* 3eoc_B* 2wha_B* 2x1n_B* 1vyw_B* ... Length = 260 Back     alignment and structure
>1g3n_C V-cyclin; cyclin-dependent kinase, INK4 inhibitor, viral cyclin, cell cycle, signaling protein; 2.90A {Human herpesvirus 8} SCOP: a.74.1.1 a.74.1.1 Length = 257 Back     alignment and structure
>1g3n_C V-cyclin; cyclin-dependent kinase, INK4 inhibitor, viral cyclin, cell cycle, signaling protein; 2.90A {Human herpesvirus 8} SCOP: a.74.1.1 a.74.1.1 Length = 257 Back     alignment and structure
>2b9r_A Human cyclin B1; cell cycle; 2.90A {Homo sapiens} PDB: 2jgz_B* Length = 269 Back     alignment and structure
>2b9r_A Human cyclin B1; cell cycle; 2.90A {Homo sapiens} PDB: 2jgz_B* Length = 269 Back     alignment and structure
>1w98_B Cyclin E, G1/S-specific cyclin E1; cell cycle, transferase; HET: TPO; 2.15A {Homo sapiens} SCOP: a.74.1.1 a.74.1.1 Length = 283 Back     alignment and structure
>1w98_B Cyclin E, G1/S-specific cyclin E1; cell cycle, transferase; HET: TPO; 2.15A {Homo sapiens} SCOP: a.74.1.1 a.74.1.1 Length = 283 Back     alignment and structure
>1f5q_B Gamma herpesvirus cyclin; herpesviral cyclin, cyclin dependent kinase. protein/protein complex, transferase; 2.50A {Murid herpesvirus 4} SCOP: a.74.1.1 a.74.1.1 Length = 252 Back     alignment and structure
>1f5q_B Gamma herpesvirus cyclin; herpesviral cyclin, cyclin dependent kinase. protein/protein complex, transferase; 2.50A {Murid herpesvirus 4} SCOP: a.74.1.1 a.74.1.1 Length = 252 Back     alignment and structure
>2i53_A Cyclin K; cell cycle, transcription, cyclin BOX, CDK9, positive transcription elongation factor, P-TEFB; 1.50A {Homo sapiens} SCOP: a.74.1.1 a.74.1.1 Length = 258 Back     alignment and structure
>2pk2_A Cyclin-T1, protein TAT; TAR, twinning, transcription regulation P- TEFB, cell cycle; 2.67A {Homo sapiens} SCOP: a.74.1.1 a.74.1.1 PDB: 2w2h_C Length = 358 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query87
1f5q_B 252 Gamma herpesvirus cyclin; herpesviral cyclin, cycl 99.86
2f2c_A 254 Cyclin homolog, V-cyclin; small molecule inhibitor 99.82
1g3n_C 257 V-cyclin; cyclin-dependent kinase, INK4 inhibitor, 99.81
3g33_B 306 CCND3 protein; Ser/Thr protein kinase, cell cycle, 99.79
2w96_A 271 G1/S-specific cyclin-D1; serine/threonine-protein 99.78
2b9r_A 269 Human cyclin B1; cell cycle; 2.90A {Homo sapiens} 99.78
2cch_B 260 Cyclin A2, cyclin-A; complex(transferase/cell divi 99.77
1w98_B 283 Cyclin E, G1/S-specific cyclin E1; cell cycle, tra 99.74
2i53_A 258 Cyclin K; cell cycle, transcription, cyclin BOX, C 99.55
2ivx_A 257 Cyclin-T2; transcription regulation, cell division 99.52
2pk2_A 358 Cyclin-T1, protein TAT; TAR, twinning, transcripti 99.47
1zp2_A 235 RNA polymerase II holoenzyme cyclin-like subunit; 99.45
3rgf_B 285 Cyclin-C; protein kinase complex, transferase,tran 99.41
1jkw_A 323 Cyclin H; cell cycle, cell division, nuclear prote 99.26
1f5q_B252 Gamma herpesvirus cyclin; herpesviral cyclin, cycl 98.94
2f2c_A254 Cyclin homolog, V-cyclin; small molecule inhibitor 98.84
1g3n_C 257 V-cyclin; cyclin-dependent kinase, INK4 inhibitor, 98.81
2b9r_A 269 Human cyclin B1; cell cycle; 2.90A {Homo sapiens} 98.7
3g33_B 306 CCND3 protein; Ser/Thr protein kinase, cell cycle, 98.69
2cch_B 260 Cyclin A2, cyclin-A; complex(transferase/cell divi 98.56
1w98_B 283 Cyclin E, G1/S-specific cyclin E1; cell cycle, tra 98.54
1c9b_A 207 General transcription factor IIB; protein-DNA comp 98.51
2w96_A 271 G1/S-specific cyclin-D1; serine/threonine-protein 98.48
1zp2_A 235 RNA polymerase II holoenzyme cyclin-like subunit; 98.23
2i53_A 258 Cyclin K; cell cycle, transcription, cyclin BOX, C 98.17
2ivx_A 257 Cyclin-T2; transcription regulation, cell division 98.07
3rgf_B 285 Cyclin-C; protein kinase complex, transferase,tran 97.93
1ais_B 200 TFB TFIIB, protein (transcription initiation facto 97.91
1c9b_A207 General transcription factor IIB; protein-DNA comp 97.52
2pk2_A 358 Cyclin-T1, protein TAT; TAR, twinning, transcripti 97.24
1jkw_A 323 Cyclin H; cell cycle, cell division, nuclear prote 96.8
1ais_B200 TFB TFIIB, protein (transcription initiation facto 96.38
3k7a_M 345 Transcription initiation factor IIB; RNA polymeras 96.0
4bbr_M 345 Transcription initiation factor IIB; RNA polymeras 94.82
2pmi_B 293 PHO85 cyclin PHO80, aminoglycoside anti; cyclin-de 90.32
3h4c_A 260 Transcription factor TFIIB-like; cyclin, transcrip 85.14
3k7a_M345 Transcription initiation factor IIB; RNA polymeras 84.6
>1f5q_B Gamma herpesvirus cyclin; herpesviral cyclin, cyclin dependent kinase. protein/protein complex, transferase; 2.50A {Murid herpesvirus 4} SCOP: a.74.1.1 a.74.1.1 Back     alignment and structure
Probab=99.86  E-value=6.5e-22  Score=130.57  Aligned_cols=81  Identities=15%  Similarity=0.158  Sum_probs=72.1

Q ss_pred             chhHHHHHHHHHHhcccccccccccChhhHHHHHHHHHHHHHhhhcchhHHHHHHHHHHHHhccCCCCccchHHHHHHHH
Q psy14722          4 ETLHLAINYVDRFLSLMSVVRSKLQLLGTTALFVASIIEVAEEYKMHNETLHLAINYVDRFLSLMSVVRSKLQLLGTTAL   83 (87)
Q Consensus         4 e~~~l~~~~~d~~l~~~~~~~~~~~~~~~r~~li~w~~ev~~~~~l~~~tl~lav~~~Dr~L~~~~~~~~~lqll~~~~l   83 (87)
                      |.+......+.+|.+   ...|+.+++.+|.++++|+.+|+.++++.++|+++||+++|||+++.+++++++|++|++||
T Consensus        23 ~i~~~l~~~E~~~~p---~~~q~~i~~~~R~~lvdWl~ev~~~~~l~~eT~~lAv~~lDRfLs~~~v~~~~lqLvg~tcl   99 (252)
T 1f5q_B           23 MIYRSEREHDARMVG---VNVDQHFTSQYRKVLTTWMFCVCKDLRQDNNVFPLAVALLDELFLSTRIDRENYQSTAAVAL   99 (252)
T ss_dssp             HHHHHHHHHHHHHSS---SSHHHHHHCSHHHHHHHHHHHHHHHTTCCTTHHHHHHHHHHHHHHHSCCCGGGHHHHHHHHH
T ss_pred             HHHHHHHHHHHHhCc---CccCCCCCHHHHHHHHHHHHHHHHHcCCChHHHHHHHHHHHHHhcCCCcCHHHHHHHHHHHH
Confidence            344555677778876   34567789999999999999999999999999999999999999999999999999999999


Q ss_pred             HhcC
Q psy14722         84 FVAS   87 (87)
Q Consensus        84 ~iAs   87 (87)
                      +|||
T Consensus       100 ~iAs  103 (252)
T 1f5q_B          100 HIAG  103 (252)
T ss_dssp             HHHH
T ss_pred             HHHH
Confidence            9996
>2f2c_A Cyclin homolog, V-cyclin; small molecule inhibitor bound between N-terminal and C-TERM domain of kinase, cell cycle-transferase complex; HET: AP9; 2.80A {Herpesvirus saimiri} SCOP: a.74.1.1 a.74.1.1 PDB: 1jow_A* 2euf_A* 1xo2_A* 1bu2_A Back     alignment and structure
>1g3n_C V-cyclin; cyclin-dependent kinase, INK4 inhibitor, viral cyclin, cell cycle, signaling protein; 2.90A {Human herpesvirus 8} SCOP: a.74.1.1 a.74.1.1 Back     alignment and structure
>3g33_B CCND3 protein; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Back     alignment and structure
>2w96_A G1/S-specific cyclin-D1; serine/threonine-protein kinase, chromosomal rearrangement, ATP-binding, transferase, polymorphism, cell division; 2.30A {Homo sapiens} PDB: 2w99_A 2w9f_A 2w9z_A Back     alignment and structure
>2b9r_A Human cyclin B1; cell cycle; 2.90A {Homo sapiens} PDB: 2jgz_B* Back     alignment and structure
>2cch_B Cyclin A2, cyclin-A; complex(transferase/cell division), ATP-binding, CDK2, cell cycle, cyclin, mitosis, nuclear protein; HET: TPO ATP; 1.7A {Homo sapiens} SCOP: a.74.1.1 a.74.1.1 PDB: 1fvv_B* 1jsu_B* 1okv_B 1okw_B* 1ol1_B* 1ol2_B* 1urc_B 1fin_B* 2c5p_B* 2c5o_B* 2i40_B* 2wev_B* 2wfy_B 2whb_B* 3eid_B* 3ej1_B* 3eoc_B* 2wha_B* 2x1n_B* 1vyw_B* ... Back     alignment and structure
>1w98_B Cyclin E, G1/S-specific cyclin E1; cell cycle, transferase; HET: TPO; 2.15A {Homo sapiens} SCOP: a.74.1.1 a.74.1.1 Back     alignment and structure
>2i53_A Cyclin K; cell cycle, transcription, cyclin BOX, CDK9, positive transcription elongation factor, P-TEFB; 1.50A {Homo sapiens} SCOP: a.74.1.1 a.74.1.1 Back     alignment and structure
>2ivx_A Cyclin-T2; transcription regulation, cell division, phosphorylation, NU protein, cell cycle, transcription; 1.8A {Homo sapiens} SCOP: a.74.1.1 a.74.1.1 PDB: 2w2h_A 3mi9_B* 3mia_B* 3tnh_B* 3tni_B* 3blh_B* 3blq_B* 3blr_B* 3lq5_B* 3my1_B* 3tn8_B* Back     alignment and structure
>2pk2_A Cyclin-T1, protein TAT; TAR, twinning, transcription regulation P- TEFB, cell cycle; 2.67A {Homo sapiens} SCOP: a.74.1.1 a.74.1.1 PDB: 2w2h_C Back     alignment and structure
>1zp2_A RNA polymerase II holoenzyme cyclin-like subunit; cyclin repeat domains, transcription-cell cycle complex; 3.00A {Schizosaccharomyces pombe} Back     alignment and structure
>3rgf_B Cyclin-C; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Back     alignment and structure
>1jkw_A Cyclin H; cell cycle, cell division, nuclear protein; 2.60A {Homo sapiens} SCOP: a.74.1.1 a.74.1.1 PDB: 1kxu_A Back     alignment and structure
>1f5q_B Gamma herpesvirus cyclin; herpesviral cyclin, cyclin dependent kinase. protein/protein complex, transferase; 2.50A {Murid herpesvirus 4} SCOP: a.74.1.1 a.74.1.1 Back     alignment and structure
>2f2c_A Cyclin homolog, V-cyclin; small molecule inhibitor bound between N-terminal and C-TERM domain of kinase, cell cycle-transferase complex; HET: AP9; 2.80A {Herpesvirus saimiri} SCOP: a.74.1.1 a.74.1.1 PDB: 1jow_A* 2euf_A* 1xo2_A* 1bu2_A Back     alignment and structure
>1g3n_C V-cyclin; cyclin-dependent kinase, INK4 inhibitor, viral cyclin, cell cycle, signaling protein; 2.90A {Human herpesvirus 8} SCOP: a.74.1.1 a.74.1.1 Back     alignment and structure
>2b9r_A Human cyclin B1; cell cycle; 2.90A {Homo sapiens} PDB: 2jgz_B* Back     alignment and structure
>3g33_B CCND3 protein; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Back     alignment and structure
>2cch_B Cyclin A2, cyclin-A; complex(transferase/cell division), ATP-binding, CDK2, cell cycle, cyclin, mitosis, nuclear protein; HET: TPO ATP; 1.7A {Homo sapiens} SCOP: a.74.1.1 a.74.1.1 PDB: 1fvv_B* 1jsu_B* 1okv_B 1okw_B* 1ol1_B* 1ol2_B* 1urc_B 1fin_B* 2c5p_B* 2c5o_B* 2i40_B* 2wev_B* 2wfy_B 2whb_B* 3eid_B* 3ej1_B* 3eoc_B* 2wha_B* 2x1n_B* 1vyw_B* ... Back     alignment and structure
>1w98_B Cyclin E, G1/S-specific cyclin E1; cell cycle, transferase; HET: TPO; 2.15A {Homo sapiens} SCOP: a.74.1.1 a.74.1.1 Back     alignment and structure
>1c9b_A General transcription factor IIB; protein-DNA complex, cyclin-like fold, helix-turn-helix, transcription/DNA complex; 2.65A {Homo sapiens} SCOP: a.74.1.2 a.74.1.2 PDB: 1tfb_A 2phg_A 1vol_A* Back     alignment and structure
>2w96_A G1/S-specific cyclin-D1; serine/threonine-protein kinase, chromosomal rearrangement, ATP-binding, transferase, polymorphism, cell division; 2.30A {Homo sapiens} PDB: 2w99_A 2w9f_A 2w9z_A Back     alignment and structure
>1zp2_A RNA polymerase II holoenzyme cyclin-like subunit; cyclin repeat domains, transcription-cell cycle complex; 3.00A {Schizosaccharomyces pombe} Back     alignment and structure
>2i53_A Cyclin K; cell cycle, transcription, cyclin BOX, CDK9, positive transcription elongation factor, P-TEFB; 1.50A {Homo sapiens} SCOP: a.74.1.1 a.74.1.1 Back     alignment and structure
>2ivx_A Cyclin-T2; transcription regulation, cell division, phosphorylation, NU protein, cell cycle, transcription; 1.8A {Homo sapiens} SCOP: a.74.1.1 a.74.1.1 PDB: 2w2h_A 3mi9_B* 3mia_B* 3tnh_B* 3tni_B* 3blh_B* 3blq_B* 3blr_B* 3lq5_B* 3my1_B* 3tn8_B* Back     alignment and structure
>3rgf_B Cyclin-C; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Back     alignment and structure
>1ais_B TFB TFIIB, protein (transcription initiation factor IIB); hyperthermophIle, ribosome binding, complex (ribosome binding/ DNA); HET: DNA 5IU; 2.10A {Pyrococcus woesei} SCOP: a.74.1.2 a.74.1.2 PDB: 1d3u_B* Back     alignment and structure
>1c9b_A General transcription factor IIB; protein-DNA complex, cyclin-like fold, helix-turn-helix, transcription/DNA complex; 2.65A {Homo sapiens} SCOP: a.74.1.2 a.74.1.2 PDB: 1tfb_A 2phg_A 1vol_A* Back     alignment and structure
>2pk2_A Cyclin-T1, protein TAT; TAR, twinning, transcription regulation P- TEFB, cell cycle; 2.67A {Homo sapiens} SCOP: a.74.1.1 a.74.1.1 PDB: 2w2h_C Back     alignment and structure
>1jkw_A Cyclin H; cell cycle, cell division, nuclear protein; 2.60A {Homo sapiens} SCOP: a.74.1.1 a.74.1.1 PDB: 1kxu_A Back     alignment and structure
>1ais_B TFB TFIIB, protein (transcription initiation factor IIB); hyperthermophIle, ribosome binding, complex (ribosome binding/ DNA); HET: DNA 5IU; 2.10A {Pyrococcus woesei} SCOP: a.74.1.2 a.74.1.2 PDB: 1d3u_B* Back     alignment and structure
>3k7a_M Transcription initiation factor IIB; RNA polymerase II, TFIIB, DNA-binding, DNA- directed RNA polymerase, isopeptide bond, magnesium; 3.80A {Saccharomyces cerevisiae} Back     alignment and structure
>4bbr_M Transcription initiation factor IIB; RNA polymerase, TFIIB; 3.40A {Saccharomyces cerevisiae} PDB: 3k7a_M 4bbs_M Back     alignment and structure
>2pmi_B PHO85 cyclin PHO80, aminoglycoside anti; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_B* Back     alignment and structure
>3h4c_A Transcription factor TFIIB-like; cyclin, transcription factor TFIIB repeat; 2.30A {Trypanosoma brucei brucei} Back     alignment and structure
>3k7a_M Transcription initiation factor IIB; RNA polymerase II, TFIIB, DNA-binding, DNA- directed RNA polymerase, isopeptide bond, magnesium; 3.80A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 87
d1bu2a1127 a.74.1.1 (A:22-148) Viral cyclin {Herpesvirus saim 1e-14
d1bu2a1127 a.74.1.1 (A:22-148) Viral cyclin {Herpesvirus saim 5e-11
d2cchb1128 a.74.1.1 (B:181-308) Cyclin A {Cow (Bos taurus) [T 1e-12
d2cchb1128 a.74.1.1 (B:181-308) Cyclin A {Cow (Bos taurus) [T 4e-09
d1f5qb1141 a.74.1.1 (B:6-146) Viral cyclin {Murine herpesviru 1e-12
d1f5qb1141 a.74.1.1 (B:6-146) Viral cyclin {Murine herpesviru 1e-08
d1g3nc1132 a.74.1.1 (C:16-147) Viral cyclin {Kaposi's sarcoma 2e-11
d1g3nc1132 a.74.1.1 (C:16-147) Viral cyclin {Kaposi's sarcoma 1e-07
d2i53a1144 a.74.1.1 (A:14-157) Cyclin K {Human (Homo sapiens) 3e-10
d2i53a1144 a.74.1.1 (A:14-157) Cyclin K {Human (Homo sapiens) 4e-07
d2ivxa1143 a.74.1.1 (A:7-149) Cyclin-T2 {Human (Homo sapiens) 5e-10
d2ivxa1143 a.74.1.1 (A:7-149) Cyclin-T2 {Human (Homo sapiens) 8e-07
d1w98b2140 a.74.1.1 (B:88-227) G1/S-specific cyclin-E1 {Human 9e-10
d1w98b2140 a.74.1.1 (B:88-227) G1/S-specific cyclin-E1 {Human 2e-06
d1jkwa1151 a.74.1.1 (A:11-161) Cyclin H (mcs2) {Human (Homo s 5e-09
d1jkwa1151 a.74.1.1 (A:11-161) Cyclin H (mcs2) {Human (Homo s 3e-07
>d1bu2a1 a.74.1.1 (A:22-148) Viral cyclin {Herpesvirus saimiri [TaxId: 10381]} Length = 127 Back     information, alignment and structure

class: All alpha proteins
fold: Cyclin-like
superfamily: Cyclin-like
family: Cyclin
domain: Viral cyclin
species: Herpesvirus saimiri [TaxId: 10381]

 Score = 61.8 bits (150), Expect = 1e-14
 Identities = 9/48 (18%), Positives = 23/48 (47%)

Query: 40 IIEVAEEYKMHNETLHLAINYVDRFLSLMSVVRSKLQLLGTTALFVAS 87
          +  + E +++      L+++ +DR+L      +  LQ +G   + + S
Sbjct: 38 MHLLCESFELDKSVFPLSVSILDRYLCKKQGTKKTLQKIGAACVLIGS 85
>d1bu2a1 a.74.1.1 (A:22-148) Viral cyclin {Herpesvirus saimiri [TaxId: 10381]} Length = 127 Back     information, alignment and structure
>d2cchb1 a.74.1.1 (B:181-308) Cyclin A {Cow (Bos taurus) [TaxId: 9913]} Length = 128 Back     information, alignment and structure
>d2cchb1 a.74.1.1 (B:181-308) Cyclin A {Cow (Bos taurus) [TaxId: 9913]} Length = 128 Back     information, alignment and structure
>d1f5qb1 a.74.1.1 (B:6-146) Viral cyclin {Murine herpesvirus 68 [TaxId: 33708]} Length = 141 Back     information, alignment and structure
>d1f5qb1 a.74.1.1 (B:6-146) Viral cyclin {Murine herpesvirus 68 [TaxId: 33708]} Length = 141 Back     information, alignment and structure
>d1g3nc1 a.74.1.1 (C:16-147) Viral cyclin {Kaposi's sarcoma-associated herpesvirus [TaxId: 37296]} Length = 132 Back     information, alignment and structure
>d1g3nc1 a.74.1.1 (C:16-147) Viral cyclin {Kaposi's sarcoma-associated herpesvirus [TaxId: 37296]} Length = 132 Back     information, alignment and structure
>d2i53a1 a.74.1.1 (A:14-157) Cyclin K {Human (Homo sapiens) [TaxId: 9606]} Length = 144 Back     information, alignment and structure
>d2i53a1 a.74.1.1 (A:14-157) Cyclin K {Human (Homo sapiens) [TaxId: 9606]} Length = 144 Back     information, alignment and structure
>d2ivxa1 a.74.1.1 (A:7-149) Cyclin-T2 {Human (Homo sapiens) [TaxId: 9606]} Length = 143 Back     information, alignment and structure
>d2ivxa1 a.74.1.1 (A:7-149) Cyclin-T2 {Human (Homo sapiens) [TaxId: 9606]} Length = 143 Back     information, alignment and structure
>d1w98b2 a.74.1.1 (B:88-227) G1/S-specific cyclin-E1 {Human (Homo sapiens) [TaxId: 9606]} Length = 140 Back     information, alignment and structure
>d1w98b2 a.74.1.1 (B:88-227) G1/S-specific cyclin-E1 {Human (Homo sapiens) [TaxId: 9606]} Length = 140 Back     information, alignment and structure
>d1jkwa1 a.74.1.1 (A:11-161) Cyclin H (mcs2) {Human (Homo sapiens) [TaxId: 9606]} Length = 151 Back     information, alignment and structure
>d1jkwa1 a.74.1.1 (A:11-161) Cyclin H (mcs2) {Human (Homo sapiens) [TaxId: 9606]} Length = 151 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query87
d1g3nc1132 Viral cyclin {Kaposi's sarcoma-associated herpesvi 99.88
d1bu2a1127 Viral cyclin {Herpesvirus saimiri [TaxId: 10381]} 99.86
d2cchb1128 Cyclin A {Cow (Bos taurus) [TaxId: 9913]} 99.85
d1f5qb1141 Viral cyclin {Murine herpesvirus 68 [TaxId: 33708] 99.84
d1w98b2140 G1/S-specific cyclin-E1 {Human (Homo sapiens) [Tax 99.83
d2i53a1144 Cyclin K {Human (Homo sapiens) [TaxId: 9606]} 99.5
d2ivxa1143 Cyclin-T2 {Human (Homo sapiens) [TaxId: 9606]} 99.38
d1jkwa1151 Cyclin H (mcs2) {Human (Homo sapiens) [TaxId: 9606 99.32
d1bu2a1127 Viral cyclin {Herpesvirus saimiri [TaxId: 10381]} 98.48
d1g3nc1132 Viral cyclin {Kaposi's sarcoma-associated herpesvi 98.35
d1f5qb1141 Viral cyclin {Murine herpesvirus 68 [TaxId: 33708] 98.31
d2cchb1128 Cyclin A {Cow (Bos taurus) [TaxId: 9913]} 98.18
d1w98b2140 G1/S-specific cyclin-E1 {Human (Homo sapiens) [Tax 98.05
d2i53a1144 Cyclin K {Human (Homo sapiens) [TaxId: 9606]} 97.25
d2ivxa1143 Cyclin-T2 {Human (Homo sapiens) [TaxId: 9606]} 96.9
d1jkwa1151 Cyclin H (mcs2) {Human (Homo sapiens) [TaxId: 9606 96.79
d1aisb295 Transcription factor IIB (TFIIB), core domain {Arc 96.41
d1vola2109 Transcription factor IIB (TFIIB), core domain {Hum 96.14
d1aisb198 Transcription factor IIB (TFIIB), core domain {Arc 96.12
d1vola195 Transcription factor IIB (TFIIB), core domain {Hum 95.85
d2ivxa2113 Cyclin-T2 {Human (Homo sapiens) [TaxId: 9606]} 91.85
d2i53a2110 Cyclin K {Human (Homo sapiens) [TaxId: 9606]} 89.51
>d1g3nc1 a.74.1.1 (C:16-147) Viral cyclin {Kaposi's sarcoma-associated herpesvirus [TaxId: 37296]} Back     information, alignment and structure
class: All alpha proteins
fold: Cyclin-like
superfamily: Cyclin-like
family: Cyclin
domain: Viral cyclin
species: Kaposi's sarcoma-associated herpesvirus [TaxId: 37296]

Probab=99.88  E-value=2.3e-23  Score=124.59  Aligned_cols=85  Identities=26%  Similarity=0.357  Sum_probs=77.1

Q ss_pred             cchhHHHHHHHHHHhcccccc--cccccChhhHHHHHHHHHHHHHhhhcchhHHHHHHHHHHHHhccCCCCccchHHHHH
Q psy14722          3 NETLHLAINYVDRFLSLMSVV--RSKLQLLGTTALFVASIIEVAEEYKMHNETLHLAINYVDRFLSLMSVVRSKLQLLGT   80 (87)
Q Consensus         3 ~e~~~l~~~~~d~~l~~~~~~--~~~~~~~~~r~~li~w~~ev~~~~~l~~~tl~lav~~~Dr~L~~~~~~~~~lqll~~   80 (87)
                      +|.+.-....+++|.+..++.  .|+.+++.+|..+++|+.+++..++++.+|+++|++++|||+++.+++++++|++|+
T Consensus         4 ~~i~~~l~~~E~~~~p~~~y~~~~q~~it~~~R~~lidWl~~v~~~~~l~~et~~lAv~llDrfls~~~v~~~~lqLia~   83 (132)
T d1g3nc1           4 DRIFYNILEIEPRFLTSDSVFGTFQQSLTSHMRKLLGTWMFSVCQEYNLEPNVVALALNLLDRLLLIKQVSKEHFQKTGS   83 (132)
T ss_dssp             HHHHHHHHHHGGGGCCCGGGHHHHTSSCCHHHHHHHHHHHHHHHHHTTCCHHHHHHHHHHHHHHTTTCCCCHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHCCChHHHHhcCccCCHHHHHHHHHHHHHHHHHhCCCcchHHHHHHHHHHHcCcccCcHHHHHHHHH
Confidence            456666778888998887653  367899999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhcC
Q psy14722         81 TALFVAS   87 (87)
Q Consensus        81 ~~l~iAs   87 (87)
                      +|++|||
T Consensus        84 tcl~iAs   90 (132)
T d1g3nc1          84 ACLLVAS   90 (132)
T ss_dssp             HHHHHHH
T ss_pred             HHHHHHH
Confidence            9999996
>d1bu2a1 a.74.1.1 (A:22-148) Viral cyclin {Herpesvirus saimiri [TaxId: 10381]} Back     information, alignment and structure
>d2cchb1 a.74.1.1 (B:181-308) Cyclin A {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1f5qb1 a.74.1.1 (B:6-146) Viral cyclin {Murine herpesvirus 68 [TaxId: 33708]} Back     information, alignment and structure
>d1w98b2 a.74.1.1 (B:88-227) G1/S-specific cyclin-E1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i53a1 a.74.1.1 (A:14-157) Cyclin K {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ivxa1 a.74.1.1 (A:7-149) Cyclin-T2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jkwa1 a.74.1.1 (A:11-161) Cyclin H (mcs2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bu2a1 a.74.1.1 (A:22-148) Viral cyclin {Herpesvirus saimiri [TaxId: 10381]} Back     information, alignment and structure
>d1g3nc1 a.74.1.1 (C:16-147) Viral cyclin {Kaposi's sarcoma-associated herpesvirus [TaxId: 37296]} Back     information, alignment and structure
>d1f5qb1 a.74.1.1 (B:6-146) Viral cyclin {Murine herpesvirus 68 [TaxId: 33708]} Back     information, alignment and structure
>d2cchb1 a.74.1.1 (B:181-308) Cyclin A {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1w98b2 a.74.1.1 (B:88-227) G1/S-specific cyclin-E1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i53a1 a.74.1.1 (A:14-157) Cyclin K {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ivxa1 a.74.1.1 (A:7-149) Cyclin-T2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jkwa1 a.74.1.1 (A:11-161) Cyclin H (mcs2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1aisb2 a.74.1.2 (B:1206-1300) Transcription factor IIB (TFIIB), core domain {Archaeon Pyrococcus woesei [TaxId: 2262]} Back     information, alignment and structure
>d1vola2 a.74.1.2 (A:208-316) Transcription factor IIB (TFIIB), core domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1aisb1 a.74.1.2 (B:1108-1205) Transcription factor IIB (TFIIB), core domain {Archaeon Pyrococcus woesei [TaxId: 2262]} Back     information, alignment and structure
>d1vola1 a.74.1.2 (A:113-207) Transcription factor IIB (TFIIB), core domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ivxa2 a.74.1.1 (A:150-262) Cyclin-T2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i53a2 a.74.1.1 (A:158-267) Cyclin K {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure