Psyllid ID: psy14904
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 233 | ||||||
| 237746986 | 228 | dithiobiotin synthetase [Oxalobacter for | 0.952 | 0.973 | 0.473 | 7e-51 | |
| 237749139 | 228 | dithiobiotin synthetase [Oxalobacter for | 0.879 | 0.899 | 0.473 | 2e-49 | |
| 445493866 | 260 | dethiobiotin synthase BioD [Janthinobact | 0.939 | 0.842 | 0.412 | 4e-49 | |
| 340789432 | 248 | dethiobiotin synthetase [Collimonas fung | 0.969 | 0.911 | 0.397 | 3e-48 | |
| 161523552 | 239 | dithiobiotin synthetase [Burkholderia mu | 0.952 | 0.928 | 0.378 | 9e-45 | |
| 421476633 | 239 | dethiobiotin synthase [Burkholderia mult | 0.952 | 0.928 | 0.378 | 1e-44 | |
| 427400061 | 282 | dethiobiotin synthase [Massilia timonae | 0.939 | 0.776 | 0.390 | 2e-44 | |
| 385207186 | 245 | dethiobiotin synthase [Burkholderia sp. | 0.974 | 0.926 | 0.382 | 2e-44 | |
| 91781581 | 245 | dithiobiotin synthetase [Burkholderia xe | 0.974 | 0.926 | 0.382 | 4e-44 | |
| 358637404 | 226 | dethiobiotin synthase [Azoarcus sp. KH32 | 0.948 | 0.977 | 0.4 | 6e-44 |
| >gi|237746986|ref|ZP_04577466.1| dithiobiotin synthetase [Oxalobacter formigenes HOxBLS] gi|229378337|gb|EEO28428.1| dithiobiotin synthetase [Oxalobacter formigenes HOxBLS] | Back alignment and taxonomy information |
|---|
Score = 206 bits (523), Expect = 7e-51, Method: Compositional matrix adjust.
Identities = 108/228 (47%), Positives = 147/228 (64%), Gaps = 6/228 (2%)
Query: 5 NFLHYFITGTNTNIGKTIISCALLSEFKKRGISCIGMKPIASGAYLNNKNKIWFNEDVNL 64
N L YFITGT+T IGKT +SCAL+ K+G+ MKP+A+GA + W NEDV+
Sbjct: 2 NPLSYFITGTDTEIGKTTVSCALIRALAKKGLHVAPMKPVAAGA--SEIGGQWHNEDVDA 59
Query: 65 LNKYSNSLYEFTKLINPYLFKYPISPYTSSNLENRIINTSHIINCYNYLSNLTDVIILEG 124
L SN+ + LI PYL K PI+P+ ++ L+ R I HI++CYN + D +I+EG
Sbjct: 60 LIAASNTELPLS-LIAPYLLKTPIAPHLAALLDQRPIELLHILSCYNEIRRQADAVIVEG 118
Query: 125 IGGFSVPFHDNENSADLAEKLGLPIILVIDLKIGCINNALLSLEAINSRGLKLIGWVANH 184
+GGF VPF D+ +SADLA +L LP+ILV+ LK+GCIN+ALL+ EAI +RGL L GW+AN
Sbjct: 119 VGGFCVPFTDSTSSADLAVQLNLPVILVVGLKLGCINHALLTAEAIRARGLNLAGWIANR 178
Query: 185 TQIVDTLFANENYIELTKYLNVTPLGRIPYLYNLNINLISHYLDFSSL 232
+ FA++N L +LN LG +PYL + + YLD S L
Sbjct: 179 IE-PHMPFADDNIRTLETWLNTPLLGTMPYLESF--SEADAYLDLSKL 223
|
Source: Oxalobacter formigenes HOxBLS Species: Oxalobacter formigenes Genus: Oxalobacter Family: Oxalobacteraceae Order: Burkholderiales Class: Betaproteobacteria Phylum: Proteobacteria Superkingdom: Bacteria |
| >gi|237749139|ref|ZP_04579619.1| dithiobiotin synthetase [Oxalobacter formigenes OXCC13] gi|229380501|gb|EEO30592.1| dithiobiotin synthetase [Oxalobacter formigenes OXCC13] | Back alignment and taxonomy information |
|---|
| >gi|445493866|ref|ZP_21460910.1| dethiobiotin synthase BioD [Janthinobacterium sp. HH01] gi|444790027|gb|ELX11574.1| dethiobiotin synthase BioD [Janthinobacterium sp. HH01] | Back alignment and taxonomy information |
|---|
| >gi|340789432|ref|YP_004754897.1| dethiobiotin synthetase [Collimonas fungivorans Ter331] gi|340554699|gb|AEK64074.1| Dethiobiotin synthetase [Collimonas fungivorans Ter331] | Back alignment and taxonomy information |
|---|
| >gi|161523552|ref|YP_001578564.1| dithiobiotin synthetase [Burkholderia multivorans ATCC 17616] gi|189351678|ref|YP_001947306.1| dithiobiotin synthetase [Burkholderia multivorans ATCC 17616] gi|221199843|ref|ZP_03572886.1| dethiobiotin synthase [Burkholderia multivorans CGD2M] gi|221207488|ref|ZP_03580497.1| dethiobiotin synthase [Burkholderia multivorans CGD2] gi|221211049|ref|ZP_03584028.1| dethiobiotin synthase [Burkholderia multivorans CGD1] gi|421471748|ref|ZP_15920008.1| dethiobiotin synthase [Burkholderia multivorans ATCC BAA-247] gi|226698961|sp|A9AE45.1|BIOD_BURM1 RecName: Full=ATP-dependent dethiobiotin synthetase BioD; AltName: Full=DTB synthetase; Short=DTBS; AltName: Full=Dethiobiotin synthase gi|160340981|gb|ABX14067.1| dethiobiotin synthase [Burkholderia multivorans ATCC 17616] gi|189335700|dbj|BAG44770.1| dethiobiotin synthetase [Burkholderia multivorans ATCC 17616] gi|221168410|gb|EEE00878.1| dethiobiotin synthase [Burkholderia multivorans CGD1] gi|221172691|gb|EEE05129.1| dethiobiotin synthase [Burkholderia multivorans CGD2] gi|221180082|gb|EEE12486.1| dethiobiotin synthase [Burkholderia multivorans CGD2M] gi|400224738|gb|EJO54948.1| dethiobiotin synthase [Burkholderia multivorans ATCC BAA-247] | Back alignment and taxonomy information |
|---|
| >gi|421476633|ref|ZP_15924508.1| dethiobiotin synthase [Burkholderia multivorans CF2] gi|400227997|gb|EJO57959.1| dethiobiotin synthase [Burkholderia multivorans CF2] | Back alignment and taxonomy information |
|---|
| >gi|427400061|ref|ZP_18891299.1| dethiobiotin synthase [Massilia timonae CCUG 45783] gi|425720801|gb|EKU83716.1| dethiobiotin synthase [Massilia timonae CCUG 45783] | Back alignment and taxonomy information |
|---|
| >gi|385207186|ref|ZP_10034054.1| dethiobiotin synthase [Burkholderia sp. Ch1-1] gi|385179524|gb|EIF28800.1| dethiobiotin synthase [Burkholderia sp. Ch1-1] | Back alignment and taxonomy information |
|---|
| >gi|91781581|ref|YP_556787.1| dithiobiotin synthetase [Burkholderia xenovorans LB400] gi|91685535|gb|ABE28735.1| Dethiobiotin synthase [Burkholderia xenovorans LB400] | Back alignment and taxonomy information |
|---|
| >gi|358637404|dbj|BAL24701.1| dethiobiotin synthase [Azoarcus sp. KH32C] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 233 | ||||||
| TIGR_CMR|CBU_1003 | 242 | CBU_1003 "dethiobiotin synthet | 0.918 | 0.884 | 0.343 | 1.2e-28 | |
| UNIPROTKB|P13000 | 225 | bioD "dethiobiotin synthetase | 0.871 | 0.902 | 0.338 | 2.3e-23 | |
| UNIPROTKB|Q9KSZ1 | 231 | bioD "ATP-dependent dethiobiot | 0.785 | 0.792 | 0.319 | 7e-22 | |
| TIGR_CMR|VC_1115 | 231 | VC_1115 "dethiobiotin syntheta | 0.785 | 0.792 | 0.319 | 7e-22 | |
| TIGR_CMR|CPS_2597 | 263 | CPS_2597 "dethiobiotin synthas | 0.570 | 0.505 | 0.310 | 3.4e-20 | |
| UNIPROTKB|P69954 | 222 | bioD "ATP-dependent dethiobiot | 0.862 | 0.905 | 0.311 | 4.4e-20 | |
| TIGR_CMR|SO_2737 | 231 | SO_2737 "dethiobiotin synthase | 0.935 | 0.943 | 0.296 | 4.4e-20 | |
| UNIPROTKB|Q5NGB5 | 225 | bioD "ATP-dependent dethiobiot | 0.815 | 0.844 | 0.297 | 6.7e-17 | |
| UNIPROTKB|P0A6E9 | 231 | ynfK [Escherichia coli K-12 (t | 0.922 | 0.930 | 0.284 | 3.3e-15 | |
| TIGR_CMR|GSU_1583 | 240 | GSU_1583 "dethiobiotin synthas | 0.755 | 0.733 | 0.293 | 2.4e-12 |
| TIGR_CMR|CBU_1003 CBU_1003 "dethiobiotin synthetase" [Coxiella burnetii RSA 493 (taxid:227377)] | Back alignment and assigned GO terms |
|---|
Score = 319 (117.4 bits), Expect = 1.2e-28, P = 1.2e-28
Identities = 78/227 (34%), Positives = 126/227 (55%)
Query: 7 LHYFXXXXXXXXXXXXXSCALLSEFKKRGISCIGMKPIASGAYLNNKNKIWFNEDVNLLN 66
+ +F S LL +F +G S G+KPIASG N NK+ N+D L
Sbjct: 1 MKFFITGTDTGVGKTYVSTLLLHQFNNKGFSTFGIKPIASGCRKIN-NKL-HNDDALALQ 58
Query: 67 KYSN--SLYEFTKLINPYLFKYPISPYTSSNLENRIINTSHIINCYNYLSNL-TDVIILE 123
K ++ + YE +NP + PI+P+ ++ L N++++ + + N + NL DV I+E
Sbjct: 59 KVASIKTTYEH---VNPIALEPPIAPHIAAKLNNQVLSKNDLAKTINQIFNLPADVFIVE 115
Query: 124 GIGGFSVPFHDNENSADLAEKLGLPIILVIDLKIGCINNALLSLEAINSRGLKLIGWVAN 183
G GG+ VP ++ E +DL + L +P++LVI +K+GC+N+A L+ +A+ + L+GWVAN
Sbjct: 116 GAGGWFVPLNEKEFLSDLVKLLKIPVVLVIGIKLGCLNHAFLTAKAMLREKIPLVGWVAN 175
Query: 184 HTQIVDTLFANENYIELTKYLNVTPLGRIPY---LYNLNIN-LISHY 226
+ D L EN L K + LG IPY + +L+I L+ H+
Sbjct: 176 CIE-PDVLAMAENIQTLKKGIKAPCLGVIPYDGTVEDLSIQPLLDHF 221
|
|
| UNIPROTKB|P13000 bioD "dethiobiotin synthetase monomer" [Escherichia coli K-12 (taxid:83333)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9KSZ1 bioD "ATP-dependent dethiobiotin synthetase BioD" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|VC_1115 VC_1115 "dethiobiotin synthetase" [Vibrio cholerae O1 biovar El Tor (taxid:686)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CPS_2597 CPS_2597 "dethiobiotin synthase" [Colwellia psychrerythraea 34H (taxid:167879)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P69954 bioD "ATP-dependent dethiobiotin synthetase BioD" [Yersinia pseudotuberculosis IP 32953 (taxid:273123)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SO_2737 SO_2737 "dethiobiotin synthase" [Shewanella oneidensis MR-1 (taxid:211586)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5NGB5 bioD "ATP-dependent dethiobiotin synthetase BioD" [Francisella tularensis subsp. tularensis SCHU S4 (taxid:177416)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P0A6E9 ynfK [Escherichia coli K-12 (taxid:83333)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|GSU_1583 GSU_1583 "dethiobiotin synthase" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 233 | |||
| PRK00090 | 222 | PRK00090, bioD, dithiobiotin synthetase; Reviewed | 2e-71 | |
| COG0132 | 223 | COG0132, BioD, Dethiobiotin synthetase [Coenzyme m | 8e-62 | |
| TIGR00347 | 166 | TIGR00347, bioD, dethiobiotin synthase | 9e-43 | |
| PRK12374 | 231 | PRK12374, PRK12374, putative dithiobiotin syntheta | 2e-35 | |
| pfam13500 | 197 | pfam13500, AAA_26, AAA domain | 2e-32 | |
| cd03109 | 134 | cd03109, DTBS, Dethiobiotin synthetase (DTBS) is t | 3e-13 | |
| TIGR00379 | 449 | TIGR00379, cobB, cobyrinic acid a,c-diamide syntha | 1e-06 | |
| COG1797 | 451 | COG1797, CobB, Cobyrinic acid a,c-diamide synthase | 3e-06 | |
| PLN02974 | 817 | PLN02974, PLN02974, adenosylmethionine-8-amino-7-o | 9e-06 | |
| cd03109 | 134 | cd03109, DTBS, Dethiobiotin synthetase (DTBS) is t | 5e-05 | |
| pfam01656 | 217 | pfam01656, CbiA, CobQ/CobB/MinD/ParA nucleotide bi | 1e-04 | |
| PRK13896 | 433 | PRK13896, PRK13896, cobyrinic acid a,c-diamide syn | 0.001 | |
| PRK01077 | 451 | PRK01077, PRK01077, cobyrinic acid a,c-diamide syn | 0.002 |
| >gnl|CDD|234625 PRK00090, bioD, dithiobiotin synthetase; Reviewed | Back alignment and domain information |
|---|
Score = 216 bits (554), Expect = 2e-71
Identities = 86/226 (38%), Positives = 125/226 (55%), Gaps = 10/226 (4%)
Query: 9 YFITGTNTNIGKTIISCALLSEFKKRGISCIGMKPIASGAYLNNKNKIWFNEDVNLLNKY 68
F+TGT+T++GKT+++ AL ++ G S G KP+ SG + N D L +
Sbjct: 2 LFVTGTDTDVGKTVVTAALAQALREAGYSVAGYKPVQSGCE-----ETDRNGDALALQRL 56
Query: 69 SN--SLYEFTKLINPYLFKYPISPYTSSNLENRIINTSHIINCYNYLSNLTDVIILEGIG 126
S YE +NPY F+ P+SP+ ++ LE I+ I L+ D++++EG G
Sbjct: 57 SGLPLDYE---DVNPYRFEEPLSPHLAAALEGVAIDLEKISAALRRLAQQYDLVLVEGAG 113
Query: 127 GFSVPFHDNENSADLAEKLGLPIILVIDLKIGCINNALLSLEAINSRGLKLIGWVANHTQ 186
G VP ++ ADLA++L LP+ILV+ +K+GCIN+ LL+LEAI +RGL L GWVAN
Sbjct: 114 GLLVPLTEDLTLADLAKQLQLPVILVVGVKLGCINHTLLTLEAIRARGLPLAGWVANGIP 173
Query: 187 IVDTLFANENYIELTKYLNVTPLGRIPYLYNLNINLISHYLDFSSL 232
L EN L + L LG +PYL + + YLD L
Sbjct: 174 PEPGLRHAENLATLERLLPAPLLGELPYLAEAELAAAAEYLDLDLL 219
|
Length = 222 |
| >gnl|CDD|223210 COG0132, BioD, Dethiobiotin synthetase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|129447 TIGR00347, bioD, dethiobiotin synthase | Back alignment and domain information |
|---|
| >gnl|CDD|237083 PRK12374, PRK12374, putative dithiobiotin synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222178 pfam13500, AAA_26, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|239383 cd03109, DTBS, Dethiobiotin synthetase (DTBS) is the penultimate enzyme in the biotin biosynthesis pathway in Escherichia coli and other microorganisms | Back alignment and domain information |
|---|
| >gnl|CDD|232946 TIGR00379, cobB, cobyrinic acid a,c-diamide synthase | Back alignment and domain information |
|---|
| >gnl|CDD|224710 COG1797, CobB, Cobyrinic acid a,c-diamide synthase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|215526 PLN02974, PLN02974, adenosylmethionine-8-amino-7-oxononanoate transaminase | Back alignment and domain information |
|---|
| >gnl|CDD|239383 cd03109, DTBS, Dethiobiotin synthetase (DTBS) is the penultimate enzyme in the biotin biosynthesis pathway in Escherichia coli and other microorganisms | Back alignment and domain information |
|---|
| >gnl|CDD|216631 pfam01656, CbiA, CobQ/CobB/MinD/ParA nucleotide binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|184379 PRK13896, PRK13896, cobyrinic acid a,c-diamide synthase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234896 PRK01077, PRK01077, cobyrinic acid a,c-diamide synthase; Validated | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 233 | |||
| COG0132 | 223 | BioD Dethiobiotin synthetase [Coenzyme metabolism] | 100.0 | |
| PRK12374 | 231 | putative dithiobiotin synthetase; Provisional | 100.0 | |
| PF13500 | 199 | AAA_26: AAA domain; PDB: 3OF5_A 2IOJ_A 4A0G_B 4A0R | 100.0 | |
| PRK00090 | 222 | bioD dithiobiotin synthetase; Reviewed | 100.0 | |
| TIGR00347 | 166 | bioD dethiobiotin synthase. Dethiobiotin synthase | 99.96 | |
| PRK00784 | 488 | cobyric acid synthase; Provisional | 99.96 | |
| PLN02974 | 817 | adenosylmethionine-8-amino-7-oxononanoate transami | 99.95 | |
| TIGR00313 | 475 | cobQ cobyric acid synthase CobQ. | 99.94 | |
| PRK01077 | 451 | cobyrinic acid a,c-diamide synthase; Validated | 99.93 | |
| TIGR00379 | 449 | cobB cobyrinic acid a,c-diamide synthase. This mod | 99.92 | |
| PRK11670 | 369 | antiporter inner membrane protein; Provisional | 99.92 | |
| COG1797 | 451 | CobB Cobyrinic acid a,c-diamide synthase [Coenzyme | 99.92 | |
| COG2894 | 272 | MinD Septum formation inhibitor-activating ATPase | 99.92 | |
| TIGR01969 | 251 | minD_arch cell division ATPase MinD, archaeal. Thi | 99.91 | |
| PRK05632 | 684 | phosphate acetyltransferase; Reviewed | 99.91 | |
| cd02037 | 169 | MRP-like MRP (Multiple Resistance and pH adaptatio | 99.91 | |
| CHL00175 | 281 | minD septum-site determining protein; Validated | 99.91 | |
| cd03109 | 134 | DTBS Dethiobiotin synthetase (DTBS) is the penulti | 99.9 | |
| PRK13896 | 433 | cobyrinic acid a,c-diamide synthase; Provisional | 99.9 | |
| PRK06278 | 476 | cobyrinic acid a,c-diamide synthase; Validated | 99.89 | |
| cd02117 | 212 | NifH_like This family contains the NifH (iron prot | 99.89 | |
| TIGR01968 | 261 | minD_bact septum site-determining protein MinD. Th | 99.88 | |
| cd02036 | 179 | MinD Bacterial cell division requires the formatio | 99.88 | |
| PRK13232 | 273 | nifH nitrogenase reductase; Reviewed | 99.88 | |
| PRK13235 | 274 | nifH nitrogenase reductase; Reviewed | 99.87 | |
| TIGR01007 | 204 | eps_fam capsular exopolysaccharide family. This mo | 99.87 | |
| COG0489 | 265 | Mrp ATPases involved in chromosome partitioning [C | 99.87 | |
| PRK10818 | 270 | cell division inhibitor MinD; Provisional | 99.86 | |
| PRK13869 | 405 | plasmid-partitioning protein RepA; Provisional | 99.86 | |
| COG0455 | 262 | flhG Antiactivator of flagellar biosynthesis FleN, | 99.86 | |
| PRK13233 | 275 | nifH nitrogenase reductase; Reviewed | 99.86 | |
| TIGR03371 | 246 | cellulose_yhjQ cellulose synthase operon protein Y | 99.86 | |
| cd03110 | 179 | Fer4_NifH_child This protein family's function is | 99.86 | |
| PHA02518 | 211 | ParA-like protein; Provisional | 99.86 | |
| KOG3022|consensus | 300 | 99.86 | ||
| PRK13185 | 270 | chlL protochlorophyllide reductase iron-sulfur ATP | 99.86 | |
| cd02040 | 270 | NifH NifH gene encodes component II (iron protein) | 99.85 | |
| TIGR03029 | 274 | EpsG chain length determinant protein tyrosine kin | 99.85 | |
| TIGR03453 | 387 | partition_RepA plasmid partitioning protein RepA. | 99.84 | |
| cd02032 | 267 | Bchl_like This family of proteins contains bchL an | 99.84 | |
| PRK13849 | 231 | putative crown gall tumor protein VirC1; Provision | 99.84 | |
| PRK13234 | 295 | nifH nitrogenase reductase; Reviewed | 99.84 | |
| PRK13236 | 296 | nitrogenase reductase; Reviewed | 99.84 | |
| TIGR02016 | 296 | BchX chlorophyllide reductase iron protein subunit | 99.83 | |
| TIGR01281 | 268 | DPOR_bchL light-independent protochlorophyllide re | 99.83 | |
| CHL00072 | 290 | chlL photochlorophyllide reductase subunit L | 99.83 | |
| PF01656 | 195 | CbiA: CobQ/CobB/MinD/ParA nucleotide binding domai | 99.83 | |
| TIGR01287 | 275 | nifH nitrogenase iron protein. This model describe | 99.83 | |
| PF06564 | 243 | YhjQ: YhjQ protein; InterPro: IPR017746 The YhjQ p | 99.83 | |
| PRK10037 | 250 | cell division protein; Provisional | 99.83 | |
| PRK13231 | 264 | nitrogenase reductase-like protein; Reviewed | 99.83 | |
| TIGR03018 | 207 | pepcterm_TyrKin exopolysaccharide/PEPCTERM locus t | 99.82 | |
| PHA02519 | 387 | plasmid partition protein SopA; Reviewed | 99.82 | |
| COG1192 | 259 | Soj ATPases involved in chromosome partitioning [C | 99.82 | |
| TIGR03815 | 322 | CpaE_hom_Actino helicase/secretion neighborhood Cp | 99.82 | |
| PRK13705 | 388 | plasmid-partitioning protein SopA; Provisional | 99.81 | |
| cd02033 | 329 | BchX Chlorophyllide reductase converts chlorophyll | 99.81 | |
| PRK13230 | 279 | nitrogenase reductase-like protein; Reviewed | 99.8 | |
| PRK09841 | 726 | cryptic autophosphorylating protein tyrosine kinas | 99.8 | |
| COG1149 | 284 | MinD superfamily P-loop ATPase containing an inser | 99.79 | |
| PRK11519 | 719 | tyrosine kinase; Provisional | 99.78 | |
| TIGR01005 | 754 | eps_transp_fam exopolysaccharide transport protein | 99.77 | |
| COG1492 | 486 | CobQ Cobyric acid synthase [Coenzyme metabolism] | 99.75 | |
| cd02038 | 139 | FleN-like FleN is a member of the Fer4_NifH superf | 99.72 | |
| PF07015 | 231 | VirC1: VirC1 protein; InterPro: IPR009744 This fam | 99.7 | |
| cd00550 | 254 | ArsA_ATPase Oxyanion-translocating ATPase (ArsA). | 99.7 | |
| COG3640 | 255 | CooC CO dehydrogenase maturation factor [Cell divi | 99.68 | |
| cd02035 | 217 | ArsA ArsA ATPase functionas as an efflux pump loca | 99.64 | |
| COG0857 | 354 | Pta BioD-like N-terminal domain of phosphotransace | 99.63 | |
| cd03111 | 106 | CpaE_like This protein family consists of proteins | 99.62 | |
| PF00142 | 273 | Fer4_NifH: 4Fe-4S iron sulfur cluster binding prot | 99.61 | |
| PF09140 | 261 | MipZ: ATPase MipZ; InterPro: IPR015223 Cell divisi | 99.61 | |
| COG1348 | 278 | NifH Nitrogenase subunit NifH (ATPase) [Inorganic | 99.61 | |
| cd02042 | 104 | ParA ParA and ParB of Caulobacter crescentus belon | 99.55 | |
| TIGR00064 | 272 | ftsY signal recognition particle-docking protein F | 99.5 | |
| PF02374 | 305 | ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_ | 99.45 | |
| PRK10867 | 433 | signal recognition particle protein; Provisional | 99.44 | |
| TIGR00959 | 428 | ffh signal recognition particle protein. This mode | 99.43 | |
| TIGR01425 | 429 | SRP54_euk signal recognition particle protein SRP5 | 99.41 | |
| PRK10416 | 318 | signal recognition particle-docking protein FtsY; | 99.4 | |
| PRK11889 | 436 | flhF flagellar biosynthesis regulator FlhF; Provis | 99.37 | |
| cd03115 | 173 | SRP The signal recognition particle (SRP) mediates | 99.36 | |
| PRK12726 | 407 | flagellar biosynthesis regulator FlhF; Provisional | 99.34 | |
| COG0541 | 451 | Ffh Signal recognition particle GTPase [Intracellu | 99.32 | |
| PF13614 | 157 | AAA_31: AAA domain; PDB: 2VED_B 2PH1_A 3EA0_B 3FKQ | 99.32 | |
| PRK00771 | 437 | signal recognition particle protein Srp54; Provisi | 99.31 | |
| PF00448 | 196 | SRP54: SRP54-type protein, GTPase domain; InterPro | 99.3 | |
| PRK12723 | 388 | flagellar biosynthesis regulator FlhF; Provisional | 99.24 | |
| PRK05703 | 424 | flhF flagellar biosynthesis regulator FlhF; Valida | 99.22 | |
| PRK12724 | 432 | flagellar biosynthesis regulator FlhF; Provisional | 99.22 | |
| PRK12727 | 559 | flagellar biosynthesis regulator FlhF; Provisional | 99.21 | |
| COG0003 | 322 | ArsA Predicted ATPase involved in chromosome parti | 99.17 | |
| PRK13886 | 241 | conjugal transfer protein TraL; Provisional | 99.17 | |
| COG0552 | 340 | FtsY Signal recognition particle GTPase [Intracell | 99.15 | |
| PRK14974 | 336 | cell division protein FtsY; Provisional | 99.14 | |
| COG1419 | 407 | FlhF Flagellar GTP-binding protein [Cell motility | 99.13 | |
| cd01983 | 99 | Fer4_NifH The Fer4_NifH superfamily contains a var | 99.11 | |
| cd03114 | 148 | ArgK-like The function of this protein family is u | 99.06 | |
| PRK06731 | 270 | flhF flagellar biosynthesis regulator FlhF; Valida | 99.06 | |
| COG4963 | 366 | CpaE Flp pilus assembly protein, ATPase CpaE [Intr | 99.03 | |
| PRK14723 | 767 | flhF flagellar biosynthesis regulator FlhF; Provis | 99.01 | |
| PRK13768 | 253 | GTPase; Provisional | 99.0 | |
| PRK14493 | 274 | putative bifunctional molybdopterin-guanine dinucl | 98.97 | |
| KOG0780|consensus | 483 | 98.91 | ||
| PRK14722 | 374 | flhF flagellar biosynthesis regulator FlhF; Provis | 98.91 | |
| TIGR03499 | 282 | FlhF flagellar biosynthetic protein FlhF. | 98.85 | |
| PRK14494 | 229 | putative molybdopterin-guanine dinucleotide biosyn | 98.82 | |
| cd02034 | 116 | CooC The accessory protein CooC, which contains a | 98.82 | |
| COG1763 | 161 | MobB Molybdopterin-guanine dinucleotide biosynthes | 98.81 | |
| COG1703 | 323 | ArgK Putative periplasmic protein kinase ArgK and | 98.79 | |
| PRK06995 | 484 | flhF flagellar biosynthesis regulator FlhF; Valida | 98.79 | |
| PRK14495 | 452 | putative molybdopterin-guanine dinucleotide biosyn | 98.72 | |
| TIGR00750 | 300 | lao LAO/AO transport system ATPase. Mutations have | 98.7 | |
| PRK09435 | 332 | membrane ATPase/protein kinase; Provisional | 98.69 | |
| TIGR00176 | 155 | mobB molybdopterin-guanine dinucleotide biosynthes | 98.6 | |
| PRK10751 | 173 | molybdopterin-guanine dinucleotide biosynthesis pr | 98.6 | |
| TIGR00345 | 284 | arsA arsenite-activated ATPase (arsA). The N-termi | 98.55 | |
| KOG0781|consensus | 587 | 98.54 | ||
| PF07755 | 301 | DUF1611: Protein of unknown function (DUF1611); In | 98.51 | |
| cd03116 | 159 | MobB Molybdenum is an essential trace element in t | 98.48 | |
| PF10609 | 81 | ParA: ParA/MinD ATPase like; InterPro: IPR019591 T | 98.47 | |
| PF03308 | 266 | ArgK: ArgK protein; InterPro: IPR005129 Bacterial | 98.41 | |
| PRK14491 | 597 | putative bifunctional molybdopterin-guanine dinucl | 98.39 | |
| COG3367 | 339 | Uncharacterized conserved protein [Function unknow | 98.38 | |
| PF03205 | 140 | MobB: Molybdopterin guanine dinucleotide synthesis | 98.38 | |
| PRK14489 | 366 | putative bifunctional molybdopterin-guanine dinucl | 98.37 | |
| PF03029 | 238 | ATP_bind_1: Conserved hypothetical ATP binding pro | 98.28 | |
| PRK14721 | 420 | flhF flagellar biosynthesis regulator FlhF; Provis | 98.23 | |
| KOG1532|consensus | 366 | 98.2 | ||
| cd03113 | 255 | CTGs CTP synthetase (CTPs) is a two-domain protein | 98.02 | |
| cd04170 | 268 | EF-G_bact Elongation factor G (EF-G) subfamily. Tr | 98.01 | |
| COG0378 | 202 | HypB Ni2+-binding GTPase involved in regulation of | 97.99 | |
| COG1341 | 398 | Predicted GTPase or GTP-binding protein [General f | 97.89 | |
| COG1066 | 456 | Sms Predicted ATP-dependent serine protease [Postt | 97.88 | |
| PRK13505 | 557 | formate--tetrahydrofolate ligase; Provisional | 97.82 | |
| PRK05973 | 237 | replicative DNA helicase; Provisional | 97.81 | |
| COG1618 | 179 | Predicted nucleotide kinase [Nucleotide transport | 97.77 | |
| KOG1533|consensus | 290 | 97.74 | ||
| cd00477 | 524 | FTHFS Formyltetrahydrofolate synthetase (FTHFS) ca | 97.73 | |
| cd01886 | 270 | EF-G Elongation factor G (EF-G) subfamily. Translo | 97.65 | |
| KOG2825|consensus | 323 | 97.64 | ||
| cd04168 | 237 | TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T | 97.6 | |
| PF01583 | 156 | APS_kinase: Adenylylsulphate kinase; InterPro: IPR | 97.59 | |
| COG0529 | 197 | CysC Adenylylsulfate kinase and related kinases [I | 97.58 | |
| PRK04296 | 190 | thymidine kinase; Provisional | 97.54 | |
| PF02492 | 178 | cobW: CobW/HypB/UreG, nucleotide-binding domain; I | 97.53 | |
| cd04169 | 267 | RF3 RF3 subfamily. Peptide chain release factor 3 | 97.53 | |
| TIGR02012 | 321 | tigrfam_recA protein RecA. This model describes or | 97.52 | |
| cd00983 | 325 | recA RecA is a bacterial enzyme which has roles in | 97.5 | |
| PF13207 | 121 | AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 | 97.48 | |
| cd01121 | 372 | Sms Sms (bacterial radA) DNA repair protein. This | 97.44 | |
| PRK00889 | 175 | adenylylsulfate kinase; Provisional | 97.44 | |
| PF01695 | 178 | IstB_IS21: IstB-like ATP binding protein; InterPro | 97.42 | |
| COG2403 | 449 | Predicted GTPase [General function prediction only | 97.41 | |
| PRK11823 | 446 | DNA repair protein RadA; Provisional | 97.4 | |
| PF00009 | 188 | GTP_EFTU: Elongation factor Tu GTP binding domain; | 97.4 | |
| TIGR00073 | 207 | hypB hydrogenase accessory protein HypB. HypB is i | 97.4 | |
| PRK14490 | 369 | putative bifunctional molybdopterin-guanine dinucl | 97.38 | |
| TIGR00416 | 454 | sms DNA repair protein RadA. The gene protuct code | 97.35 | |
| PRK07667 | 193 | uridine kinase; Provisional | 97.35 | |
| PRK00741 | 526 | prfC peptide chain release factor 3; Provisional | 97.34 | |
| PF13245 | 76 | AAA_19: Part of AAA domain | 97.34 | |
| PRK05480 | 209 | uridine/cytidine kinase; Provisional | 97.3 | |
| PRK15453 | 290 | phosphoribulokinase; Provisional | 97.29 | |
| PHA00729 | 226 | NTP-binding motif containing protein | 97.29 | |
| cd01394 | 218 | radB RadB. The archaeal protein radB shares simila | 97.29 | |
| cd02019 | 69 | NK Nucleoside/nucleotide kinase (NK) is a protein | 97.27 | |
| cd01393 | 226 | recA_like RecA is a bacterial enzyme which has rol | 97.25 | |
| PRK09354 | 349 | recA recombinase A; Provisional | 97.24 | |
| PRK13506 | 578 | formate--tetrahydrofolate ligase; Provisional | 97.24 | |
| cd00561 | 159 | CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B | 97.23 | |
| cd01124 | 187 | KaiC KaiC is a circadian clock protein primarily f | 97.23 | |
| PRK00007 | 693 | elongation factor G; Reviewed | 97.19 | |
| TIGR02236 | 310 | recomb_radA DNA repair and recombination protein R | 97.19 | |
| PRK10463 | 290 | hydrogenase nickel incorporation protein HypB; Pro | 97.19 | |
| cd02028 | 179 | UMPK_like Uridine monophosphate kinase_like (UMPK_ | 97.18 | |
| cd01884 | 195 | EF_Tu EF-Tu subfamily. This subfamily includes ort | 97.18 | |
| cd00881 | 189 | GTP_translation_factor GTP translation factor fami | 97.17 | |
| PRK09361 | 225 | radB DNA repair and recombination protein RadB; Pr | 97.16 | |
| TIGR02237 | 209 | recomb_radB DNA repair and recombination protein R | 97.16 | |
| COG1484 | 254 | DnaC DNA replication protein [DNA replication, rec | 97.16 | |
| TIGR00484 | 689 | EF-G translation elongation factor EF-G. After pep | 97.13 | |
| COG4088 | 261 | Predicted nucleotide kinase [Nucleotide transport | 97.12 | |
| PRK08233 | 182 | hypothetical protein; Provisional | 97.09 | |
| PRK06526 | 254 | transposase; Provisional | 97.08 | |
| PRK06696 | 223 | uridine kinase; Validated | 97.08 | |
| PRK07952 | 244 | DNA replication protein DnaC; Validated | 97.07 | |
| PRK12739 | 691 | elongation factor G; Reviewed | 97.04 | |
| COG1936 | 180 | Predicted nucleotide kinase (related to CMP and AM | 97.03 | |
| cd02029 | 277 | PRK_like Phosphoribulokinase-like (PRK-like) is a | 97.03 | |
| PF01935 | 229 | DUF87: Domain of unknown function DUF87; InterPro: | 97.03 | |
| TIGR03878 | 259 | thermo_KaiC_2 KaiC domain protein, AF_0795 family. | 97.01 | |
| PF00485 | 194 | PRK: Phosphoribulokinase / Uridine kinase family; | 96.99 | |
| cd02027 | 149 | APSK Adenosine 5'-phosphosulfate kinase (APSK) cat | 96.98 | |
| cd01120 | 165 | RecA-like_NTPases RecA-like NTPases. This family i | 96.98 | |
| PF00154 | 322 | RecA: recA bacterial DNA recombination protein; In | 96.97 | |
| PRK09183 | 259 | transposase/IS protein; Provisional | 96.97 | |
| TIGR00682 | 311 | lpxK tetraacyldisaccharide 4'-kinase. Also called | 96.97 | |
| PRK05541 | 176 | adenylylsulfate kinase; Provisional | 96.96 | |
| TIGR00503 | 527 | prfC peptide chain release factor 3. This translat | 96.95 | |
| PRK03846 | 198 | adenylylsulfate kinase; Provisional | 96.93 | |
| PRK00652 | 325 | lpxK tetraacyldisaccharide 4'-kinase; Reviewed | 96.93 | |
| PF06418 | 276 | CTP_synth_N: CTP synthase N-terminus; InterPro: IP | 96.92 | |
| PRK12377 | 248 | putative replication protein; Provisional | 96.9 | |
| TIGR03574 | 249 | selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem | 96.89 | |
| TIGR02238 | 313 | recomb_DMC1 meiotic recombinase Dmc1. This model d | 96.88 | |
| PRK08118 | 167 | topology modulation protein; Reviewed | 96.87 | |
| PLN03187 | 344 | meiotic recombination protein DMC1 homolog; Provis | 96.87 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 96.85 | |
| TIGR00041 | 195 | DTMP_kinase thymidylate kinase. Function: phosphor | 96.85 | |
| PRK08939 | 306 | primosomal protein DnaI; Reviewed | 96.85 | |
| cd01672 | 200 | TMPK Thymidine monophosphate kinase (TMPK), also k | 96.84 | |
| PRK08181 | 269 | transposase; Validated | 96.81 | |
| TIGR00235 | 207 | udk uridine kinase. Model contains a number of lon | 96.81 | |
| cd00544 | 169 | CobU Adenosylcobinamide kinase / adenosylcobinamid | 96.81 | |
| PRK04040 | 188 | adenylate kinase; Provisional | 96.79 | |
| cd00984 | 242 | DnaB_C DnaB helicase C terminal domain. The hexame | 96.79 | |
| PF08433 | 270 | KTI12: Chromatin associated protein KTI12 ; InterP | 96.79 | |
| PRK06835 | 329 | DNA replication protein DnaC; Validated | 96.77 | |
| PF02606 | 326 | LpxK: Tetraacyldisaccharide-1-P 4'-kinase; InterPr | 96.73 | |
| KOG0635|consensus | 207 | 96.72 | ||
| PF12846 | 304 | AAA_10: AAA-like domain | 96.69 | |
| PLN03127 | 447 | Elongation factor Tu; Provisional | 96.69 | |
| PRK01906 | 338 | tetraacyldisaccharide 4'-kinase; Provisional | 96.69 | |
| PF03266 | 168 | NTPase_1: NTPase; InterPro: IPR004948 This entry r | 96.68 | |
| PRK08533 | 230 | flagellar accessory protein FlaH; Reviewed | 96.68 | |
| cd03112 | 158 | CobW_like The function of this protein family is u | 96.68 | |
| TIGR00455 | 184 | apsK adenylylsulfate kinase (apsK). Important resi | 96.67 | |
| PRK06762 | 166 | hypothetical protein; Provisional | 96.67 | |
| PRK10218 | 607 | GTP-binding protein; Provisional | 96.67 | |
| TIGR01394 | 594 | TypA_BipA GTP-binding protein TypA/BipA. This bact | 96.66 | |
| COG0468 | 279 | RecA RecA/RadA recombinase [DNA replication, recom | 96.65 | |
| PRK08727 | 233 | hypothetical protein; Validated | 96.64 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 96.64 | |
| COG2109 | 198 | BtuR ATP:corrinoid adenosyltransferase [Coenzyme m | 96.62 | |
| PHA02542 | 473 | 41 41 helicase; Provisional | 96.61 | |
| PRK13351 | 687 | elongation factor G; Reviewed | 96.61 | |
| cd01122 | 271 | GP4d_helicase GP4d_helicase is a homohexameric 5'- | 96.61 | |
| PRK14527 | 191 | adenylate kinase; Provisional | 96.61 | |
| PRK05433 | 600 | GTP-binding protein LepA; Provisional | 96.58 | |
| PTZ00035 | 337 | Rad51 protein; Provisional | 96.57 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 96.57 | |
| PRK06921 | 266 | hypothetical protein; Provisional | 96.56 | |
| PRK06851 | 367 | hypothetical protein; Provisional | 96.56 | |
| cd02025 | 220 | PanK Pantothenate kinase (PanK) catalyzes the phos | 96.55 | |
| PRK06067 | 234 | flagellar accessory protein FlaH; Validated | 96.55 | |
| PRK04301 | 317 | radA DNA repair and recombination protein RadA; Va | 96.55 | |
| PLN02924 | 220 | thymidylate kinase | 96.54 | |
| KOG3347|consensus | 176 | 96.52 | ||
| PRK07933 | 213 | thymidylate kinase; Validated | 96.52 | |
| PRK00049 | 396 | elongation factor Tu; Reviewed | 96.52 | |
| PRK06217 | 183 | hypothetical protein; Validated | 96.52 | |
| PRK05439 | 311 | pantothenate kinase; Provisional | 96.51 | |
| PRK00089 | 292 | era GTPase Era; Reviewed | 96.5 | |
| COG0467 | 260 | RAD55 RecA-superfamily ATPases implicated in signa | 96.49 | |
| PF13481 | 193 | AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. | 96.48 | |
| PF13238 | 129 | AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB | 96.47 | |
| PF06745 | 226 | KaiC: KaiC; InterPro: IPR014774 This entry represe | 96.46 | |
| COG0572 | 218 | Udk Uridine kinase [Nucleotide transport and metab | 96.45 | |
| CHL00071 | 409 | tufA elongation factor Tu | 96.42 | |
| TIGR03880 | 224 | KaiC_arch_3 KaiC domain protein, AF_0351 family. T | 96.41 | |
| smart00053 | 240 | DYNc Dynamin, GTPase. Large GTPases that mediate v | 96.41 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 96.39 | |
| PRK06761 | 282 | hypothetical protein; Provisional | 96.39 | |
| TIGR03881 | 229 | KaiC_arch_4 KaiC domain protein, PAE1156 family. M | 96.37 | |
| TIGR00708 | 173 | cobA cob(I)alamin adenosyltransferase. Alternate n | 96.36 | |
| PF03796 | 259 | DnaB_C: DnaB-like helicase C terminal domain; Inte | 96.36 | |
| PRK05380 | 533 | pyrG CTP synthetase; Validated | 96.35 | |
| PRK05642 | 234 | DNA replication initiation factor; Validated | 96.34 | |
| TIGR03877 | 237 | thermo_KaiC_1 KaiC domain protein, Ph0284 family. | 96.34 | |
| PTZ00301 | 210 | uridine kinase; Provisional | 96.33 | |
| PRK00698 | 205 | tmk thymidylate kinase; Validated | 96.31 | |
| COG0237 | 201 | CoaE Dephospho-CoA kinase [Coenzyme metabolism] | 96.3 | |
| COG4240 | 300 | Predicted kinase [General function prediction only | 96.3 | |
| cd04165 | 224 | GTPBP1_like GTPBP1-like. Mammalian GTP binding pro | 96.29 | |
| PF13479 | 213 | AAA_24: AAA domain | 96.29 | |
| PF05729 | 166 | NACHT: NACHT domain | 96.27 | |
| PRK13947 | 171 | shikimate kinase; Provisional | 96.26 | |
| PF13604 | 196 | AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL | 96.26 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 96.25 | |
| PRK08116 | 268 | hypothetical protein; Validated | 96.25 | |
| cd02023 | 198 | UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. | 96.24 | |
| PRK11537 | 318 | putative GTP-binding protein YjiA; Provisional | 96.22 | |
| KOG3220|consensus | 225 | 96.22 | ||
| TIGR00101 | 199 | ureG urease accessory protein UreG. This model rep | 96.21 | |
| PRK03731 | 171 | aroL shikimate kinase II; Reviewed | 96.2 | |
| PRK09519 | 790 | recA DNA recombination protein RecA; Reviewed | 96.16 | |
| PLN03186 | 342 | DNA repair protein RAD51 homolog; Provisional | 96.15 | |
| PRK08903 | 227 | DnaA regulatory inactivator Hda; Validated | 96.15 | |
| cd04167 | 213 | Snu114p Snu114p subfamily. Snu114p is one of sever | 96.13 | |
| PRK06547 | 172 | hypothetical protein; Provisional | 96.13 | |
| TIGR02475 | 341 | CobW cobalamin biosynthesis protein CobW. A broade | 96.13 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 96.12 | |
| KOG1534|consensus | 273 | 96.12 | ||
| COG1435 | 201 | Tdk Thymidine kinase [Nucleotide transport and met | 96.11 | |
| PRK05800 | 170 | cobU adenosylcobinamide kinase/adenosylcobinamide- | 96.11 | |
| PRK12736 | 394 | elongation factor Tu; Reviewed | 96.09 | |
| COG1159 | 298 | Era GTPase [General function prediction only] | 96.06 | |
| KOG2749|consensus | 415 | 96.03 | ||
| PF13086 | 236 | AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV | 96.02 | |
| PRK13973 | 213 | thymidylate kinase; Provisional | 96.02 | |
| COG1855 | 604 | ATPase (PilT family) [General function prediction | 96.01 | |
| TIGR00485 | 394 | EF-Tu translation elongation factor TU. This align | 96.0 | |
| PF01268 | 557 | FTHFS: Formate--tetrahydrofolate ligase; InterPro: | 95.99 | |
| TIGR01360 | 188 | aden_kin_iso1 adenylate kinase, isozyme 1 subfamil | 95.98 | |
| PF13521 | 163 | AAA_28: AAA domain; PDB: 1LW7_A. | 95.97 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 95.97 | |
| PRK00131 | 175 | aroK shikimate kinase; Reviewed | 95.95 | |
| PRK06851 | 367 | hypothetical protein; Provisional | 95.94 | |
| TIGR03575 | 340 | selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryoti | 95.94 | |
| PRK05595 | 444 | replicative DNA helicase; Provisional | 95.93 | |
| PTZ00141 | 446 | elongation factor 1- alpha; Provisional | 95.92 | |
| PRK07261 | 171 | topology modulation protein; Provisional | 95.91 | |
| PF05970 | 364 | PIF1: PIF1-like helicase; InterPro: IPR010285 This | 95.89 | |
| COG0504 | 533 | PyrG CTP synthase (UTP-ammonia lyase) [Nucleotide | 95.88 | |
| cd02020 | 147 | CMPK Cytidine monophosphate kinase (CMPK) catalyze | 95.87 | |
| PRK04328 | 249 | hypothetical protein; Provisional | 95.86 | |
| PLN03126 | 478 | Elongation factor Tu; Provisional | 95.84 | |
| PRK08760 | 476 | replicative DNA helicase; Provisional | 95.84 | |
| TIGR03600 | 421 | phage_DnaB phage replicative helicase, DnaB family | 95.84 | |
| PLN03046 | 460 | D-glycerate 3-kinase; Provisional | 95.84 | |
| PRK13949 | 169 | shikimate kinase; Provisional | 95.82 | |
| COG1102 | 179 | Cmk Cytidylate kinase [Nucleotide transport and me | 95.81 | |
| COG1663 | 336 | LpxK Tetraacyldisaccharide-1-P 4'-kinase [Cell env | 95.79 | |
| PRK12735 | 396 | elongation factor Tu; Reviewed | 95.79 | |
| PRK01184 | 184 | hypothetical protein; Provisional | 95.77 | |
| PLN02796 | 347 | D-glycerate 3-kinase | 95.76 | |
| PF00004 | 132 | AAA: ATPase family associated with various cellula | 95.76 | |
| TIGR02239 | 316 | recomb_RAD51 DNA repair protein RAD51. This eukary | 95.75 | |
| PRK08506 | 472 | replicative DNA helicase; Provisional | 95.74 | |
| PLN02327 | 557 | CTP synthase | 95.7 | |
| PRK03839 | 180 | putative kinase; Provisional | 95.69 | |
| PRK12338 | 319 | hypothetical protein; Provisional | 95.68 | |
| TIGR00665 | 434 | DnaB replicative DNA helicase. This model describe | 95.67 | |
| PF13173 | 128 | AAA_14: AAA domain | 95.67 | |
| PRK14528 | 186 | adenylate kinase; Provisional | 95.67 | |
| PRK14530 | 215 | adenylate kinase; Provisional | 95.65 | |
| PF01745 | 233 | IPT: Isopentenyl transferase; InterPro: IPR002648 | 95.65 | |
| PRK06749 | 428 | replicative DNA helicase; Provisional | 95.64 | |
| PRK00081 | 194 | coaE dephospho-CoA kinase; Reviewed | 95.64 | |
| PF08423 | 256 | Rad51: Rad51; InterPro: IPR013632 This domain is f | 95.63 | |
| TIGR00337 | 525 | PyrG CTP synthase. CTP synthase is involved in pyr | 95.62 | |
| COG4108 | 528 | PrfC Peptide chain release factor RF-3 [Translatio | 95.6 | |
| COG0125 | 208 | Tmk Thymidylate kinase [Nucleotide transport and m | 95.58 | |
| COG1160 | 444 | Predicted GTPases [General function prediction onl | 95.57 | |
| PRK14531 | 183 | adenylate kinase; Provisional | 95.56 | |
| PRK08006 | 471 | replicative DNA helicase; Provisional | 95.55 | |
| PRK00300 | 205 | gmk guanylate kinase; Provisional | 95.53 | |
| TIGR01359 | 183 | UMP_CMP_kin_fam UMP-CMP kinase family. This subfam | 95.53 | |
| PRK13507 | 587 | formate--tetrahydrofolate ligase; Provisional | 95.53 | |
| cd02024 | 187 | NRK1 Nicotinamide riboside kinase (NRK) is an enzy | 95.53 | |
| PF07724 | 171 | AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR | 95.52 | |
| PRK09270 | 229 | nucleoside triphosphate hydrolase domain-containin | 95.49 | |
| PRK12339 | 197 | 2-phosphoglycerate kinase; Provisional | 95.49 | |
| PRK02496 | 184 | adk adenylate kinase; Provisional | 95.48 | |
| PRK10846 | 416 | bifunctional folylpolyglutamate synthase/ dihydrof | 95.48 | |
| TIGR00436 | 270 | era GTP-binding protein Era. Era is an essential G | 95.47 | |
| PRK05748 | 448 | replicative DNA helicase; Provisional | 95.46 | |
| cd00046 | 144 | DEXDc DEAD-like helicases superfamily. A diverse f | 95.43 | |
| PLN02759 | 637 | Formate--tetrahydrofolate ligase | 95.41 | |
| PRK09165 | 497 | replicative DNA helicase; Provisional | 95.41 | |
| PRK13975 | 196 | thymidylate kinase; Provisional | 95.41 | |
| PRK08840 | 464 | replicative DNA helicase; Provisional | 95.39 | |
| PRK05986 | 191 | cob(I)alamin adenolsyltransferase/cobinamide ATP-d | 95.39 | |
| PRK07429 | 327 | phosphoribulokinase; Provisional | 95.38 | |
| cd01123 | 235 | Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r | 95.36 | |
| PLN02200 | 234 | adenylate kinase family protein | 95.36 | |
| PF07728 | 139 | AAA_5: AAA domain (dynein-related subfamily); Inte | 95.34 | |
| PRK13695 | 174 | putative NTPase; Provisional | 95.34 | |
| PLN00043 | 447 | elongation factor 1-alpha; Provisional | 95.34 | |
| PF09848 | 352 | DUF2075: Uncharacterized conserved protein (DUF207 | 95.33 | |
| PRK12422 | 445 | chromosomal replication initiation protein; Provis | 95.33 | |
| TIGR00554 | 290 | panK_bact pantothenate kinase, bacterial type. Sho | 95.33 | |
| PRK06904 | 472 | replicative DNA helicase; Validated | 95.31 | |
| PF13191 | 185 | AAA_16: AAA ATPase domain; PDB: 2V1U_A. | 95.31 | |
| cd01125 | 239 | repA Hexameric Replicative Helicase RepA. RepA is | 95.31 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 95.3 | |
| PRK05057 | 172 | aroK shikimate kinase I; Reviewed | 95.26 | |
| COG0480 | 697 | FusA Translation elongation factors (GTPases) [Tra | 95.24 | |
| PF02223 | 186 | Thymidylate_kin: Thymidylate kinase; InterPro: IPR | 95.23 | |
| PF13671 | 143 | AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 | 95.22 | |
| cd00227 | 175 | CPT Chloramphenicol (Cm) phosphotransferase (CPT). | 95.2 | |
| TIGR00376 | 637 | DNA helicase, putative. The gene product may repre | 95.19 | |
| PRK09302 | 509 | circadian clock protein KaiC; Reviewed | 95.18 | |
| PF00910 | 107 | RNA_helicase: RNA helicase; InterPro: IPR000605 He | 95.17 | |
| PRK06321 | 472 | replicative DNA helicase; Provisional | 95.16 | |
| PHA02530 | 300 | pseT polynucleotide kinase; Provisional | 95.15 | |
| PRK04220 | 301 | 2-phosphoglycerate kinase; Provisional | 95.14 | |
| TIGR03754 | 643 | conj_TOL_TraD conjugative coupling factor TraD, TO | 95.13 | |
| cd02026 | 273 | PRK Phosphoribulokinase (PRK) is an enzyme involve | 95.1 | |
| cd02022 | 179 | DPCK Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.2 | 95.09 | |
| PF10662 | 143 | PduV-EutP: Ethanolamine utilisation - propanediol | 95.09 | |
| TIGR01618 | 220 | phage_P_loop phage nucleotide-binding protein. Thi | 95.08 | |
| cd01131 | 198 | PilT Pilus retraction ATPase PilT. PilT is a nucle | 95.08 | |
| PRK13764 | 602 | ATPase; Provisional | 95.06 | |
| PRK05537 | 568 | bifunctional sulfate adenylyltransferase subunit 1 | 95.06 | |
| COG0370 | 653 | FeoB Fe2+ transport system protein B [Inorganic io | 95.06 | |
| COG1072 | 283 | CoaA Panthothenate kinase [Coenzyme metabolism] | 95.05 | |
| PRK00625 | 173 | shikimate kinase; Provisional | 95.04 | |
| PLN02165 | 334 | adenylate isopentenyltransferase | 95.0 | |
| KOG2004|consensus | 906 | 94.94 | ||
| PTZ00386 | 625 | formyl tetrahydrofolate synthetase; Provisional | 94.92 | |
| TIGR02880 | 284 | cbbX_cfxQ probable Rubsico expression protein CbbX | 94.91 | |
| COG3911 | 183 | Predicted ATPase [General function prediction only | 94.91 | |
| PF00308 | 219 | Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 | 94.89 | |
| cd01129 | 264 | PulE-GspE PulE/GspE The type II secretory pathway | 94.86 | |
| TIGR01393 | 595 | lepA GTP-binding protein LepA. LepA (GUF1 in Sacca | 94.86 | |
| cd01883 | 219 | EF1_alpha Eukaryotic elongation factor 1 (EF1) alp | 94.85 | |
| PRK05636 | 505 | replicative DNA helicase; Provisional | 94.84 | |
| PF06414 | 199 | Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e | 94.84 | |
| PRK00023 | 225 | cmk cytidylate kinase; Provisional | 94.82 | |
| PRK07004 | 460 | replicative DNA helicase; Provisional | 94.82 | |
| PRK13946 | 184 | shikimate kinase; Provisional | 94.8 | |
| cd02021 | 150 | GntK Gluconate kinase (GntK) catalyzes the phospho | 94.8 | |
| PF00931 | 287 | NB-ARC: NB-ARC domain; InterPro: IPR002182 This is | 94.79 | |
| PRK04182 | 180 | cytidylate kinase; Provisional | 94.79 | |
| TIGR00017 | 217 | cmk cytidylate kinase. This family consists of cyt | 94.77 | |
| PRK14730 | 195 | coaE dephospho-CoA kinase; Provisional | 94.77 | |
| TIGR02322 | 179 | phosphon_PhnN phosphonate metabolism protein/1,5-b | 94.76 | |
| TIGR02881 | 261 | spore_V_K stage V sporulation protein K. Members o | 94.75 | |
| PF00265 | 176 | TK: Thymidine kinase; InterPro: IPR001267 Thymidin | 94.73 | |
| KOG0991|consensus | 333 | 94.72 | ||
| COG2019 | 189 | AdkA Archaeal adenylate kinase [Nucleotide transpo | 94.67 | |
| COG0703 | 172 | AroK Shikimate kinase [Amino acid transport and me | 94.65 | |
| PRK14734 | 200 | coaE dephospho-CoA kinase; Provisional | 94.65 | |
| cd00464 | 154 | SK Shikimate kinase (SK) is the fifth enzyme in th | 94.64 | |
| PRK13948 | 182 | shikimate kinase; Provisional | 94.64 | |
| TIGR02782 | 299 | TrbB_P P-type conjugative transfer ATPase TrbB. Th | 94.63 | |
| COG0563 | 178 | Adk Adenylate kinase and related kinases [Nucleoti | 94.62 | |
| PRK07560 | 731 | elongation factor EF-2; Reviewed | 94.61 | |
| PTZ00088 | 229 | adenylate kinase 1; Provisional | 94.6 | |
| KOG0744|consensus | 423 | 94.6 | ||
| TIGR00362 | 405 | DnaA chromosomal replication initiator protein Dna | 94.56 | |
| cd01428 | 194 | ADK Adenylate kinase (ADK) catalyzes the reversibl | 94.55 | |
| PF10412 | 386 | TrwB_AAD_bind: Type IV secretion-system coupling p | 94.54 | |
| PRK05506 | 632 | bifunctional sulfate adenylyltransferase subunit 1 | 94.53 | |
| PRK00091 | 307 | miaA tRNA delta(2)-isopentenylpyrophosphate transf | 94.48 | |
| PRK00149 | 450 | dnaA chromosomal replication initiation protein; R | 94.45 | |
| TIGR01313 | 163 | therm_gnt_kin carbohydrate kinase, thermoresistant | 94.44 | |
| CHL00181 | 287 | cbbX CbbX; Provisional | 94.43 | |
| PRK09302 | 509 | circadian clock protein KaiC; Reviewed | 94.43 | |
| TIGR02173 | 171 | cyt_kin_arch cytidylate kinase, putative. Proteins | 94.42 | |
| COG2874 | 235 | FlaH Predicted ATPases involved in biogenesis of a | 94.39 | |
| PLN02348 | 395 | phosphoribulokinase | 94.35 | |
| TIGR03172 | 232 | probable selenium-dependent hydroxylase accessory | 94.33 | |
| TIGR00150 | 133 | HI0065_YjeE ATPase, YjeE family. Members of this f | 94.32 | |
| smart00763 | 361 | AAA_PrkA PrkA AAA domain. This is a family of PrkA | 94.32 | |
| PF00437 | 270 | T2SE: Type II/IV secretion system protein; InterPr | 94.31 | |
| TIGR03743 | 634 | SXT_TraD conjugative coupling factor TraD, SXT/TOL | 94.26 | |
| COG1428 | 216 | Deoxynucleoside kinases [Nucleotide transport and | 94.25 | |
| KOG3062|consensus | 281 | 94.23 | ||
| PRK13976 | 209 | thymidylate kinase; Provisional | 94.2 | |
| PRK14532 | 188 | adenylate kinase; Provisional | 94.19 | |
| TIGR02746 | 797 | TraC-F-type type-IV secretion system protein TraC. | 94.17 | |
| PRK07414 | 178 | cob(I)yrinic acid a,c-diamide adenosyltransferase; | 94.16 | |
| COG2759 | 554 | MIS1 Formyltetrahydrofolate synthetase [Nucleotide | 94.15 | |
| PRK14088 | 440 | dnaA chromosomal replication initiation protein; P | 94.13 | |
| PRK14738 | 206 | gmk guanylate kinase; Provisional | 94.07 | |
| PF01580 | 205 | FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR00 | 94.07 | |
| PF02562 | 205 | PhoH: PhoH-like protein; InterPro: IPR003714 PhoH | 94.05 | |
| PRK13700 | 732 | conjugal transfer protein TraD; Provisional | 94.04 | |
| PRK14731 | 208 | coaE dephospho-CoA kinase; Provisional | 93.99 | |
| PRK12317 | 425 | elongation factor 1-alpha; Reviewed | 93.98 | |
| PLN02422 | 232 | dephospho-CoA kinase | 93.98 | |
| PRK00279 | 215 | adk adenylate kinase; Reviewed | 93.91 | |
| PF01591 | 222 | 6PF2K: 6-phosphofructo-2-kinase; InterPro: IPR0130 | 93.91 | |
| PRK08099 | 399 | bifunctional DNA-binding transcriptional repressor | 93.9 | |
| TIGR01499 | 397 | folC folylpolyglutamate synthase/dihydrofolate syn | 93.87 | |
| COG0050 | 394 | TufB GTPases - translation elongation factors [Tra | 93.85 | |
| PRK10536 | 262 | hypothetical protein; Provisional | 93.84 | |
| TIGR01085 | 464 | murE UDP-N-acetylmuramyl-tripeptide synthetase. A | 93.82 | |
| PRK14733 | 204 | coaE dephospho-CoA kinase; Provisional | 93.82 | |
| COG2074 | 299 | 2-phosphoglycerate kinase [Carbohydrate transport | 93.81 | |
| PRK05416 | 288 | glmZ(sRNA)-inactivating NTPase; Provisional | 93.8 | |
| TIGR01351 | 210 | adk adenylate kinases. Adenylate kinase (EC 2.7.4. | 93.79 | |
| TIGR02640 | 262 | gas_vesic_GvpN gas vesicle protein GvpN. Members o | 93.75 | |
| COG1110 | 1187 | Reverse gyrase [DNA replication, recombination, an | 93.73 | |
| KOG0462|consensus | 650 | 93.72 | ||
| PRK08356 | 195 | hypothetical protein; Provisional | 93.68 | |
| PLN02674 | 244 | adenylate kinase | 93.67 | |
| TIGR01420 | 343 | pilT_fam pilus retraction protein PilT. This model | 93.64 | |
| PRK12740 | 668 | elongation factor G; Reviewed | 93.62 | |
| TIGR02836 | 492 | spore_IV_A stage IV sporulation protein A. A compa | 93.58 | |
| PRK01438 | 480 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 93.54 | |
| TIGR02768 | 744 | TraA_Ti Ti-type conjugative transfer relaxase TraA | 93.49 | |
| PRK00139 | 460 | murE UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-d | 93.47 | |
| PRK13721 | 844 | conjugal transfer ATP-binding protein TraC; Provis | 93.47 | |
| cd01127 | 410 | TrwB Bacterial conjugation protein TrwB, ATP bindi | 93.46 | |
| PRK07773 | 886 | replicative DNA helicase; Validated | 93.46 | |
| TIGR01650 | 327 | PD_CobS cobaltochelatase, CobS subunit. This model | 93.41 | |
| PLN02748 | 468 | tRNA dimethylallyltransferase | 93.39 | |
| PRK01390 | 460 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 93.39 | |
| TIGR00929 | 785 | VirB4_CagE type IV secretion/conjugal transfer ATP | 93.38 | |
| PRK09518 | 712 | bifunctional cytidylate kinase/GTPase Der; Reviewe | 93.36 | |
| TIGR03015 | 269 | pepcterm_ATPase putative secretion ATPase, PEP-CTE | 93.35 | |
| COG0466 | 782 | Lon ATP-dependent Lon protease, bacterial type [Po | 93.34 | |
| PRK10078 | 186 | ribose 1,5-bisphosphokinase; Provisional | 93.31 | |
| TIGR03783 | 829 | Bac_Flav_CT_G Bacteroides conjugation system ATPas | 93.28 | |
| PLN02840 | 421 | tRNA dimethylallyltransferase | 93.24 | |
| TIGR01448 | 720 | recD_rel helicase, putative, RecD/TraA family. Thi | 93.24 |
| >COG0132 BioD Dethiobiotin synthetase [Coenzyme metabolism] | Back alignment and domain information |
|---|
Probab=100.00 E-value=4.3e-38 Score=249.05 Aligned_cols=219 Identities=37% Similarity=0.619 Sum_probs=193.9
Q ss_pred CceeEEEEeCCCCCcHHHHHHHHHHHHHHcCCeeeEEeeeecCcccCCCCCCccchHHHHHHHHhCCCcccccceeeeee
Q psy14904 5 NFLHYFITGTNTNIGKTIISCALLSEFKKRGISCIGMKPIASGAYLNNKNKIWFNEDVNLLNKYSNSLYEFTKLINPYLF 84 (233)
Q Consensus 5 ~~~~i~i~~~kggvGKTt~a~~La~~l~~~G~~Vl~~dp~~~~~~~~~~~~~l~~~d~~~~~~~~~~~~~~~~~~~~~~~ 84 (233)
||+.|+|||+.+|||||++|+.|+++++++|++|.++||+++|.+... + ++|..++++.+++..++ +.++|+.|
T Consensus 1 m~~~~fVtGTDT~VGKTv~S~aL~~~l~~~g~~~~~~KPVqsG~~~~~--~---~~D~~~l~~~~~~~~~~-~~~~py~f 74 (223)
T COG0132 1 MMKRFFVTGTDTGVGKTVVSAALAQALKQQGYSVAGYKPVQTGSEETA--E---NSDALVLQRLSGLDLSY-ELINPYRF 74 (223)
T ss_pred CCceEEEEeCCCCccHHHHHHHHHHHHHhCCCeeEEECceeeCCCCCC--C---CchHHHHHHhcCCCccc-ccccceec
Confidence 578999999999999999999999999999999999999999887543 1 46899999999987666 67889999
Q ss_pred cCCCChhhhhhhcCCCCCHHHHHHHHHHhhcCCCeEEEeccCcccCccCCCCchHHHHHHhCCCEEEEEcCCCCcHHHHH
Q psy14904 85 KYPISPYTSSNLENRIINTSHIINCYNYLSNLTDVIILEGIGGFSVPFHDNENSADLAEKLGLPIILVIDLKIGCINNAL 164 (233)
Q Consensus 85 ~~~~~~~~~~~~~~~~~~~~~l~~~~~~l~~~~D~vlID~~~g~~~p~~~~~~~~~l~~~~~~~vllV~~~~~~~~~~~~ 164 (233)
..|.+|++++..++..++.+.+...+.++.+.||+|||||+||+.+|+++.++.+|++..+..|+|+|+..++|++|+++
T Consensus 75 ~~P~sPhlAa~~eg~~I~~~~l~~~l~~l~~~~d~vlVEGAGGl~vPl~~~~~~~D~~~~~~lpvILV~~~~LGtINHtl 154 (223)
T COG0132 75 KEPLSPHLAAELEGRTIDLEKLSQGLRQLLKKYDLVLVEGAGGLLVPLTEEYTFADLAVQLQLPVILVVGIKLGTINHTL 154 (223)
T ss_pred CCCCCcHHHHhhcCCcccHHHHHHHHHhhhcccCEEEEeCCCceeeecCCcccHHHHHHHcCCCEEEEecCCccHHHHHH
Confidence 99999999999998888999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHhCCCcEEEEEEcccCCCchhhhhhhHHHHHhhcCCCceEecCCCCCCChhhhhhhcCCC
Q psy14904 165 LSLEAINSRGLKLIGWVANHTQIVDTLFANENYIELTKYLNVTPLGRIPYLYNLNINLISHYLDFS 230 (233)
Q Consensus 165 ~~~~~l~~~~~~i~GiVlN~~~~~~~~~~~~~~~~l~~~~~~pvlg~IP~~~~l~~~~~~~~~~~~ 230 (233)
.+++.+++.++++.|+|+|+++ +......+....+++..+.|++|.+|+.++.......++.+++
T Consensus 155 Lt~eal~~~gl~l~G~I~n~~~-~~~~~~~~~~~~l~~~~~~p~~g~~p~~~~~~~~~~~~~~~l~ 219 (223)
T COG0132 155 LTVEALRARGLPLAGWVANGIN-PELDHYAEINATLLKRIGAPLLGIIPYLPESEEEELGKLIDLA 219 (223)
T ss_pred HHHHHHHHCCCCEEEEEEccCC-CchhHHHHHHHHHHHhcCCCccccccCCccccchhhhhhhhhH
Confidence 9999999999999999999998 6554444455578888999999999998876544444444443
|
|
| >PRK12374 putative dithiobiotin synthetase; Provisional | Back alignment and domain information |
|---|
| >PF13500 AAA_26: AAA domain; PDB: 3OF5_A 2IOJ_A 4A0G_B 4A0R_A 4A0H_B 4A0F_B 3FMI_C 3FPA_D 3FMF_C 3FGN_A | Back alignment and domain information |
|---|
| >PRK00090 bioD dithiobiotin synthetase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00347 bioD dethiobiotin synthase | Back alignment and domain information |
|---|
| >PRK00784 cobyric acid synthase; Provisional | Back alignment and domain information |
|---|
| >PLN02974 adenosylmethionine-8-amino-7-oxononanoate transaminase | Back alignment and domain information |
|---|
| >TIGR00313 cobQ cobyric acid synthase CobQ | Back alignment and domain information |
|---|
| >PRK01077 cobyrinic acid a,c-diamide synthase; Validated | Back alignment and domain information |
|---|
| >TIGR00379 cobB cobyrinic acid a,c-diamide synthase | Back alignment and domain information |
|---|
| >PRK11670 antiporter inner membrane protein; Provisional | Back alignment and domain information |
|---|
| >COG1797 CobB Cobyrinic acid a,c-diamide synthase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >COG2894 MinD Septum formation inhibitor-activating ATPase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR01969 minD_arch cell division ATPase MinD, archaeal | Back alignment and domain information |
|---|
| >PRK05632 phosphate acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >cd02037 MRP-like MRP (Multiple Resistance and pH adaptation) is a homologue of the Fer4_NifH superfamily | Back alignment and domain information |
|---|
| >CHL00175 minD septum-site determining protein; Validated | Back alignment and domain information |
|---|
| >cd03109 DTBS Dethiobiotin synthetase (DTBS) is the penultimate enzyme in the biotin biosynthesis pathway in Escherichia coli and other microorganisms | Back alignment and domain information |
|---|
| >PRK13896 cobyrinic acid a,c-diamide synthase; Provisional | Back alignment and domain information |
|---|
| >PRK06278 cobyrinic acid a,c-diamide synthase; Validated | Back alignment and domain information |
|---|
| >cd02117 NifH_like This family contains the NifH (iron protein) of nitrogenase, L subunit (BchL/ChlL) of the protochlorophyllide reductase and the BchX subunit of the Chlorophyllide reductase | Back alignment and domain information |
|---|
| >TIGR01968 minD_bact septum site-determining protein MinD | Back alignment and domain information |
|---|
| >cd02036 MinD Bacterial cell division requires the formation of a septum at mid-cell | Back alignment and domain information |
|---|
| >PRK13232 nifH nitrogenase reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK13235 nifH nitrogenase reductase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01007 eps_fam capsular exopolysaccharide family | Back alignment and domain information |
|---|
| >COG0489 Mrp ATPases involved in chromosome partitioning [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK10818 cell division inhibitor MinD; Provisional | Back alignment and domain information |
|---|
| >PRK13869 plasmid-partitioning protein RepA; Provisional | Back alignment and domain information |
|---|
| >COG0455 flhG Antiactivator of flagellar biosynthesis FleN, an ATPase [Cell motility] | Back alignment and domain information |
|---|
| >PRK13233 nifH nitrogenase reductase; Reviewed | Back alignment and domain information |
|---|
| >TIGR03371 cellulose_yhjQ cellulose synthase operon protein YhjQ | Back alignment and domain information |
|---|
| >cd03110 Fer4_NifH_child This protein family's function is unkown | Back alignment and domain information |
|---|
| >PHA02518 ParA-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG3022|consensus | Back alignment and domain information |
|---|
| >PRK13185 chlL protochlorophyllide reductase iron-sulfur ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd02040 NifH NifH gene encodes component II (iron protein) of nitrogenase | Back alignment and domain information |
|---|
| >TIGR03029 EpsG chain length determinant protein tyrosine kinase EpsG | Back alignment and domain information |
|---|
| >TIGR03453 partition_RepA plasmid partitioning protein RepA | Back alignment and domain information |
|---|
| >cd02032 Bchl_like This family of proteins contains bchL and chlL | Back alignment and domain information |
|---|
| >PRK13849 putative crown gall tumor protein VirC1; Provisional | Back alignment and domain information |
|---|
| >PRK13234 nifH nitrogenase reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK13236 nitrogenase reductase; Reviewed | Back alignment and domain information |
|---|
| >TIGR02016 BchX chlorophyllide reductase iron protein subunit X | Back alignment and domain information |
|---|
| >TIGR01281 DPOR_bchL light-independent protochlorophyllide reductase, iron-sulfur ATP-binding protein | Back alignment and domain information |
|---|
| >CHL00072 chlL photochlorophyllide reductase subunit L | Back alignment and domain information |
|---|
| >PF01656 CbiA: CobQ/CobB/MinD/ParA nucleotide binding domain; InterPro: IPR002586 This entry consists of various cobyrinic acid a,c-diamide synthases | Back alignment and domain information |
|---|
| >TIGR01287 nifH nitrogenase iron protein | Back alignment and domain information |
|---|
| >PF06564 YhjQ: YhjQ protein; InterPro: IPR017746 The YhjQ protein is encoded immediately upstream of bacterial cellulose synthase (bcs) genes in a broad range of bacteria, including both copies of the bcs locus in Klebsiella pneumoniae, and in several species is clearly part of the bcs operon | Back alignment and domain information |
|---|
| >PRK10037 cell division protein; Provisional | Back alignment and domain information |
|---|
| >PRK13231 nitrogenase reductase-like protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR03018 pepcterm_TyrKin exopolysaccharide/PEPCTERM locus tyrosine autokinase | Back alignment and domain information |
|---|
| >PHA02519 plasmid partition protein SopA; Reviewed | Back alignment and domain information |
|---|
| >COG1192 Soj ATPases involved in chromosome partitioning [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR03815 CpaE_hom_Actino helicase/secretion neighborhood CpaE-like protein | Back alignment and domain information |
|---|
| >PRK13705 plasmid-partitioning protein SopA; Provisional | Back alignment and domain information |
|---|
| >cd02033 BchX Chlorophyllide reductase converts chlorophylls into bacteriochlorophylls by reducing the chlorin B-ring | Back alignment and domain information |
|---|
| >PRK13230 nitrogenase reductase-like protein; Reviewed | Back alignment and domain information |
|---|
| >PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional | Back alignment and domain information |
|---|
| >COG1149 MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK11519 tyrosine kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR01005 eps_transp_fam exopolysaccharide transport protein family | Back alignment and domain information |
|---|
| >COG1492 CobQ Cobyric acid synthase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >cd02038 FleN-like FleN is a member of the Fer4_NifH superfamily | Back alignment and domain information |
|---|
| >PF07015 VirC1: VirC1 protein; InterPro: IPR009744 This family consists of several bacterial VirC1 proteins | Back alignment and domain information |
|---|
| >cd00550 ArsA_ATPase Oxyanion-translocating ATPase (ArsA) | Back alignment and domain information |
|---|
| >COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >cd02035 ArsA ArsA ATPase functionas as an efflux pump located on the inner membrane of the cell | Back alignment and domain information |
|---|
| >COG0857 Pta BioD-like N-terminal domain of phosphotransacetylase [General function prediction only] | Back alignment and domain information |
|---|
| >cd03111 CpaE_like This protein family consists of proteins similar to the cpaE protein of the Caulobacter pilus assembly and the orf4 protein of Actinobacillus pilus formation gene cluster | Back alignment and domain information |
|---|
| >PF00142 Fer4_NifH: 4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family; InterPro: IPR000392 This entry represents members of the NifH/BchL/ChlL family | Back alignment and domain information |
|---|
| >PF09140 MipZ: ATPase MipZ; InterPro: IPR015223 Cell division in bacteria is facilitated by a polymeric ring structure, the Z ring, composed of tubulin-like FtsZ protofilaments | Back alignment and domain information |
|---|
| >COG1348 NifH Nitrogenase subunit NifH (ATPase) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd02042 ParA ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation | Back alignment and domain information |
|---|
| >TIGR00064 ftsY signal recognition particle-docking protein FtsY | Back alignment and domain information |
|---|
| >PF02374 ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_A 3IBG_B 3SJA_A 3H84_B 3SJD_A 3ZS9_A 3A37_A 2WOJ_A 3SJC_B 3A36_B | Back alignment and domain information |
|---|
| >PRK10867 signal recognition particle protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00959 ffh signal recognition particle protein | Back alignment and domain information |
|---|
| >TIGR01425 SRP54_euk signal recognition particle protein SRP54 | Back alignment and domain information |
|---|
| >PRK10416 signal recognition particle-docking protein FtsY; Provisional | Back alignment and domain information |
|---|
| >PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes | Back alignment and domain information |
|---|
| >PRK12726 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PF13614 AAA_31: AAA domain; PDB: 2VED_B 2PH1_A 3EA0_B 3FKQ_A 3KB1_B 1ION_A 3LA6_H 3BFV_B 3CIO_D | Back alignment and domain information |
|---|
| >PRK00771 signal recognition particle protein Srp54; Provisional | Back alignment and domain information |
|---|
| >PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >PRK12723 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PRK12724 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK12727 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >COG0003 ArsA Predicted ATPase involved in chromosome partitioning [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK13886 conjugal transfer protein TraL; Provisional | Back alignment and domain information |
|---|
| >COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK14974 cell division protein FtsY; Provisional | Back alignment and domain information |
|---|
| >COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] | Back alignment and domain information |
|---|
| >cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain | Back alignment and domain information |
|---|
| >cd03114 ArgK-like The function of this protein family is unkown | Back alignment and domain information |
|---|
| >PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >COG4963 CpaE Flp pilus assembly protein, ATPase CpaE [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK13768 GTPase; Provisional | Back alignment and domain information |
|---|
| >PRK14493 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MoaE; Provisional | Back alignment and domain information |
|---|
| >KOG0780|consensus | Back alignment and domain information |
|---|
| >PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >TIGR03499 FlhF flagellar biosynthetic protein FlhF | Back alignment and domain information |
|---|
| >PRK14494 putative molybdopterin-guanine dinucleotide biosynthesis protein MobB/FeS domain-containing protein protein; Provisional | Back alignment and domain information |
|---|
| >cd02034 CooC The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH) | Back alignment and domain information |
|---|
| >COG1763 MobB Molybdopterin-guanine dinucleotide biosynthesis protein [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PRK14495 putative molybdopterin-guanine dinucleotide biosynthesis protein MobB/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00750 lao LAO/AO transport system ATPase | Back alignment and domain information |
|---|
| >PRK09435 membrane ATPase/protein kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB | Back alignment and domain information |
|---|
| >PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional | Back alignment and domain information |
|---|
| >TIGR00345 arsA arsenite-activated ATPase (arsA) | Back alignment and domain information |
|---|
| >KOG0781|consensus | Back alignment and domain information |
|---|
| >PF07755 DUF1611: Protein of unknown function (DUF1611); InterPro: IPR011669 This entry contains a number of hypothetical bacterial and archaeal proteins | Back alignment and domain information |
|---|
| >cd03116 MobB Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes | Back alignment and domain information |
|---|
| >PF10609 ParA: ParA/MinD ATPase like; InterPro: IPR019591 This entry represents ATPases involved in plasmid partitioning [] | Back alignment and domain information |
|---|
| >PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components | Back alignment and domain information |
|---|
| >PRK14491 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MoeA; Provisional | Back alignment and domain information |
|---|
| >COG3367 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A | Back alignment and domain information |
|---|
| >PRK14489 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobA/MobB; Provisional | Back alignment and domain information |
|---|
| >PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity | Back alignment and domain information |
|---|
| >PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >KOG1532|consensus | Back alignment and domain information |
|---|
| >cd03113 CTGs CTP synthetase (CTPs) is a two-domain protein, which consists of an N-terminal synthetase domain and C-terminal glutaminase domain | Back alignment and domain information |
|---|
| >cd04170 EF-G_bact Elongation factor G (EF-G) subfamily | Back alignment and domain information |
|---|
| >COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] | Back alignment and domain information |
|---|
| >COG1341 Predicted GTPase or GTP-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK13505 formate--tetrahydrofolate ligase; Provisional | Back alignment and domain information |
|---|
| >PRK05973 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1533|consensus | Back alignment and domain information |
|---|
| >cd00477 FTHFS Formyltetrahydrofolate synthetase (FTHFS) catalyzes the ATP-dependent activation of formate ion via its addition to the N10 position of tetrahydrofolate | Back alignment and domain information |
|---|
| >cd01886 EF-G Elongation factor G (EF-G) subfamily | Back alignment and domain information |
|---|
| >KOG2825|consensus | Back alignment and domain information |
|---|
| >cd04168 TetM_like Tet(M)-like subfamily | Back alignment and domain information |
|---|
| >PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases | Back alignment and domain information |
|---|
| >COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK04296 thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >PF02492 cobW: CobW/HypB/UreG, nucleotide-binding domain; InterPro: IPR003495 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt | Back alignment and domain information |
|---|
| >cd04169 RF3 RF3 subfamily | Back alignment and domain information |
|---|
| >TIGR02012 tigrfam_recA protein RecA | Back alignment and domain information |
|---|
| >cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A | Back alignment and domain information |
|---|
| >cd01121 Sms Sms (bacterial radA) DNA repair protein | Back alignment and domain information |
|---|
| >PRK00889 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif | Back alignment and domain information |
|---|
| >COG2403 Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11823 DNA repair protein RadA; Provisional | Back alignment and domain information |
|---|
| >PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site | Back alignment and domain information |
|---|
| >TIGR00073 hypB hydrogenase accessory protein HypB | Back alignment and domain information |
|---|
| >PRK14490 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MobA; Provisional | Back alignment and domain information |
|---|
| >TIGR00416 sms DNA repair protein RadA | Back alignment and domain information |
|---|
| >PRK07667 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK00741 prfC peptide chain release factor 3; Provisional | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >PRK05480 uridine/cytidine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK15453 phosphoribulokinase; Provisional | Back alignment and domain information |
|---|
| >PHA00729 NTP-binding motif containing protein | Back alignment and domain information |
|---|
| >cd01394 radB RadB | Back alignment and domain information |
|---|
| >cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars | Back alignment and domain information |
|---|
| >cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >PRK09354 recA recombinase A; Provisional | Back alignment and domain information |
|---|
| >PRK13506 formate--tetrahydrofolate ligase; Provisional | Back alignment and domain information |
|---|
| >cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP | Back alignment and domain information |
|---|
| >cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs | Back alignment and domain information |
|---|
| >PRK00007 elongation factor G; Reviewed | Back alignment and domain information |
|---|
| >TIGR02236 recomb_radA DNA repair and recombination protein RadA | Back alignment and domain information |
|---|
| >PRK10463 hydrogenase nickel incorporation protein HypB; Provisional | Back alignment and domain information |
|---|
| >cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >cd01884 EF_Tu EF-Tu subfamily | Back alignment and domain information |
|---|
| >cd00881 GTP_translation_factor GTP translation factor family | Back alignment and domain information |
|---|
| >PRK09361 radB DNA repair and recombination protein RadB; Provisional | Back alignment and domain information |
|---|
| >TIGR02237 recomb_radB DNA repair and recombination protein RadB | Back alignment and domain information |
|---|
| >COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR00484 EF-G translation elongation factor EF-G | Back alignment and domain information |
|---|
| >COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK08233 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >PRK06696 uridine kinase; Validated | Back alignment and domain information |
|---|
| >PRK07952 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >PRK12739 elongation factor G; Reviewed | Back alignment and domain information |
|---|
| >COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd02029 PRK_like Phosphoribulokinase-like (PRK-like) is a family of proteins similar to phosphoribulokinase (PRK), the enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes | Back alignment and domain information |
|---|
| >PF01935 DUF87: Domain of unknown function DUF87; InterPro: IPR002789 The function of this domain is unknown | Back alignment and domain information |
|---|
| >TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family | Back alignment and domain information |
|---|
| >PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 | Back alignment and domain information |
|---|
| >cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) | Back alignment and domain information |
|---|
| >cd01120 RecA-like_NTPases RecA-like NTPases | Back alignment and domain information |
|---|
| >PF00154 RecA: recA bacterial DNA recombination protein; InterPro: IPR013765 The recA gene product is a multifunctional enzyme that plays a role in homologous recombination, DNA repair and induction of the SOS response [] | Back alignment and domain information |
|---|
| >PRK09183 transposase/IS protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00682 lpxK tetraacyldisaccharide 4'-kinase | Back alignment and domain information |
|---|
| >PRK05541 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00503 prfC peptide chain release factor 3 | Back alignment and domain information |
|---|
| >PRK03846 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK00652 lpxK tetraacyldisaccharide 4'-kinase; Reviewed | Back alignment and domain information |
|---|
| >PF06418 CTP_synth_N: CTP synthase N-terminus; InterPro: IPR017456 CTP synthase is involved in pyrimidine ribonucleotide/ribonucleoside metabolism, catalysing the synthesis of CTP from UTP by amination of the pyrimidine ring at the 4-position [] | Back alignment and domain information |
|---|
| >PRK12377 putative replication protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal | Back alignment and domain information |
|---|
| >TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 | Back alignment and domain information |
|---|
| >PRK08118 topology modulation protein; Reviewed | Back alignment and domain information |
|---|
| >PLN03187 meiotic recombination protein DMC1 homolog; Provisional | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >TIGR00041 DTMP_kinase thymidylate kinase | Back alignment and domain information |
|---|
| >PRK08939 primosomal protein DnaI; Reviewed | Back alignment and domain information |
|---|
| >cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor | Back alignment and domain information |
|---|
| >PRK08181 transposase; Validated | Back alignment and domain information |
|---|
| >TIGR00235 udk uridine kinase | Back alignment and domain information |
|---|
| >cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) | Back alignment and domain information |
|---|
| >PRK04040 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >cd00984 DnaB_C DnaB helicase C terminal domain | Back alignment and domain information |
|---|
| >PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] | Back alignment and domain information |
|---|
| >PRK06835 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >PF02606 LpxK: Tetraacyldisaccharide-1-P 4'-kinase; InterPro: IPR003758 Tetraacyldisaccharide 4'-kinase phosphorylates the 4'-position of a tetraacyldisaccharide 1-phosphate precursor (DS-1-P) of lipid A, but the enzyme has not yet been purified because of instability [] | Back alignment and domain information |
|---|
| >KOG0635|consensus | Back alignment and domain information |
|---|
| >PF12846 AAA_10: AAA-like domain | Back alignment and domain information |
|---|
| >PLN03127 Elongation factor Tu; Provisional | Back alignment and domain information |
|---|
| >PRK01906 tetraacyldisaccharide 4'-kinase; Provisional | Back alignment and domain information |
|---|
| >PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] | Back alignment and domain information |
|---|
| >PRK08533 flagellar accessory protein FlaH; Reviewed | Back alignment and domain information |
|---|
| >cd03112 CobW_like The function of this protein family is unkown | Back alignment and domain information |
|---|
| >TIGR00455 apsK adenylylsulfate kinase (apsK) | Back alignment and domain information |
|---|
| >PRK06762 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK10218 GTP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01394 TypA_BipA GTP-binding protein TypA/BipA | Back alignment and domain information |
|---|
| >COG0468 RecA RecA/RadA recombinase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >COG2109 BtuR ATP:corrinoid adenosyltransferase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PHA02542 41 41 helicase; Provisional | Back alignment and domain information |
|---|
| >PRK13351 elongation factor G; Reviewed | Back alignment and domain information |
|---|
| >cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases | Back alignment and domain information |
|---|
| >PRK14527 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK05433 GTP-binding protein LepA; Provisional | Back alignment and domain information |
|---|
| >PTZ00035 Rad51 protein; Provisional | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >PRK06921 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06851 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway | Back alignment and domain information |
|---|
| >PRK06067 flagellar accessory protein FlaH; Validated | Back alignment and domain information |
|---|
| >PRK04301 radA DNA repair and recombination protein RadA; Validated | Back alignment and domain information |
|---|
| >PLN02924 thymidylate kinase | Back alignment and domain information |
|---|
| >KOG3347|consensus | Back alignment and domain information |
|---|
| >PRK07933 thymidylate kinase; Validated | Back alignment and domain information |
|---|
| >PRK00049 elongation factor Tu; Reviewed | Back alignment and domain information |
|---|
| >PRK06217 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK05439 pantothenate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK00089 era GTPase Era; Reviewed | Back alignment and domain information |
|---|
| >COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C | Back alignment and domain information |
|---|
| >PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C | Back alignment and domain information |
|---|
| >PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical | Back alignment and domain information |
|---|
| >COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >CHL00071 tufA elongation factor Tu | Back alignment and domain information |
|---|
| >TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family | Back alignment and domain information |
|---|
| >smart00053 DYNc Dynamin, GTPase | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >PRK06761 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family | Back alignment and domain information |
|---|
| >TIGR00708 cobA cob(I)alamin adenosyltransferase | Back alignment and domain information |
|---|
| >PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork | Back alignment and domain information |
|---|
| >PRK05380 pyrG CTP synthetase; Validated | Back alignment and domain information |
|---|
| >PRK05642 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family | Back alignment and domain information |
|---|
| >PTZ00301 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK00698 tmk thymidylate kinase; Validated | Back alignment and domain information |
|---|
| >COG0237 CoaE Dephospho-CoA kinase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >COG4240 Predicted kinase [General function prediction only] | Back alignment and domain information |
|---|
| >cd04165 GTPBP1_like GTPBP1-like | Back alignment and domain information |
|---|
| >PF13479 AAA_24: AAA domain | Back alignment and domain information |
|---|
| >PF05729 NACHT: NACHT domain | Back alignment and domain information |
|---|
| >PRK13947 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >PRK08116 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >PRK11537 putative GTP-binding protein YjiA; Provisional | Back alignment and domain information |
|---|
| >KOG3220|consensus | Back alignment and domain information |
|---|
| >TIGR00101 ureG urease accessory protein UreG | Back alignment and domain information |
|---|
| >PRK03731 aroL shikimate kinase II; Reviewed | Back alignment and domain information |
|---|
| >PRK09519 recA DNA recombination protein RecA; Reviewed | Back alignment and domain information |
|---|
| >PLN03186 DNA repair protein RAD51 homolog; Provisional | Back alignment and domain information |
|---|
| >PRK08903 DnaA regulatory inactivator Hda; Validated | Back alignment and domain information |
|---|
| >cd04167 Snu114p Snu114p subfamily | Back alignment and domain information |
|---|
| >PRK06547 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02475 CobW cobalamin biosynthesis protein CobW | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >KOG1534|consensus | Back alignment and domain information |
|---|
| >COG1435 Tdk Thymidine kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK12736 elongation factor Tu; Reviewed | Back alignment and domain information |
|---|
| >COG1159 Era GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2749|consensus | Back alignment and domain information |
|---|
| >PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A | Back alignment and domain information |
|---|
| >PRK13973 thymidylate kinase; Provisional | Back alignment and domain information |
|---|
| >COG1855 ATPase (PilT family) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00485 EF-Tu translation elongation factor TU | Back alignment and domain information |
|---|
| >PF01268 FTHFS: Formate--tetrahydrofolate ligase; InterPro: IPR000559 Formate--tetrahydrofolate ligase (6 | Back alignment and domain information |
|---|
| >TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily | Back alignment and domain information |
|---|
| >PF13521 AAA_28: AAA domain; PDB: 1LW7_A | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >PRK00131 aroK shikimate kinase; Reviewed | Back alignment and domain information |
|---|
| >PRK06851 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03575 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic | Back alignment and domain information |
|---|
| >PRK05595 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PTZ00141 elongation factor 1- alpha; Provisional | Back alignment and domain information |
|---|
| >PRK07261 topology modulation protein; Provisional | Back alignment and domain information |
|---|
| >PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins | Back alignment and domain information |
|---|
| >COG0504 PyrG CTP synthase (UTP-ammonia lyase) [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor | Back alignment and domain information |
|---|
| >PRK04328 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN03126 Elongation factor Tu; Provisional | Back alignment and domain information |
|---|
| >PRK08760 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily | Back alignment and domain information |
|---|
| >PLN03046 D-glycerate 3-kinase; Provisional | Back alignment and domain information |
|---|
| >PRK13949 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >COG1663 LpxK Tetraacyldisaccharide-1-P 4'-kinase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK12735 elongation factor Tu; Reviewed | Back alignment and domain information |
|---|
| >PRK01184 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN02796 D-glycerate 3-kinase | Back alignment and domain information |
|---|
| >PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >TIGR02239 recomb_RAD51 DNA repair protein RAD51 | Back alignment and domain information |
|---|
| >PRK08506 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PLN02327 CTP synthase | Back alignment and domain information |
|---|
| >PRK03839 putative kinase; Provisional | Back alignment and domain information |
|---|
| >PRK12338 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00665 DnaB replicative DNA helicase | Back alignment and domain information |
|---|
| >PF13173 AAA_14: AAA domain | Back alignment and domain information |
|---|
| >PRK14528 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14530 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PF01745 IPT: Isopentenyl transferase; InterPro: IPR002648 Isopentenyl transferase / dimethylallyl transferase synthesizes isopentenyladensosine 5'-monophosphate, a cytokinin that induces shoot formation on host plants infected with the Ti plasmid [] | Back alignment and domain information |
|---|
| >PRK06749 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK00081 coaE dephospho-CoA kinase; Reviewed | Back alignment and domain information |
|---|
| >PF08423 Rad51: Rad51; InterPro: IPR013632 This domain is found at the C terminus of the DNA repair and recombination protein Rad51 | Back alignment and domain information |
|---|
| >TIGR00337 PyrG CTP synthase | Back alignment and domain information |
|---|
| >COG4108 PrfC Peptide chain release factor RF-3 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG0125 Tmk Thymidylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >COG1160 Predicted GTPases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14531 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK08006 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK00300 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family | Back alignment and domain information |
|---|
| >PRK13507 formate--tetrahydrofolate ligase; Provisional | Back alignment and domain information |
|---|
| >cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) | Back alignment and domain information |
|---|
| >PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed | Back alignment and domain information |
|---|
| >PRK12339 2-phosphoglycerate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK02496 adk adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK10846 bifunctional folylpolyglutamate synthase/ dihydrofolate synthase; Provisional | Back alignment and domain information |
|---|
| >TIGR00436 era GTP-binding protein Era | Back alignment and domain information |
|---|
| >PRK05748 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >cd00046 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >PLN02759 Formate--tetrahydrofolate ligase | Back alignment and domain information |
|---|
| >PRK09165 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK13975 thymidylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK08840 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK07429 phosphoribulokinase; Provisional | Back alignment and domain information |
|---|
| >cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B | Back alignment and domain information |
|---|
| >PLN02200 adenylate kinase family protein | Back alignment and domain information |
|---|
| >PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >PRK13695 putative NTPase; Provisional | Back alignment and domain information |
|---|
| >PLN00043 elongation factor 1-alpha; Provisional | Back alignment and domain information |
|---|
| >PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function | Back alignment and domain information |
|---|
| >PRK12422 chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00554 panK_bact pantothenate kinase, bacterial type | Back alignment and domain information |
|---|
| >PRK06904 replicative DNA helicase; Validated | Back alignment and domain information |
|---|
| >PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A | Back alignment and domain information |
|---|
| >cd01125 repA Hexameric Replicative Helicase RepA | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >PRK05057 aroK shikimate kinase I; Reviewed | Back alignment and domain information |
|---|
| >COG0480 FusA Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF02223 Thymidylate_kin: Thymidylate kinase; InterPro: IPR018094 Thymidylate kinase (2 | Back alignment and domain information |
|---|
| >PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B | Back alignment and domain information |
|---|
| >cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) | Back alignment and domain information |
|---|
| >TIGR00376 DNA helicase, putative | Back alignment and domain information |
|---|
| >PRK09302 circadian clock protein KaiC; Reviewed | Back alignment and domain information |
|---|
| >PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) | Back alignment and domain information |
|---|
| >PRK06321 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PHA02530 pseT polynucleotide kinase; Provisional | Back alignment and domain information |
|---|
| >PRK04220 2-phosphoglycerate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR03754 conj_TOL_TraD conjugative coupling factor TraD, TOL family | Back alignment and domain information |
|---|
| >cd02026 PRK Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes | Back alignment and domain information |
|---|
| >cd02022 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2 | Back alignment and domain information |
|---|
| >PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways | Back alignment and domain information |
|---|
| >TIGR01618 phage_P_loop phage nucleotide-binding protein | Back alignment and domain information |
|---|
| >cd01131 PilT Pilus retraction ATPase PilT | Back alignment and domain information |
|---|
| >PRK13764 ATPase; Provisional | Back alignment and domain information |
|---|
| >PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated | Back alignment and domain information |
|---|
| >COG0370 FeoB Fe2+ transport system protein B [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1072 CoaA Panthothenate kinase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK00625 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PLN02165 adenylate isopentenyltransferase | Back alignment and domain information |
|---|
| >KOG2004|consensus | Back alignment and domain information |
|---|
| >PTZ00386 formyl tetrahydrofolate synthetase; Provisional | Back alignment and domain information |
|---|
| >TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX | Back alignment and domain information |
|---|
| >COG3911 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication | Back alignment and domain information |
|---|
| >cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) | Back alignment and domain information |
|---|
| >TIGR01393 lepA GTP-binding protein LepA | Back alignment and domain information |
|---|
| >cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily | Back alignment and domain information |
|---|
| >PRK05636 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein [] | Back alignment and domain information |
|---|
| >PRK00023 cmk cytidylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK07004 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK13946 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate | Back alignment and domain information |
|---|
| >PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] | Back alignment and domain information |
|---|
| >PRK04182 cytidylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00017 cmk cytidylate kinase | Back alignment and domain information |
|---|
| >PRK14730 coaE dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN | Back alignment and domain information |
|---|
| >TIGR02881 spore_V_K stage V sporulation protein K | Back alignment and domain information |
|---|
| >PF00265 TK: Thymidine kinase; InterPro: IPR001267 Thymidine kinase (TK) (2 | Back alignment and domain information |
|---|
| >KOG0991|consensus | Back alignment and domain information |
|---|
| >COG2019 AdkA Archaeal adenylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14734 coaE dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants | Back alignment and domain information |
|---|
| >PRK13948 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB | Back alignment and domain information |
|---|
| >COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK07560 elongation factor EF-2; Reviewed | Back alignment and domain information |
|---|
| >PTZ00088 adenylate kinase 1; Provisional | Back alignment and domain information |
|---|
| >KOG0744|consensus | Back alignment and domain information |
|---|
| >TIGR00362 DnaA chromosomal replication initiator protein DnaA | Back alignment and domain information |
|---|
| >cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) | Back alignment and domain information |
|---|
| >PF10412 TrwB_AAD_bind: Type IV secretion-system coupling protein DNA-binding domain; InterPro: IPR019476 The plasmid conjugative coupling protein TraD (also known as TrwB) is a basic integral inner-membrane nucleoside-triphosphate-binding protein | Back alignment and domain information |
|---|
| >PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional | Back alignment and domain information |
|---|
| >PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed | Back alignment and domain information |
|---|
| >PRK00149 dnaA chromosomal replication initiation protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family | Back alignment and domain information |
|---|
| >CHL00181 cbbX CbbX; Provisional | Back alignment and domain information |
|---|
| >PRK09302 circadian clock protein KaiC; Reviewed | Back alignment and domain information |
|---|
| >TIGR02173 cyt_kin_arch cytidylate kinase, putative | Back alignment and domain information |
|---|
| >COG2874 FlaH Predicted ATPases involved in biogenesis of archaeal flagella [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PLN02348 phosphoribulokinase | Back alignment and domain information |
|---|
| >TIGR03172 probable selenium-dependent hydroxylase accessory protein YqeC | Back alignment and domain information |
|---|
| >TIGR00150 HI0065_YjeE ATPase, YjeE family | Back alignment and domain information |
|---|
| >smart00763 AAA_PrkA PrkA AAA domain | Back alignment and domain information |
|---|
| >PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] | Back alignment and domain information |
|---|
| >TIGR03743 SXT_TraD conjugative coupling factor TraD, SXT/TOL subfamily | Back alignment and domain information |
|---|
| >COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >KOG3062|consensus | Back alignment and domain information |
|---|
| >PRK13976 thymidylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14532 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02746 TraC-F-type type-IV secretion system protein TraC | Back alignment and domain information |
|---|
| >PRK07414 cob(I)yrinic acid a,c-diamide adenosyltransferase; Validated | Back alignment and domain information |
|---|
| >COG2759 MIS1 Formyltetrahydrofolate synthetase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14088 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK14738 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >PF01580 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR002543 The FtsK/SpoIIIE domain is found extensively in a wide variety of proteins from prokaryotes and plasmids [] some of which contain up to three copies | Back alignment and domain information |
|---|
| >PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] | Back alignment and domain information |
|---|
| >PRK13700 conjugal transfer protein TraD; Provisional | Back alignment and domain information |
|---|
| >PRK14731 coaE dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >PRK12317 elongation factor 1-alpha; Reviewed | Back alignment and domain information |
|---|
| >PLN02422 dephospho-CoA kinase | Back alignment and domain information |
|---|
| >PRK00279 adk adenylate kinase; Reviewed | Back alignment and domain information |
|---|
| >PF01591 6PF2K: 6-phosphofructo-2-kinase; InterPro: IPR013079 6-Phosphofructo-2-kinase (2 | Back alignment and domain information |
|---|
| >PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01499 folC folylpolyglutamate synthase/dihydrofolate synthase | Back alignment and domain information |
|---|
| >COG0050 TufB GTPases - translation elongation factors [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK10536 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01085 murE UDP-N-acetylmuramyl-tripeptide synthetase | Back alignment and domain information |
|---|
| >PRK14733 coaE dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >COG2074 2-phosphoglycerate kinase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05416 glmZ(sRNA)-inactivating NTPase; Provisional | Back alignment and domain information |
|---|
| >TIGR01351 adk adenylate kinases | Back alignment and domain information |
|---|
| >TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN | Back alignment and domain information |
|---|
| >COG1110 Reverse gyrase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0462|consensus | Back alignment and domain information |
|---|
| >PRK08356 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN02674 adenylate kinase | Back alignment and domain information |
|---|
| >TIGR01420 pilT_fam pilus retraction protein PilT | Back alignment and domain information |
|---|
| >PRK12740 elongation factor G; Reviewed | Back alignment and domain information |
|---|
| >TIGR02836 spore_IV_A stage IV sporulation protein A | Back alignment and domain information |
|---|
| >PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA | Back alignment and domain information |
|---|
| >PRK00139 murE UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase; Provisional | Back alignment and domain information |
|---|
| >PRK13721 conjugal transfer ATP-binding protein TraC; Provisional | Back alignment and domain information |
|---|
| >cd01127 TrwB Bacterial conjugation protein TrwB, ATP binding domain | Back alignment and domain information |
|---|
| >PRK07773 replicative DNA helicase; Validated | Back alignment and domain information |
|---|
| >TIGR01650 PD_CobS cobaltochelatase, CobS subunit | Back alignment and domain information |
|---|
| >PLN02748 tRNA dimethylallyltransferase | Back alignment and domain information |
|---|
| >PRK01390 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >TIGR00929 VirB4_CagE type IV secretion/conjugal transfer ATPase, VirB4 family | Back alignment and domain information |
|---|
| >PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed | Back alignment and domain information |
|---|
| >TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10078 ribose 1,5-bisphosphokinase; Provisional | Back alignment and domain information |
|---|
| >TIGR03783 Bac_Flav_CT_G Bacteroides conjugation system ATPase, TraG family | Back alignment and domain information |
|---|
| >PLN02840 tRNA dimethylallyltransferase | Back alignment and domain information |
|---|
| >TIGR01448 recD_rel helicase, putative, RecD/TraA family | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 233 | ||||
| 1dts_A | 221 | Crystal Structure Of An Atp Dependent Carboxylase, | 5e-26 | ||
| 1dam_A | 224 | Dethiobiotin Synthetase Complexed With Dethiobiotin | 6e-26 | ||
| 3of5_A | 228 | Crystal Structure Of A Dethiobiotin Synthetase From | 7e-14 | ||
| 3mle_A | 242 | Crystal Structure Of Dethiobiotin Synthetase (Biod) | 6e-07 | ||
| 2qmo_A | 220 | Crystal Structure Of Dethiobiotin Synthetase (Biod) | 4e-04 |
| >pdb|1DTS|A Chain A, Crystal Structure Of An Atp Dependent Carboxylase, Dethiobiotin Synthase, At 1.65 Angstroms Resolution Length = 221 | Back alignment and structure |
|
| >pdb|1DAM|A Chain A, Dethiobiotin Synthetase Complexed With Dethiobiotin, Adp, Inorganic Phosphate And Magnesium Length = 224 | Back alignment and structure |
| >pdb|3OF5|A Chain A, Crystal Structure Of A Dethiobiotin Synthetase From Francisella Tularensis Subsp. Tularensis Schu S4 Length = 228 | Back alignment and structure |
| >pdb|3MLE|A Chain A, Crystal Structure Of Dethiobiotin Synthetase (Biod) From Helicobacter Pylori Cocrystallized With Atp Length = 242 | Back alignment and structure |
| >pdb|2QMO|A Chain A, Crystal Structure Of Dethiobiotin Synthetase (Biod) From Helicobacter Pylori Length = 220 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 233 | |||
| 1byi_A | 224 | Dethiobiotin synthase; biotin synthesis, cyclo-lig | 6e-71 | |
| 3of5_A | 228 | Dethiobiotin synthetase; structural genomics, cent | 3e-67 | |
| 3fgn_A | 251 | Dethiobiotin synthetase; biotin biosynthesis, BIOD | 2e-61 | |
| 3qxc_A | 242 | Dethiobiotin synthetase; DTBS, structural genomics | 2e-59 | |
| 4a0g_A | 831 | Adenosylmethionine-8-amino-7-oxononanoate aminotra | 3e-20 |
| >1byi_A Dethiobiotin synthase; biotin synthesis, cyclo-ligase, ligase; 0.97A {Escherichia coli} SCOP: c.37.1.10 PDB: 1bs1_A* 1a82_A 1dad_A* 1dae_A* 1daf_A* 1dag_A* 1dah_A* 1dai_A* 1dak_A* 1dam_A* 1dbs_A 1dts_A Length = 224 | Back alignment and structure |
|---|
Score = 215 bits (549), Expect = 6e-71
Identities = 82/226 (36%), Positives = 113/226 (50%), Gaps = 5/226 (2%)
Query: 8 HYFITGTNTNIGKTIISCALLSEFKKRGISCIGMKPIASGAYLNNKNKIWFNEDVNLLNK 67
YF+TGT+T +GKT+ SCALL K G G KP+ASG+ + N D L +
Sbjct: 3 RYFVTGTDTEVGKTVASCALLQAAKAAGYRTAGYKPVASGS--EKTPEGLRNSDALALQR 60
Query: 68 YSNSLYEFTKLINPYLFKYPISPYTSSNLENRIINTSHIINCYNYLSNLTDVIILEGIGG 127
S SL +NPY F P SP+ S E R I + + L D +++EG GG
Sbjct: 61 NS-SLQLDYATVNPYTFAEPTSPHIISAQEGRPIESLVMSAGLRALEQQADWVLVEGAGG 119
Query: 128 FSVPFHDNENSADLAEKLGLPIILVIDLKIGCINNALLSLEAINSRGLKLIGWVANHTQI 187
+ P D AD + LP+ILV+ +K+GCIN+A+L+ + I GL L GWVAN
Sbjct: 120 WFTPLSDTFTFADWVTQEQLPVILVVGVKLGCINHAMLTAQVIQHAGLTLAGWVANDVTP 179
Query: 188 VDTLFANENYIELTKYLNVTPLGRIPYLYNLNIN-LISHYLDFSSL 232
A E LT+ + LG IP+L N Y++ + L
Sbjct: 180 PGKRHA-EYMTTLTRMIPAPLLGEIPWLAENPENAATGKYINLALL 224
|
| >3of5_A Dethiobiotin synthetase; structural genomics, center for structural genomics of infec diseases, csgid, ligase; 1.52A {Francisella tularensis subsp} Length = 228 | Back alignment and structure |
|---|
| >3fgn_A Dethiobiotin synthetase; biotin biosynthesis, BIOD, ATP-BIND ligase, magnesium, nucleotide-binding; 1.85A {Mycobacterium tuberculosis} PDB: 3fmf_A* 3fmi_A* 3fpa_A* Length = 251 | Back alignment and structure |
|---|
| >3qxc_A Dethiobiotin synthetase; DTBS, structural genomics, ATP BIND biology, protein structure initiative, midwest center for S genomics, MCSG; HET: ATP; 1.34A {Helicobacter pylori} PDB: 3mle_A* 3qxh_A* 3qxj_A* 3qxs_A* 3qxx_A* 3qy0_A* 2qmo_A Length = 242 | Back alignment and structure |
|---|
| >4a0g_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; BIO3-BIO1, biotin synthesis; HET: PLP; 2.50A {Arabidopsis thaliana} PDB: 4a0h_A* 4a0r_A* 4a0f_A* Length = 831 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 233 | |||
| 3of5_A | 228 | Dethiobiotin synthetase; structural genomics, cent | 100.0 | |
| 1byi_A | 224 | Dethiobiotin synthase; biotin synthesis, cyclo-lig | 100.0 | |
| 3fgn_A | 251 | Dethiobiotin synthetase; biotin biosynthesis, BIOD | 100.0 | |
| 3qxc_A | 242 | Dethiobiotin synthetase; DTBS, structural genomics | 100.0 | |
| 4a0g_A | 831 | Adenosylmethionine-8-amino-7-oxononanoate aminotra | 99.95 | |
| 2ph1_A | 262 | Nucleotide-binding protein; alpha-beta protein, st | 99.92 | |
| 1g3q_A | 237 | MIND ATPase, cell division inhibitor; alpha-beta-a | 99.92 | |
| 3q9l_A | 260 | Septum site-determining protein MIND; ATPase, bact | 99.92 | |
| 4dzz_A | 206 | Plasmid partitioning protein PARF; deviant walker | 99.91 | |
| 1hyq_A | 263 | MIND, cell division inhibitor (MIND-1); MINC, FTSZ | 99.91 | |
| 3ea0_A | 245 | ATPase, para family; alpha-beta-alpha sandwich, st | 99.91 | |
| 1wcv_1 | 257 | SOJ, segregation protein; ATPase, bacterial, chrom | 99.91 | |
| 3k9g_A | 267 | PF-32 protein; ssgcid, SBRI, decode biostructures, | 99.9 | |
| 3bfv_A | 271 | CAPA1, CAPB2, membrane protein CAPA1, protein tyro | 99.89 | |
| 3la6_A | 286 | Tyrosine-protein kinase WZC; P-loop protein, nucle | 99.89 | |
| 3cio_A | 299 | ETK, tyrosine-protein kinase ETK; WZC, escherichia | 99.88 | |
| 2oze_A | 298 | ORF delta'; para, walker type atpases, DNA segrega | 99.88 | |
| 3end_A | 307 | Light-independent protochlorophyllide reductase ir | 99.87 | |
| 2afh_E | 289 | Nitrogenase iron protein 1; nitrogen fixation, iro | 99.87 | |
| 3cwq_A | 209 | Para family chromosome partitioning protein; alpha | 99.87 | |
| 1cp2_A | 269 | CP2, nitrogenase iron protein; oxidoreductase; 1.9 | 99.86 | |
| 3kjh_A | 254 | CO dehydrogenase/acetyl-COA synthase complex, acce | 99.86 | |
| 2xj4_A | 286 | MIPZ; replication, cell division, ATPase, WACA; 1. | 99.86 | |
| 3fwy_A | 314 | Light-independent protochlorophyllide reductase I | 99.86 | |
| 3ug7_A | 349 | Arsenical pump-driving ATPase; tail-anchored, memb | 99.85 | |
| 3zq6_A | 324 | Putative arsenical pump-driving ATPase; tail-ancho | 99.85 | |
| 3fkq_A | 373 | NTRC-like two-domain protein; RER070207001320, str | 99.82 | |
| 3ez2_A | 398 | Plasmid partition protein A; type IA, DNA binding, | 99.81 | |
| 3pg5_A | 361 | Uncharacterized protein; structural genomics, PSI- | 99.81 | |
| 3ez9_A | 403 | Para; DNA binding, winged-HTH, partition, biosynth | 99.8 | |
| 2woo_A | 329 | ATPase GET3; tail-anchored, membrane protein, targ | 99.78 | |
| 2woj_A | 354 | ATPase GET3; tail-anchored, membrane protein, targ | 99.77 | |
| 2obn_A | 349 | Hypothetical protein; structural genomics, joint c | 99.75 | |
| 3iqw_A | 334 | Tail-anchored protein targeting factor GET3; ATPas | 99.73 | |
| 1ihu_A | 589 | Arsenical pump-driving ATPase; aluminum fluoride, | 99.71 | |
| 3io3_A | 348 | DEHA2D07832P; chaperone, membrane traffic, ATPase; | 99.71 | |
| 1ihu_A | 589 | Arsenical pump-driving ATPase; aluminum fluoride, | 99.7 | |
| 2xxa_A | 433 | Signal recognition particle protein; protein trans | 99.63 | |
| 3igf_A | 374 | ALL4481 protein; two-domained protein consisting o | 99.62 | |
| 1zu4_A | 320 | FTSY; GTPase, signal recognition particle, SRP, re | 99.5 | |
| 3dm5_A | 443 | SRP54, signal recognition 54 kDa protein; protein- | 99.48 | |
| 1j8m_F | 297 | SRP54, signal recognition 54 kDa protein; signalin | 99.48 | |
| 2ffh_A | 425 | Protein (FFH); SRP54, signal recognition particle, | 99.46 | |
| 1ls1_A | 295 | Signal recognition particle protein; FFH, SRP54, S | 99.42 | |
| 2j37_W | 504 | Signal recognition particle 54 kDa protein (SRP54) | 99.38 | |
| 2v3c_C | 432 | SRP54, signal recognition 54 kDa protein; nucleoti | 99.34 | |
| 3kl4_A | 433 | SRP54, signal recognition 54 kDa protein; signal r | 99.29 | |
| 1vma_A | 306 | Cell division protein FTSY; TM0570, structural gen | 99.26 | |
| 2px0_A | 296 | Flagellar biosynthesis protein FLHF; SRP GTPase, f | 99.23 | |
| 1yrb_A | 262 | ATP(GTP)binding protein; GTPase, P-loop, rossman f | 99.13 | |
| 2g0t_A | 350 | Conserved hypothetical protein; structural genomic | 99.05 | |
| 2r8r_A | 228 | Sensor protein; KDPD, PFAM02702, MCSG, structural | 98.92 | |
| 3p32_A | 355 | Probable GTPase RV1496/MT1543; structural genomics | 98.74 | |
| 1xjc_A | 169 | MOBB protein homolog; structural genomics, midwest | 98.68 | |
| 3e70_C | 328 | DPA, signal recognition particle receptor; FTSY, S | 98.55 | |
| 2yhs_A | 503 | FTSY, cell division protein FTSY; cell cycle, prot | 98.44 | |
| 1s1m_A | 545 | CTP synthase; CTP synthetase, UTP:ammonia ligase ( | 98.4 | |
| 1vco_A | 550 | CTP synthetase; tetramer, riken structural genomic | 98.36 | |
| 3pzx_A | 557 | Formate--tetrahydrofolate ligase; HET: TOE; 2.20A | 98.11 | |
| 1np6_A | 174 | Molybdopterin-guanine dinucleotide biosynthesis pr | 98.11 | |
| 1u94_A | 356 | RECA protein, recombinase A; homologous recombinat | 97.9 | |
| 2p67_A | 341 | LAO/AO transport system kinase; ARGK, structural G | 97.87 | |
| 1xp8_A | 366 | RECA protein, recombinase A; recombination, radior | 97.75 | |
| 2cvh_A | 220 | DNA repair and recombination protein RADB; filamen | 97.73 | |
| 2rdo_7 | 704 | EF-G, elongation factor G; elongation factor G, EF | 97.61 | |
| 2zr9_A | 349 | Protein RECA, recombinase A; recombination, RECA m | 97.58 | |
| 1nks_A | 194 | Adenylate kinase; thermophilic, transferase; HET: | 97.49 | |
| 3hr8_A | 356 | Protein RECA; alpha and beta proteins (A/B, A+B), | 97.47 | |
| 3io5_A | 333 | Recombination and repair protein; storage dimer, i | 97.4 | |
| 3vqt_A | 548 | RF-3, peptide chain release factor 3; translation, | 97.38 | |
| 1xx6_A | 191 | Thymidine kinase; NESG, northeast structural genom | 97.37 | |
| 2b8t_A | 223 | Thymidine kinase; deoxyribonucleoside kinase, zinc | 97.33 | |
| 2f1r_A | 171 | Molybdopterin-guanine dinucleotide biosynthesis pr | 97.32 | |
| 2yvu_A | 186 | Probable adenylyl-sulfate kinase; transferase, str | 97.31 | |
| 3a4m_A | 260 | L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m | 97.27 | |
| 1nn5_A | 215 | Similar to deoxythymidylate kinase (thymidylate K; | 97.26 | |
| 2orw_A | 184 | Thymidine kinase; TMTK, TP4A, transferase; HET: 4T | 97.26 | |
| 3uie_A | 200 | Adenylyl-sulfate kinase 1, chloroplastic; rossmann | 97.09 | |
| 1g5t_A | 196 | COB(I)alamin adenosyltransferase; P-loop protein, | 97.08 | |
| 1dar_A | 691 | EF-G, elongation factor G; ribosomal translocase, | 97.06 | |
| 1qf9_A | 194 | UMP/CMP kinase, protein (uridylmonophosphate/cytid | 97.03 | |
| 2wwf_A | 212 | Thymidilate kinase, putative; transferase, malaria | 96.97 | |
| 2j9r_A | 214 | Thymidine kinase; TK1, DNK, lasso, transferase, AT | 96.97 | |
| 1v5w_A | 343 | DMC1, meiotic recombination protein DMC1/LIM15 hom | 96.97 | |
| 2pbr_A | 195 | DTMP kinase, thymidylate kinase; transferase, nucl | 96.95 | |
| 4fn5_A | 709 | EF-G 1, elongation factor G 1; translation, transl | 96.95 | |
| 3tr5_A | 528 | RF-3, peptide chain release factor 3; protein synt | 96.94 | |
| 3trf_A | 185 | Shikimate kinase, SK; amino acid biosynthesis, tra | 96.92 | |
| 2plr_A | 213 | DTMP kinase, probable thymidylate kinase; TMP-bind | 96.91 | |
| 1kht_A | 192 | Adenylate kinase; phosphotransferase, signaling pr | 96.91 | |
| 2z0h_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 96.91 | |
| 2dr3_A | 247 | UPF0273 protein PH0284; RECA superfamily ATPase, h | 96.9 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 96.88 | |
| 2pez_A | 179 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 96.88 | |
| 2h5e_A | 529 | Peptide chain release factor RF-3; beta barrel, tr | 96.87 | |
| 1a7j_A | 290 | Phosphoribulokinase; transferase, calvin cycle; 2. | 96.87 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 96.87 | |
| 1rj9_A | 304 | FTSY, signal recognition protein; SRP-GTPase domai | 96.84 | |
| 3iev_A | 308 | GTP-binding protein ERA; ERA, GTPase, KH domain, a | 96.83 | |
| 1rz3_A | 201 | Hypothetical protein rbstp0775; MCSG, structural g | 96.8 | |
| 1e6c_A | 173 | Shikimate kinase; phosphoryl transfer, ADP, shikim | 96.77 | |
| 3lda_A | 400 | DNA repair protein RAD51; DNA binding protein, ATP | 96.74 | |
| 1via_A | 175 | Shikimate kinase; structural genomics, transferase | 96.73 | |
| 3bh0_A | 315 | DNAB-like replicative helicase; ATPase, replicatio | 96.69 | |
| 1uj2_A | 252 | Uridine-cytidine kinase 2; alpha/beta mononucleoti | 96.68 | |
| 3kb2_A | 173 | SPBC2 prophage-derived uncharacterized protein YOR | 96.67 | |
| 3t61_A | 202 | Gluconokinase; PSI-biology, structural genomics, p | 96.67 | |
| 3bgw_A | 444 | DNAB-like replicative helicase; ATPase, replicatio | 96.67 | |
| 1m7g_A | 211 | Adenylylsulfate kinase; APS kinase, transferase, s | 96.66 | |
| 3j25_A | 638 | Tetracycline resistance protein TETM; antibiotic r | 96.65 | |
| 3ld9_A | 223 | DTMP kinase, thymidylate kinase; ssgcid, NIH, niai | 96.65 | |
| 3b9q_A | 302 | Chloroplast SRP receptor homolog, alpha subunit CP | 96.65 | |
| 1gtv_A | 214 | TMK, thymidylate kinase; transferase, transferase | 96.64 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 96.63 | |
| 4a1f_A | 338 | DNAB helicase, replicative DNA helicase; hydrolase | 96.59 | |
| 2orv_A | 234 | Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 | 96.59 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 96.58 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 96.56 | |
| 2xex_A | 693 | Elongation factor G; GTPase, translation, biosynth | 96.56 | |
| 2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 96.55 | |
| 2v54_A | 204 | DTMP kinase, thymidylate kinase; nucleotide biosyn | 96.54 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 96.53 | |
| 1zuh_A | 168 | Shikimate kinase; alpha-beta protein, transferase; | 96.52 | |
| 1cke_A | 227 | CK, MSSA, protein (cytidine monophosphate kinase); | 96.52 | |
| 2c5m_A | 294 | CTP synthase; cytidine 5-prime triphosphate synthe | 96.5 | |
| 2if2_A | 204 | Dephospho-COA kinase; alpha-beta protein, structur | 96.5 | |
| 2og2_A | 359 | Putative signal recognition particle receptor; nuc | 96.49 | |
| 2wsm_A | 221 | Hydrogenase expression/formation protein (HYPB); m | 96.47 | |
| 2iyv_A | 184 | Shikimate kinase, SK; transferase, aromatic amino | 96.39 | |
| 1w4r_A | 195 | Thymidine kinase; type II, human, cytosolic, phosp | 96.37 | |
| 3vaa_A | 199 | Shikimate kinase, SK; structural genomics, center | 96.35 | |
| 1cr0_A | 296 | DNA primase/helicase; RECA-type protein fold, tran | 96.34 | |
| 4edh_A | 213 | DTMP kinase, thymidylate kinase; structural genomi | 96.31 | |
| 2rhm_A | 193 | Putative kinase; P-loop containing nucleoside trip | 96.3 | |
| 1qhx_A | 178 | CPT, protein (chloramphenicol phosphotransferase); | 96.28 | |
| 2c78_A | 405 | Elongation factor TU-A; hydrolase, GTPase, transla | 96.27 | |
| 1ukz_A | 203 | Uridylate kinase; transferase; HET: ADP AMP; 1.90A | 96.25 | |
| 4eun_A | 200 | Thermoresistant glucokinase; putative sugar kinase | 96.23 | |
| 3nva_A | 535 | CTP synthase; rossman fold, nucleotide binding, LI | 96.22 | |
| 2c95_A | 196 | Adenylate kinase 1; transferase, AP4A, nucleotide | 96.22 | |
| 1uf9_A | 203 | TT1252 protein; P-loop, nucleotide binding domain, | 96.2 | |
| 1kag_A | 173 | SKI, shikimate kinase I; transferase, structural g | 96.19 | |
| 3c8u_A | 208 | Fructokinase; YP_612366.1, putative fructose trans | 96.17 | |
| 1jjv_A | 206 | Dephospho-COA kinase; P-loop nucleotide-binding fo | 96.15 | |
| 1y63_A | 184 | LMAJ004144AAA protein; structural genomics, protei | 96.15 | |
| 2q6t_A | 444 | DNAB replication FORK helicase; hydrolase; 2.90A { | 96.14 | |
| 2ze6_A | 253 | Isopentenyl transferase; crown GALL tumor, cytokin | 96.12 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 96.12 | |
| 2zts_A | 251 | Putative uncharacterized protein PH0186; KAIC like | 96.11 | |
| 2r6a_A | 454 | DNAB helicase, replicative helicase; replication, | 96.11 | |
| 3do6_A | 543 | Formate--tetrahydrofolate ligase; TM1766, putative | 96.11 | |
| 3iij_A | 180 | Coilin-interacting nuclear ATPase protein; alpha a | 96.1 | |
| 2ywe_A | 600 | GTP-binding protein LEPA; G domain, beta-barrel, f | 96.1 | |
| 3e2i_A | 219 | Thymidine kinase; Zn-binding, ATP-binding, DNA syn | 96.06 | |
| 2bwj_A | 199 | Adenylate kinase 5; phosphoryl transfer reaction, | 96.01 | |
| 1knq_A | 175 | Gluconate kinase; ALFA/beta structure, transferase | 96.01 | |
| 3hjn_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 96.01 | |
| 3asz_A | 211 | Uridine kinase; cytidine phosphorylation, transfer | 96.0 | |
| 3be4_A | 217 | Adenylate kinase; malaria, cryptosporidium parvum | 96.0 | |
| 3lv8_A | 236 | DTMP kinase, thymidylate kinase; structural genomi | 95.98 | |
| 3lw7_A | 179 | Adenylate kinase related protein (ADKA-like); AMP, | 95.98 | |
| 2gks_A | 546 | Bifunctional SAT/APS kinase; transferase, sulfuryl | 95.98 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 95.95 | |
| 4hlc_A | 205 | DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri | 95.94 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 95.94 | |
| 3e1s_A | 574 | Exodeoxyribonuclease V, subunit RECD; alpha and be | 95.93 | |
| 3v9p_A | 227 | DTMP kinase, thymidylate kinase; ssgcid, STRU geno | 95.92 | |
| 1m8p_A | 573 | Sulfate adenylyltransferase; rossmann fold, phosph | 95.91 | |
| 1ly1_A | 181 | Polynucleotide kinase; PNK, phosphatase, transfera | 95.9 | |
| 3cm0_A | 186 | Adenylate kinase; ATP-binding, cytoplasm, nucleoti | 95.89 | |
| 4tmk_A | 213 | Protein (thymidylate kinase); ATP:DTMP phosphotran | 95.87 | |
| 2r2a_A | 199 | Uncharacterized protein; zonular occludens toxin, | 95.85 | |
| 1x6v_B | 630 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 95.83 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 95.82 | |
| 4eaq_A | 229 | DTMP kinase, thymidylate kinase; structural genomi | 95.81 | |
| 2hf9_A | 226 | Probable hydrogenase nickel incorporation protein | 95.81 | |
| 3crm_A | 323 | TRNA delta(2)-isopentenylpyrophosphate transferase | 95.8 | |
| 3ake_A | 208 | Cytidylate kinase; CMP kinase, CMP complex, open c | 95.8 | |
| 1tev_A | 196 | UMP-CMP kinase; ploop, NMP binding region, LID reg | 95.79 | |
| 1odf_A | 290 | YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser | 95.79 | |
| 1q57_A | 503 | DNA primase/helicase; dntpase, DNA replication, tr | 95.78 | |
| 1aky_A | 220 | Adenylate kinase; ATP:AMP phosphotransferase, myok | 95.75 | |
| 1zak_A | 222 | Adenylate kinase; ATP:AMP-phosphotransferase, tran | 95.75 | |
| 2vli_A | 183 | Antibiotic resistance protein; transferase, tunica | 95.71 | |
| 2z43_A | 324 | DNA repair and recombination protein RADA; archaea | 95.7 | |
| 3umf_A | 217 | Adenylate kinase; rossmann fold, transferase; 2.05 | 95.67 | |
| 3d3q_A | 340 | TRNA delta(2)-isopentenylpyrophosphate transferase | 95.66 | |
| 1zd8_A | 227 | GTP:AMP phosphotransferase mitochondrial; ATP:AMP | 95.59 | |
| 1nij_A | 318 | Hypothetical protein YJIA; structural genomics, P- | 95.55 | |
| 2www_A | 349 | Methylmalonic aciduria type A protein, mitochondri | 95.54 | |
| 2cdn_A | 201 | Adenylate kinase; phosphoryl transfer, associative | 95.53 | |
| 1nlf_A | 279 | Regulatory protein REPA; replicative DNA helicase | 95.49 | |
| 2dy1_A | 665 | Elongation factor G; translocation, GTP complex, s | 95.46 | |
| 1w78_A | 422 | FOLC bifunctional protein; DHFS, dihydrofolate syn | 95.45 | |
| 2jaq_A | 205 | Deoxyguanosine kinase; transferase, deoxyribonucle | 95.45 | |
| 3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 95.44 | |
| 2grj_A | 192 | Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp | 95.43 | |
| 3r20_A | 233 | Cytidylate kinase; structural genomics, seattle st | 95.42 | |
| 2f6r_A | 281 | COA synthase, bifunctional coenzyme A synthase; 18 | 95.4 | |
| 2vhj_A | 331 | Ntpase P4, P4; non- hydrolysable ATP analogue, hyd | 95.39 | |
| 2axn_A | 520 | 6-phosphofructo-2-kinase/fructose-2,6- biphosphata | 95.38 | |
| 3tqc_A | 321 | Pantothenate kinase; biosynthesis of cofactors, pr | 95.36 | |
| 1ak2_A | 233 | Adenylate kinase isoenzyme-2; nucleoside monophosp | 95.35 | |
| 2pt5_A | 168 | Shikimate kinase, SK; aromatic amino acid biosynth | 95.28 | |
| 1jbw_A | 428 | Folylpolyglutamate synthase; FPGS folate AMPPCP te | 95.23 | |
| 4e22_A | 252 | Cytidylate kinase; P-loop, CMP/ATP binding, transf | 95.2 | |
| 3nrs_A | 437 | Dihydrofolate:folylpolyglutamate synthetase; struc | 95.2 | |
| 4b3f_X | 646 | DNA-binding protein smubp-2; hydrolase, helicase; | 95.2 | |
| 3tau_A | 208 | Guanylate kinase, GMP kinase; structural genomics, | 95.18 | |
| 4ag6_A | 392 | VIRB4 ATPase, type IV secretory pathway VIRB4 comp | 95.17 | |
| 3tlx_A | 243 | Adenylate kinase 2; structural genomics, structura | 95.17 | |
| 1d2e_A | 397 | Elongation factor TU (EF-TU); G-protein, beta-barr | 95.15 | |
| 1n0w_A | 243 | DNA repair protein RAD51 homolog 1; DNA repair, ho | 95.15 | |
| 2bbw_A | 246 | Adenylate kinase 4, AK4; nucleotide kinase, nucleo | 95.14 | |
| 4fcw_A | 311 | Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 | 95.11 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 95.09 | |
| 2qby_B | 384 | CDC6 homolog 3, cell division control protein 6 ho | 95.08 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 95.08 | |
| 2j41_A | 207 | Guanylate kinase; GMP, GMK, transferase, ATP-bindi | 95.07 | |
| 3upu_A | 459 | ATP-dependent DNA helicase DDA; RECA-like domain, | 95.05 | |
| 3cmw_A | 1706 | Protein RECA, recombinase A; homologous recombinat | 95.04 | |
| 3fb4_A | 216 | Adenylate kinase; psychrophIle, phosphotransferase | 95.03 | |
| 1e4v_A | 214 | Adenylate kinase; transferase(phosphotransferase); | 95.01 | |
| 2qt1_A | 207 | Nicotinamide riboside kinase 1; non-protein kinase | 94.98 | |
| 2ehv_A | 251 | Hypothetical protein PH0186; KAIC, RECA ATPase, un | 94.97 | |
| 1vht_A | 218 | Dephospho-COA kinase; structural genomics, transfe | 94.92 | |
| 1sq5_A | 308 | Pantothenate kinase; P-loop, transferase; HET: PAU | 94.88 | |
| 3a8t_A | 339 | Adenylate isopentenyltransferase; rossmann fold pr | 94.85 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 94.85 | |
| 1g8f_A | 511 | Sulfate adenylyltransferase; alpha-beta protein, b | 94.83 | |
| 1o5z_A | 442 | Folylpolyglutamate synthase/dihydrofolate synthas; | 94.82 | |
| 2qor_A | 204 | Guanylate kinase; phosphotransferase, purine metab | 94.81 | |
| 2vos_A | 487 | Folylpolyglutamate synthase protein FOLC; ligase, | 94.8 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 94.79 | |
| 1e9r_A | 437 | Conjugal transfer protein TRWB; coupling protein, | 94.75 | |
| 1zp6_A | 191 | Hypothetical protein ATU3015; alpha-beta protein., | 94.72 | |
| 3eag_A | 326 | UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME | 94.7 | |
| 3dl0_A | 216 | Adenylate kinase; phosphotransferase, zinc coordin | 94.66 | |
| 2xb4_A | 223 | Adenylate kinase; ATP-binding, nucleotide-binding, | 94.64 | |
| 1gvn_B | 287 | Zeta; postsegregational killing system, plasmid; 1 | 94.61 | |
| 1g7s_A | 594 | Translation initiation factor IF2/EIF5B; translati | 94.59 | |
| 1e8c_A | 498 | UDP-N-acetylmuramoylalanyl-D-glutamate--2,6- diami | 94.58 | |
| 2qm8_A | 337 | GTPase/ATPase; G protein, G3E, metallochaperone, c | 94.57 | |
| 2i1q_A | 322 | DNA repair and recombination protein RADA; ATPase, | 94.53 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 94.51 | |
| 2p5t_B | 253 | PEZT; postsegregational killing system, phosphoryl | 94.5 | |
| 1kgd_A | 180 | CASK, peripheral plasma membrane CASK; maguk, guan | 94.49 | |
| 3aez_A | 312 | Pantothenate kinase; transferase, homodimer, COA b | 94.49 | |
| 3hdt_A | 223 | Putative kinase; structura genomics, PSI-2, protei | 94.46 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 94.44 | |
| 2jeo_A | 245 | Uridine-cytidine kinase 1; UCK, transferase, ATP-b | 94.43 | |
| 3tr0_A | 205 | Guanylate kinase, GMP kinase; purines, pyrimidines | 94.42 | |
| 2wtz_A | 535 | UDP-N-acetylmuramoyl-L-alanyl-D-glutamate- -2,6-di | 94.41 | |
| 3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 94.4 | |
| 3exa_A | 322 | TRNA delta(2)-isopentenylpyrophosphate transferase | 94.38 | |
| 3cmw_A | 1706 | Protein RECA, recombinase A; homologous recombinat | 94.35 | |
| 4a74_A | 231 | DNA repair and recombination protein RADA; hydrola | 94.27 | |
| 2bdt_A | 189 | BH3686; alpha-beta protein, structural genomics, P | 94.27 | |
| 1pzn_A | 349 | RAD51, DNA repair and recombination protein RAD51, | 94.26 | |
| 3ch4_B | 202 | Pmkase, phosphomevalonate kinase; parallel beta-sh | 94.23 | |
| 1c9k_A | 180 | COBU, adenosylcobinamide kinase; alpha/beta struct | 94.2 | |
| 3nwj_A | 250 | ATSK2; P loop, shikimate, nucleoside monophosphate | 94.14 | |
| 1w36_D | 608 | RECD, exodeoxyribonuclease V alpha chain; recombin | 94.06 | |
| 2eyu_A | 261 | Twitching motility protein PILT; pilus retraction | 94.06 | |
| 3tmk_A | 216 | Thymidylate kinase; phosphotransferase; HET: T5A; | 94.02 | |
| 3eph_A | 409 | TRNA isopentenyltransferase; transferase, alternat | 93.95 | |
| 1ltq_A | 301 | Polynucleotide kinase; phosphatase, alpha/beta, P- | 93.9 | |
| 2i3b_A | 189 | HCR-ntpase, human cancer-related ntpase; AAA, ross | 93.87 | |
| 2bjv_A | 265 | PSP operon transcriptional activator; AAA, transcr | 93.86 | |
| 3sr0_A | 206 | Adenylate kinase; phosphoryl transfer analogue, AL | 93.83 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 93.83 | |
| 2gk6_A | 624 | Regulator of nonsense transcripts 1; UPF1, helicas | 93.81 | |
| 3foz_A | 316 | TRNA delta(2)-isopentenylpyrophosphate transferas; | 93.75 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 93.73 | |
| 1q3t_A | 236 | Cytidylate kinase; nucleotide monophosphate kinase | 93.72 | |
| 1ofh_A | 310 | ATP-dependent HSL protease ATP-binding subunit HSL | 93.67 | |
| 1tue_A | 212 | Replication protein E1; helicase, replication, E1E | 93.66 | |
| 2ewv_A | 372 | Twitching motility protein PILT; pilus retraction | 93.64 | |
| 4ehx_A | 315 | Tetraacyldisaccharide 4'-kinase; membrane protein, | 93.62 | |
| 1j6u_A | 469 | UDP-N-acetylmuramate-alanine ligase MURC; structur | 93.6 | |
| 3a00_A | 186 | Guanylate kinase, GMP kinase; domain movement, dim | 93.48 | |
| 1lvg_A | 198 | Guanylate kinase, GMP kinase; transferase; HET: AD | 93.44 | |
| 1ye8_A | 178 | Protein THEP1, hypothetical UPF0334 kinase-like pr | 93.34 | |
| 3tqf_A | 181 | HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co | 93.31 | |
| 2x5o_A | 439 | UDP-N-acetylmuramoylalanine--D-glutamate ligase; A | 93.22 | |
| 3hn7_A | 524 | UDP-N-acetylmuramate-L-alanine ligase; ATP-binding | 93.21 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 93.19 | |
| 2a5y_B | 549 | CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis | 93.18 | |
| 2wjy_A | 800 | Regulator of nonsense transcripts 1; nonsense medi | 93.17 | |
| 3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 93.14 | |
| 2ocp_A | 241 | DGK, deoxyguanosine kinase; protein-nucleotide com | 93.13 | |
| 1p5z_B | 263 | DCK, deoxycytidine kinase; nucleoside kinase, P-lo | 93.13 | |
| 3ney_A | 197 | 55 kDa erythrocyte membrane protein; structural ge | 93.09 | |
| 3fdi_A | 201 | Uncharacterized protein; cytidylate kinase like pr | 93.09 | |
| 1bif_A | 469 | 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; | 93.09 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 93.08 | |
| 3lk7_A | 451 | UDP-N-acetylmuramoylalanine--D-glutamate ligase; a | 93.04 | |
| 3cr8_A | 552 | Sulfate adenylyltranferase, adenylylsulfate kinase | 92.95 | |
| 1xwi_A | 322 | SKD1 protein; VPS4B, AAA ATPase, protein transport | 92.95 | |
| 2vo1_A | 295 | CTP synthase 1; pyrimidine biosynthesis, glutamine | 92.93 | |
| 1w5s_A | 412 | Origin recognition complex subunit 2 ORC2; replica | 92.93 | |
| 1sxj_A | 516 | Activator 1 95 kDa subunit; clamp loader, processi | 92.91 | |
| 1um8_A | 376 | ATP-dependent CLP protease ATP-binding subunit CL; | 92.89 | |
| 2qmh_A | 205 | HPR kinase/phosphorylase; V267F mutation, ATP-bind | 92.87 | |
| 1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 92.77 | |
| 2h92_A | 219 | Cytidylate kinase; rossmann fold, transferase; HET | 92.7 | |
| 3lnc_A | 231 | Guanylate kinase, GMP kinase; ALS collaborative cr | 92.66 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 92.54 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 92.54 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 92.29 | |
| 2dyk_A | 161 | GTP-binding protein; GTPase, ribosome-binding prot | 92.27 | |
| 3pxg_A | 468 | Negative regulator of genetic competence CLPC/MEC; | 92.14 | |
| 3hws_A | 363 | ATP-dependent CLP protease ATP-binding subunit CL; | 92.05 | |
| 1ex7_A | 186 | Guanylate kinase; substrate-induced FIT, domain mo | 92.04 | |
| 2xzl_A | 802 | ATP-dependent helicase NAM7; hydrolase-RNA complex | 92.03 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 91.98 | |
| 2qp9_X | 355 | Vacuolar protein sorting-associated protein 4; ATP | 91.98 | |
| 1p9r_A | 418 | General secretion pathway protein E; bacterial typ | 91.96 | |
| 3uk6_A | 368 | RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding | 91.96 | |
| 3zvl_A | 416 | Bifunctional polynucleotide phosphatase/kinase; hy | 91.86 | |
| 3eie_A | 322 | Vacuolar protein sorting-associated protein 4; AAA | 91.84 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 91.78 | |
| 1in4_A | 334 | RUVB, holliday junction DNA helicase RUVB; AAA+-cl | 91.78 | |
| 1znw_A | 207 | Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans | 91.76 | |
| 3d8b_A | 357 | Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s | 91.74 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 91.68 | |
| 1z6g_A | 218 | Guanylate kinase; structural genomics, SGC, struct | 91.67 | |
| 3avx_A | 1289 | Elongation factor TS, elongation factor TU, linke | 91.64 | |
| 2v9p_A | 305 | Replication protein E1; AAA+ molecular motor, DNA | 91.54 | |
| 1htw_A | 158 | HI0065; nucleotide-binding fold, structural genomi | 91.42 | |
| 4hv4_A | 494 | UDP-N-acetylmuramate--L-alanine ligase; MURC, yers | 91.39 | |
| 1dek_A | 241 | Deoxynucleoside monophosphate kinase; transferase, | 91.39 | |
| 4b4t_L | 437 | 26S protease subunit RPT4; hydrolase, AAA-atpases, | 91.26 | |
| 4i1u_A | 210 | Dephospho-COA kinase; structural genomics, niaid, | 91.24 | |
| 1s96_A | 219 | Guanylate kinase, GMP kinase; E.coli, dimer, SAD, | 90.96 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 90.94 | |
| 1ojl_A | 304 | Transcriptional regulatory protein ZRAR; response | 90.92 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 90.88 | |
| 2vp4_A | 230 | Deoxynucleoside kinase; ATP-binding, DNA synthesis | 90.79 | |
| 4b4t_K | 428 | 26S protease regulatory subunit 6B homolog; hydrol | 90.75 | |
| 3gmt_A | 230 | Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle | 90.66 | |
| 1hqc_A | 324 | RUVB; extended AAA-ATPase domain, complex with nuc | 90.63 | |
| 1z6t_A | 591 | APAF-1, apoptotic protease activating factor 1; ca | 90.61 | |
| 2zan_A | 444 | Vacuolar protein sorting-associating protein 4B; S | 90.56 | |
| 2r62_A | 268 | Cell division protease FTSH homolog; ATPase domain | 90.41 | |
| 3pfi_A | 338 | Holliday junction ATP-dependent DNA helicase RUVB; | 90.4 | |
| 1p3d_A | 475 | UDP-N-acetylmuramate--alanine ligase; alpha/beta p | 90.37 | |
| 2ga8_A | 359 | Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn | 90.36 | |
| 2c9o_A | 456 | RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- | 90.3 | |
| 3t5g_A | 181 | GTP-binding protein RHEB; immunoglobulin-like beta | 90.18 | |
| 2f9l_A | 199 | RAB11B, member RAS oncogene family; RAB11B GTPase, | 90.15 | |
| 4b4t_M | 434 | 26S protease regulatory subunit 6A; hydrolase, AAA | 90.11 | |
| 1sxj_C | 340 | Activator 1 40 kDa subunit; clamp loader, processi | 90.06 | |
| 1osn_A | 341 | Thymidine kinase, VZV-TK; chickenpox, BVDU-MP, tra | 90.04 | |
| 3clv_A | 208 | RAB5 protein, putative; malaria, GTPase, structura | 90.02 | |
| 4gp7_A | 171 | Metallophosphoesterase; polynucleotide kinase phos | 89.99 | |
| 2fna_A | 357 | Conserved hypothetical protein; structural genomic | 89.97 | |
| 2f00_A | 491 | UDP-N-acetylmuramate--L-alanine ligase; amide bond | 89.95 | |
| 3iby_A | 256 | Ferrous iron transport protein B; G protein, G dom | 89.81 | |
| 4b4t_J | 405 | 26S protease regulatory subunit 8 homolog; hydrola | 89.72 | |
| 3lfu_A | 647 | DNA helicase II; SF1 helicase, ATP-binding, DNA da | 89.63 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 89.62 | |
| 3ice_A | 422 | Transcription termination factor RHO; transcriptio | 89.6 | |
| 1iqp_A | 327 | RFCS; clamp loader, extended AAA-ATPase domain, co | 89.58 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 89.52 | |
| 1of1_A | 376 | Thymidine kinase; transferase, antiviral drug, enz | 89.52 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 89.49 | |
| 2gza_A | 361 | Type IV secretion system protein VIRB11; ATPase, h | 89.44 | |
| 2npi_A | 460 | Protein CLP1; CLP1-PCF11 complex, ATP binding, ter | 89.39 | |
| 1e2k_A | 331 | Thymidine kinase; transferase, antiviral drug, enz | 89.3 | |
| 2lkc_A | 178 | Translation initiation factor IF-2; NMR {Geobacill | 89.27 | |
| 3r6d_A | 221 | NAD-dependent epimerase/dehydratase; structural ge | 89.25 | |
| 3bs4_A | 260 | Uncharacterized protein PH0321; structural genomic | 89.25 | |
| 3u61_B | 324 | DNA polymerase accessory protein 44; AAA+, ATP hyd | 89.22 | |
| 1gg4_A | 452 | UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6- diamino | 89.18 | |
| 1sxj_D | 353 | Activator 1 41 kDa subunit; clamp loader, processi | 89.17 | |
| 1f0k_A | 364 | MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pe | 89.16 | |
| 1jr3_A | 373 | DNA polymerase III subunit gamma; processivity, pr | 89.11 | |
| 2d1y_A | 256 | Hypothetical protein TT0321; strucrtural genomics, | 89.11 | |
| 1svm_A | 377 | Large T antigen; AAA+ fold, viral protein; HET: AT | 88.98 | |
| 2ce2_X | 166 | GTPase HRAS; signaling protein, guanine nucleotide | 88.98 | |
| 1upt_A | 171 | ARL1, ADP-ribosylation factor-like protein 1; hydr | 88.92 | |
| 3bwd_D | 182 | RAC-like GTP-binding protein ARAC6; G domain, cyto | 88.89 | |
| 1sxj_E | 354 | Activator 1 40 kDa subunit; clamp loader, processi | 88.86 | |
| 1sxj_B | 323 | Activator 1 37 kDa subunit; clamp loader, processi | 88.79 | |
| 3orf_A | 251 | Dihydropteridine reductase; alpha-beta-alpha sandw | 88.74 | |
| 4b4t_H | 467 | 26S protease regulatory subunit 7 homolog; hydrola | 88.73 | |
| 2chq_A | 319 | Replication factor C small subunit; DNA-binding pr | 88.62 | |
| 1svi_A | 195 | GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro | 88.55 | |
| 2atv_A | 196 | RERG, RAS-like estrogen-regulated growth inhibitor | 88.54 | |
| 3v8b_A | 283 | Putative dehydrogenase, possibly 3-oxoacyl-[acyl- | 88.52 | |
| 2iwr_A | 178 | Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi | 88.47 | |
| 3m6a_A | 543 | ATP-dependent protease LA 1; alpha, beta, ATP-bind | 88.43 | |
| 3pvs_A | 447 | Replication-associated recombination protein A; ma | 88.29 | |
| 1g41_A | 444 | Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep | 88.26 | |
| 3guy_A | 230 | Short-chain dehydrogenase/reductase SDR; structura | 88.18 | |
| 3uce_A | 223 | Dehydrogenase; rossmann fold, oxidoreductase; HET: | 88.14 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 88.14 | |
| 1lw7_A | 365 | Transcriptional regulator NADR; NMN, NMN adenylyl | 88.04 | |
| 2oap_1 | 511 | GSPE-2, type II secretion system protein; hexameri | 88.02 | |
| 3con_A | 190 | GTPase NRAS; structural genomics consortium, SGC, | 88.01 | |
| 2pt7_A | 330 | CAG-ALFA; ATPase, protein-protein complex, type IV | 88.0 | |
| 2ce2_X | 166 | GTPase HRAS; signaling protein, guanine nucleotide | 87.95 | |
| 3oes_A | 201 | GTPase rhebl1; small GTPase, structural genomics, | 87.94 | |
| 3tpc_A | 257 | Short chain alcohol dehydrogenase-related dehydro; | 87.94 | |
| 1ky3_A | 182 | GTP-binding protein YPT7P; vesicular traffic, GTP | 87.86 | |
| 1a5t_A | 334 | Delta prime, HOLB; zinc finger, DNA replication; 2 | 87.82 | |
| 4e6p_A | 259 | Probable sorbitol dehydrogenase (L-iditol 2-dehyd; | 87.82 | |
| 3pxx_A | 287 | Carveol dehydrogenase; structural genomics, seattl | 87.81 | |
| 2r44_A | 331 | Uncharacterized protein; putative ATPase, structur | 87.72 | |
| 3un1_A | 260 | Probable oxidoreductase; structural genomics, PSI- | 87.67 | |
| 2elf_A | 370 | Protein translation elongation factor 1A; tRNA, py | 87.64 | |
| 3ioy_A | 319 | Short-chain dehydrogenase/reductase SDR; structura | 87.62 | |
| 4b4t_I | 437 | 26S protease regulatory subunit 4 homolog; hydrola | 87.62 | |
| 2fn4_A | 181 | P23, RAS-related protein R-RAS; GDP/GTP binding, G | 87.55 | |
| 3v2h_A | 281 | D-beta-hydroxybutyrate dehydrogenase; structural g | 87.5 | |
| 2fv8_A | 207 | H6, RHO-related GTP-binding protein RHOB; GDP/GTP | 87.43 | |
| 2wsb_A | 254 | Galactitol dehydrogenase; oxidoreductase, SDR, ros | 87.36 | |
| 3s55_A | 281 | Putative short-chain dehydrogenase/reductase; stru | 87.31 | |
| 1z2a_A | 168 | RAS-related protein RAB-23; RAB GTPase, vesicular | 87.28 | |
| 3vfd_A | 389 | Spastin; ATPase, microtubule severing, hydrolase; | 87.28 | |
| 3gem_A | 260 | Short chain dehydrogenase; structural genomics, AP | 87.26 | |
| 3pk0_A | 262 | Short-chain dehydrogenase/reductase SDR; ssgcid, s | 87.22 | |
| 1nrj_B | 218 | SR-beta, signal recognition particle receptor beta | 87.2 | |
| 3pqc_A | 195 | Probable GTP-binding protein ENGB; rossmann fold, | 87.14 | |
| 3ged_A | 247 | Short-chain dehydrogenase/reductase SDR; SCOR, ros | 87.13 | |
| 2wjg_A | 188 | FEOB, ferrous iron transport protein B homolog; me | 87.11 | |
| 3kta_A | 182 | Chromosome segregation protein SMC; structural mai | 87.1 | |
| 1p6x_A | 334 | Thymidine kinase; P-loop, LID, transferase; HET: T | 87.07 | |
| 3op4_A | 248 | 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto | 87.02 | |
| 3k53_A | 271 | Ferrous iron transport protein B; GTPase fold, hel | 86.98 | |
| 3co5_A | 143 | Putative two-component system transcriptional RES | 86.96 | |
| 3hu3_A | 489 | Transitional endoplasmic reticulum ATPase; VCP, tr | 86.89 | |
| 2wji_A | 165 | Ferrous iron transport protein B homolog; membrane | 86.82 | |
| 1knx_A | 312 | Probable HPR(Ser) kinase/phosphatase; HPR kinase, | 86.81 | |
| 2onk_A | 240 | Molybdate/tungstate ABC transporter, ATP-binding p | 86.75 | |
| 4fs3_A | 256 | Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; | 86.65 | |
| 2ged_A | 193 | SR-beta, signal recognition particle receptor beta | 86.63 | |
| 1fjh_A | 257 | 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc | 86.62 | |
| 2rhc_B | 277 | Actinorhodin polyketide ketoreductase; oxidoreduct | 86.57 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 86.5 | |
| 2v6i_A | 431 | RNA helicase; membrane, hydrolase, transmembrane, | 86.44 | |
| 3rih_A | 293 | Short chain dehydrogenase or reductase; structural | 86.42 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 86.41 | |
| 3b6e_A | 216 | Interferon-induced helicase C domain-containing P; | 86.33 | |
| 1u8z_A | 168 | RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH | 86.31 | |
| 4da9_A | 280 | Short-chain dehydrogenase/reductase; structural ge | 86.26 | |
| 2j0v_A | 212 | RAC-like GTP-binding protein ARAC7; nucleotide-bin | 86.26 | |
| 4eso_A | 255 | Putative oxidoreductase; NADP, structural genomics | 86.23 | |
| 2ehd_A | 234 | Oxidoreductase, oxidoreductase, short-chain dehydr | 86.22 | |
| 3grp_A | 266 | 3-oxoacyl-(acyl carrierprotein) reductase; structu | 86.22 | |
| 3dii_A | 247 | Short-chain dehydrogenase/reductase SDR; SCOR, ros | 86.2 | |
| 1zmt_A | 254 | Haloalcohol dehalogenase HHEC; halohydrin dehaloge | 86.05 | |
| 3tif_A | 235 | Uncharacterized ABC transporter ATP-binding prote; | 86.02 | |
| 2cxx_A | 190 | Probable GTP-binding protein ENGB; structural geno | 85.98 | |
| 1u0j_A | 267 | DNA replication protein; AAA+ protein, P-loop atpa | 85.93 | |
| 3ppi_A | 281 | 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de | 85.77 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 85.75 | |
| 1oix_A | 191 | RAS-related protein RAB-11A; small G protein, intr | 85.74 | |
| 2dkn_A | 255 | 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta | 85.67 | |
| 1kao_A | 167 | RAP2A; GTP-binding protein, small G protein, GDP, | 85.66 | |
| 3sop_A | 270 | Neuronal-specific septin-3; hydrolase; HET: GDP; 2 | 85.64 | |
| 2pcj_A | 224 | ABC transporter, lipoprotein-releasing system ATP- | 85.63 | |
| 2cbz_A | 237 | Multidrug resistance-associated protein 1; ABC pro | 85.59 | |
| 3d3w_A | 244 | L-xylulose reductase; uronate cycle, short-chain d | 85.55 | |
| 2iut_A | 574 | DNA translocase FTSK; nucleotide-binding, chromoso | 85.55 | |
| 2erx_A | 172 | GTP-binding protein DI-RAS2; GTP hydrolysis, trans | 85.54 | |
| 2qen_A | 350 | Walker-type ATPase; unknown function; HET: ADP; 2. | 85.53 | |
| 3rkr_A | 262 | Short chain oxidoreductase; rossmann fold; HET: NA | 85.52 | |
| 1rif_A | 282 | DAR protein, DNA helicase UVSW; bacteriophage, REC | 85.51 | |
| 3l77_A | 235 | Short-chain alcohol dehydrogenase; oxidoreductase; | 85.48 | |
| 2fz4_A | 237 | DNA repair protein RAD25; RECA-like domain, DNA da | 85.43 | |
| 3rd5_A | 291 | Mypaa.01249.C; ssgcid, structural genomics, seattl | 85.43 | |
| 3m1a_A | 281 | Putative dehydrogenase; short, PSI, MCSG, structur | 85.37 | |
| 1xhl_A | 297 | Short-chain dehydrogenase/reductase family member | 85.34 | |
| 1mv5_A | 243 | LMRA, multidrug resistance ABC transporter ATP-bin | 85.32 | |
| 3pgx_A | 280 | Carveol dehydrogenase; structural genomics, seattl | 85.32 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 85.31 | |
| 2am1_A | 454 | SP protein, UDP-N-acetylmuramoylalanine-D-glutamyl | 85.31 | |
| 1z0f_A | 179 | RAB14, member RAS oncogene family; RAB GTPase, ves | 85.31 | |
| 1g8p_A | 350 | Magnesium-chelatase 38 kDa subunit; parallel beta | 85.3 | |
| 3qq5_A | 423 | Small GTP-binding protein; hydrogenase, H-cluster, | 85.28 | |
| 3sjy_A | 403 | Translation initiation factor 2 subunit gamma; zin | 85.28 | |
| 3uxy_A | 266 | Short-chain dehydrogenase/reductase SDR; structura | 85.21 | |
| 3b85_A | 208 | Phosphate starvation-inducible protein; PHOH2, ATP | 85.2 | |
| 2ius_A | 512 | DNA translocase FTSK; nucleotide-binding, chromoso | 85.19 | |
| 1zbd_A | 203 | Rabphilin-3A; G protein, effector, RABCDR, synapti | 85.14 | |
| 2ag5_A | 246 | DHRS6, dehydrogenase/reductase (SDR family) member | 85.12 | |
| 2va8_A | 715 | SSO2462, SKI2-type helicase; hydrolase, DNA repair | 85.1 | |
| 3rwb_A | 247 | TPLDH, pyridoxal 4-dehydrogenase; short chain dehy | 85.09 | |
| 3i4f_A | 264 | 3-oxoacyl-[acyl-carrier protein] reductase; struct | 85.08 | |
| 1zcb_A | 362 | G alpha I/13; GTP-binding, lipoprotein, membrane, | 85.05 | |
| 2qu8_A | 228 | Putative nucleolar GTP-binding protein 1; GTPase, | 84.99 | |
| 1m2o_B | 190 | GTP-binding protein SAR1, GTP binding protein; zin | 84.97 | |
| 2ce7_A | 476 | Cell division protein FTSH; metalloprotease; HET: | 84.96 | |
| 2d2e_A | 250 | SUFC protein; ABC-ATPase, SUF protein, 310-helix, | 84.96 | |
| 1b0u_A | 262 | Histidine permease; ABC transporter, transport pro | 84.88 | |
| 1ko7_A | 314 | HPR kinase/phosphatase; protein kinase, phosphotra | 84.86 | |
| 3h1t_A | 590 | Type I site-specific restriction-modification syst | 84.83 | |
| 1spx_A | 278 | Short-chain reductase family member (5L265); paral | 84.82 |
| >3of5_A Dethiobiotin synthetase; structural genomics, center for structural genomics of infec diseases, csgid, ligase; 1.52A {Francisella tularensis subsp} | Back alignment and structure |
|---|
Probab=100.00 E-value=6.3e-39 Score=258.14 Aligned_cols=214 Identities=25% Similarity=0.455 Sum_probs=184.8
Q ss_pred CceeEEEEeCCCCCcHHHHHHHHHHHHHHcCCeeeEEeeeecCcccCCCCCCccchHHHHHHHHhCCCcccccceeeeee
Q psy14904 5 NFLHYFITGTNTNIGKTIISCALLSEFKKRGISCIGMKPIASGAYLNNKNKIWFNEDVNLLNKYSNSLYEFTKLINPYLF 84 (233)
Q Consensus 5 ~~~~i~i~~~kggvGKTt~a~~La~~l~~~G~~Vl~~dp~~~~~~~~~~~~~l~~~d~~~~~~~~~~~~~~~~~~~~~~~ 84 (233)
+||.|+|+|+.+|+|||++|++|+++|+++|++|.++||++++++..+ +++.+.|..+ ..++...++ +.++++.+
T Consensus 3 ~mk~i~Itgt~t~vGKT~vt~~L~~~l~~~G~~V~~~KPv~~g~~~~~--~~~~~~D~~~--~~~~~~~~~-~~~~~~~~ 77 (228)
T 3of5_A 3 AMKKFFIIGTDTEVGKTYISTKLIEVCEHQNIKSLCLKPVASGQSQFS--ELCEDVESIL--NAYKHKFTA-AEINLISF 77 (228)
T ss_dssp TCEEEEEEESSSSSCHHHHHHHHHHHHHHTTCCEEEECSEEESBCSSS--SSBHHHHHHH--HHTTTSSCH-HHHCSEEE
T ss_pred CCcEEEEEeCCCCCCHHHHHHHHHHHHHHCCCeeEEecceeecCccCC--CCCChHHHHH--HhcCCCCCh-hhEEEEEE
Confidence 479999999999999999999999999999999999999999887654 4554456654 566765444 45678999
Q ss_pred cCCCChhhhhhhcCCCCCHHHHHHHHHH-hhcCCCeEEEeccCcccCccCCCCchHHHHHHhCCCEEEEEcCCCCcHHHH
Q psy14904 85 KYPISPYTSSNLENRIINTSHIINCYNY-LSNLTDVIILEGIGGFSVPFHDNENSADLAEKLGLPIILVIDLKIGCINNA 163 (233)
Q Consensus 85 ~~~~~~~~~~~~~~~~~~~~~l~~~~~~-l~~~~D~vlID~~~g~~~p~~~~~~~~~l~~~~~~~vllV~~~~~~~~~~~ 163 (233)
..|.+|+.++.+++.....+++.+.+++ ++++||+|||||++|+.+|+....+++++++.+++|+++|++.+.++++++
T Consensus 78 ~~p~sp~~aa~~~~~~i~~~~i~~~~~~~l~~~~D~vlIEgaggl~~p~~~~~~~adla~~l~~pviLV~~~~~~~i~~~ 157 (228)
T 3of5_A 78 NQAVAPHIIAAKTKVDISIENLKQFIEDKYNQDLDILFIEGAGGLLTPYSDHTTQLDLIKALQIPVLLVSAIKVGCINHT 157 (228)
T ss_dssp SSSSCHHHHHHHTTCCCCHHHHHHHHHGGGGSSCSEEEEEEEEETTCBSSSSCBHHHHHHHHTCCEEEEEECSTTHHHHH
T ss_pred CCCCCHHHHHHHcCCCCCHHHHHHHHHHHHHccCCEEEEECCCccccccccchhHHHHHHHcCCCEEEEEcCCcchHHHH
Confidence 9999999998888887788999999999 999999999999999999988888999999999999999999999999999
Q ss_pred HHHHHHHHhCCCcEEEEEEcccCCCchhhhhhhHHHHHhhcCCCceEecCCCCCCChhhhhhhcCC
Q psy14904 164 LLSLEAINSRGLKLIGWVANHTQIVDTLFANENYIELTKYLNVTPLGRIPYLYNLNINLISHYLDF 229 (233)
Q Consensus 164 ~~~~~~l~~~~~~i~GiVlN~~~~~~~~~~~~~~~~l~~~~~~pvlg~IP~~~~l~~~~~~~~~~~ 229 (233)
..+++.+++.++++.|+|+|+++ ++...++.+.+.+++.+|+|++|+|| ...+++.|++.
T Consensus 158 ~~~~~~l~~~~~~i~GvIlN~~~-~~~~~~~~~~~~l~~~~g~pvLG~iP-----~~~~~~~~~~~ 217 (228)
T 3of5_A 158 LLTINELNRHNIKLAGWIANCND-SNIKYIDEQINTIEELSGYKCSAKIS-----RNADYLDFIDL 217 (228)
T ss_dssp HHHHHHHHHTTCCEEEEEEEECC-TTCSCHHHHHHHHHHHHSCCCSEEEE-----SSCCHHHHHHH
T ss_pred HHHHHHHHhCCCcEEEEEEECcC-CcchhhHHHHHHHHHhhCCCEEEECC-----CchHhhhhcCH
Confidence 99999999999999999999998 65444567888999989999999999 23445666554
|
| >1byi_A Dethiobiotin synthase; biotin synthesis, cyclo-ligase, ligase; 0.97A {Escherichia coli} SCOP: c.37.1.10 PDB: 1bs1_A* 1a82_A 1dad_A* 1dae_A* 1daf_A* 1dag_A* 1dah_A* 1dai_A* 1dak_A* 1dam_A* 1dbs_A 1dts_A | Back alignment and structure |
|---|
| >3fgn_A Dethiobiotin synthetase; biotin biosynthesis, BIOD, ATP-BIND ligase, magnesium, nucleotide-binding; 1.85A {Mycobacterium tuberculosis} PDB: 3fmf_A* 3fmi_A* 3fpa_A* | Back alignment and structure |
|---|
| >3qxc_A Dethiobiotin synthetase; DTBS, structural genomics, ATP BIND biology, protein structure initiative, midwest center for S genomics, MCSG; HET: ATP; 1.34A {Helicobacter pylori} PDB: 3mle_A* 3qxh_A* 3qxj_A* 3qxs_A* 3qxx_A* 3qy0_A* 2qmo_A | Back alignment and structure |
|---|
| >4a0g_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; BIO3-BIO1, biotin synthesis; HET: PLP; 2.50A {Arabidopsis thaliana} PDB: 4a0h_A* 4a0r_A* 4a0f_A* | Back alignment and structure |
|---|
| >2ph1_A Nucleotide-binding protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Archaeoglobus fulgidus dsm 4304} PDB: 3kb1_A* | Back alignment and structure |
|---|
| >1g3q_A MIND ATPase, cell division inhibitor; alpha-beta-alpha layered, protein-ADP complex, cell cycle, hydrolase; HET: ADP; 2.00A {Pyrococcus furiosus} SCOP: c.37.1.10 PDB: 1g3r_A* 1ion_A* | Back alignment and structure |
|---|
| >3q9l_A Septum site-determining protein MIND; ATPase, bacterial cell division inhibitor, MINC, MINE, cell hydrolase; HET: ATP; 2.34A {Escherichia coli} PDB: 3r9i_A* 3r9j_A* | Back alignment and structure |
|---|
| >4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* | Back alignment and structure |
|---|
| >1hyq_A MIND, cell division inhibitor (MIND-1); MINC, FTSZ, bacterial cell division, cell cycle; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >3ea0_A ATPase, para family; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: ATP; 2.20A {Chlorobium tepidum} | Back alignment and structure |
|---|
| >1wcv_1 SOJ, segregation protein; ATPase, bacterial, chromosome segregation; 1.6A {Thermus thermophilus} PDB: 2bej_A* 2bek_A* | Back alignment and structure |
|---|
| >3k9g_A PF-32 protein; ssgcid, SBRI, decode biostructures, UW, NIH, niaid, borellia burgdorferi, plasmid partition protein, iodide; 2.25A {Borrelia burgdorferi} PDB: 3k9h_A | Back alignment and structure |
|---|
| >3bfv_A CAPA1, CAPB2, membrane protein CAPA1, protein tyrosine kinase; chimerical protein, P-loop protein, capsule biogenesis/degradation; HET: ADP; 1.80A {Staphylococcus aureus} PDB: 2ved_A* | Back alignment and structure |
|---|
| >3la6_A Tyrosine-protein kinase WZC; P-loop protein, nucleotide binding domain, walker A motif, B protein kinase, oligomerization; HET: ADP; 3.20A {Escherichia coli} | Back alignment and structure |
|---|
| >3cio_A ETK, tyrosine-protein kinase ETK; WZC, escherichia coli tyrosine kinase domain, signaling protein, transferase, inner membrane, membrane; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >2oze_A ORF delta'; para, walker type atpases, DNA segregation, PSM19035, plasmid, DNA binding protein; HET: AGS EPE; 1.83A {Streptococcus pyogenes} | Back alignment and structure |
|---|
| >2afh_E Nitrogenase iron protein 1; nitrogen fixation, iron-sulfur, metal-binding, molybdenum, oxidoreductase; HET: HCA CFN CLF PGE PG4 P6G 1PE; 2.10A {Azotobacter vinelandii} SCOP: c.37.1.10 PDB: 1g1m_A 1g5p_A 1m1y_E* 1m34_E* 1n2c_E* 1nip_A* 1fp6_A* 2afi_E* 2afk_E* 2nip_A 1de0_A 1xcp_A* 1xdb_A 1xd8_A 1xd9_A* 1g20_E* 1g21_E* 2c8v_A* 1rw4_A | Back alignment and structure |
|---|
| >3cwq_A Para family chromosome partitioning protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: ADP; 2.47A {Synechocystis SP} | Back alignment and structure |
|---|
| >1cp2_A CP2, nitrogenase iron protein; oxidoreductase; 1.93A {Clostridium pasteurianum} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >3kjh_A CO dehydrogenase/acetyl-COA synthase complex, accessory protein COOC; Zn-bound dimer, nickel binding protein, ATPase; 1.90A {Carboxydothermus hydrogenoformans} PDB: 3kjg_A* 3kje_A 3kji_A* | Back alignment and structure |
|---|
| >2xj4_A MIPZ; replication, cell division, ATPase, WACA; 1.60A {Caulobacter vibrioides} PDB: 2xj9_A* 2xit_A | Back alignment and structure |
|---|
| >3fwy_A Light-independent protochlorophyllide reductase I ATP-binding protein; BCHL, electron donor, DPOR, Fe protein, nitrogenase; HET: ADP; 1.63A {Rhodobacter sphaeroides 2} | Back alignment and structure |
|---|
| >3ug7_A Arsenical pump-driving ATPase; tail-anchored, membrane protein, targeting factor, ATP-bindi TRC40, ARSA, nucleotide-binding; HET: ADP; 2.90A {Methanocaldococcus jannaschii} PDB: 3ug6_A* | Back alignment and structure |
|---|
| >3zq6_A Putative arsenical pump-driving ATPase; tail-anchored, membrane protein; HET: ADP; 2.11A {Methanothermobacter thermautotrophicusorganism_taxid} | Back alignment and structure |
|---|
| >3fkq_A NTRC-like two-domain protein; RER070207001320, structural GE joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: ATP 2PE; 2.10A {Eubacterium rectale} | Back alignment and structure |
|---|
| >3ez2_A Plasmid partition protein A; type IA, DNA binding, winged-HTH, DNA bindin; HET: ADP EPE; 2.05A {Escherichia coli} PDB: 3ez6_A* 3ez7_A | Back alignment and structure |
|---|
| >3pg5_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 3.30A {Corynebacterium diphtheriae} | Back alignment and structure |
|---|
| >3ez9_A Para; DNA binding, winged-HTH, partition, biosynthetic protein; 2.80A {Salmonella enterica subsp} PDB: 3ezf_A | Back alignment and structure |
|---|
| >2woo_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; 3.01A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2woj_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; HET: ADP; 1.99A {Saccharomyces cerevisiae} PDB: 3h84_A 3zs8_A 3zs9_A* 3sja_A 3sjb_A 3sjc_A 3sjd_A* 3idq_A 3a36_A 3a37_A* | Back alignment and structure |
|---|
| >2obn_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, unknown function; HET: PG4; 2.30A {Anabaena variabilis} | Back alignment and structure |
|---|
| >3iqw_A Tail-anchored protein targeting factor GET3; ATPase, Zn binding, protein transport; HET: ANP; 3.00A {Chaetomium thermophilum} PDB: 3iqx_A* 3ibg_A* | Back alignment and structure |
|---|
| >1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* | Back alignment and structure |
|---|
| >3io3_A DEHA2D07832P; chaperone, membrane traffic, ATPase; HET: ADP; 1.80A {Debaryomyces hansenii} | Back alignment and structure |
|---|
| >1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* | Back alignment and structure |
|---|
| >2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 | Back alignment and structure |
|---|
| >3igf_A ALL4481 protein; two-domained protein consisting of the N-terminal alpha-beta the C-terminal all beta domain., structural genomics; 2.00A {Nostoc SP} | Back alignment and structure |
|---|
| >1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A | Back alignment and structure |
|---|
| >3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F | Back alignment and structure |
|---|
| >2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A | Back alignment and structure |
|---|
| >1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* | Back alignment and structure |
|---|
| >2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A | Back alignment and structure |
|---|
| >2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B | Back alignment and structure |
|---|
| >3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A | Back alignment and structure |
|---|
| >1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 | Back alignment and structure |
|---|
| >2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* | Back alignment and structure |
|---|
| >1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* | Back alignment and structure |
|---|
| >2g0t_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.67A {Thermotoga maritima} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* | Back alignment and structure |
|---|
| >1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* | Back alignment and structure |
|---|
| >2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A | Back alignment and structure |
|---|
| >1s1m_A CTP synthase; CTP synthetase, UTP:ammonia ligase (ADP-forming), cytidine 5 triphosphate synthase, ammonia lyase; 2.30A {Escherichia coli} SCOP: c.23.16.1 c.37.1.10 PDB: 2ad5_A* | Back alignment and structure |
|---|
| >1vco_A CTP synthetase; tetramer, riken structural genomics/proteomics initiative, RSGI, structural genomics, ligase; HET: GLN; 2.15A {Thermus thermophilus} SCOP: c.23.16.1 c.37.1.10 PDB: 1vcn_A 1vcm_A | Back alignment and structure |
|---|
| >1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A | Back alignment and structure |
|---|
| >1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A | Back alignment and structure |
|---|
| >2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 | Back alignment and structure |
|---|
| >2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* | Back alignment and structure |
|---|
| >2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H | Back alignment and structure |
|---|
| >2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... | Back alignment and structure |
|---|
| >1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >3vqt_A RF-3, peptide chain release factor 3; translation, GTPase; HET: GDP; 1.80A {Desulfovibrio vulgaris} PDB: 3vr1_A* | Back alignment and structure |
|---|
| >1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 | Back alignment and structure |
|---|
| >2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* | Back alignment and structure |
|---|
| >2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* | Back alignment and structure |
|---|
| >1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* | Back alignment and structure |
|---|
| >2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* | Back alignment and structure |
|---|
| >3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* | Back alignment and structure |
|---|
| >1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* | Back alignment and structure |
|---|
| >1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... | Back alignment and structure |
|---|
| >1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* | Back alignment and structure |
|---|
| >2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* | Back alignment and structure |
|---|
| >2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* | Back alignment and structure |
|---|
| >1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A | Back alignment and structure |
|---|
| >2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >4fn5_A EF-G 1, elongation factor G 1; translation, translation-antibiotic compl; HET: 0UO; 2.90A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A | Back alignment and structure |
|---|
| >2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* | Back alignment and structure |
|---|
| >2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* | Back alignment and structure |
|---|
| >1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* | Back alignment and structure |
|---|
| >3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* | Back alignment and structure |
|---|
| >1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* | Back alignment and structure |
|---|
| >3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* | Back alignment and structure |
|---|
| >1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* | Back alignment and structure |
|---|
| >3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* | Back alignment and structure |
|---|
| >3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* | Back alignment and structure |
|---|
| >3j25_A Tetracycline resistance protein TETM; antibiotic resistance, translation; HET: GCP; 7.20A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} | Back alignment and structure |
|---|
| >3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} | Back alignment and structure |
|---|
| >2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* | Back alignment and structure |
|---|
| >1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* | Back alignment and structure |
|---|
| >2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* | Back alignment and structure |
|---|
| >1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* | Back alignment and structure |
|---|
| >3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* | Back alignment and structure |
|---|
| >4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* | Back alignment and structure |
|---|
| >2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} | Back alignment and structure |
|---|
| >1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* | Back alignment and structure |
|---|
| >2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... | Back alignment and structure |
|---|
| >1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* | Back alignment and structure |
|---|
| >4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} | Back alignment and structure |
|---|
| >3nva_A CTP synthase; rossman fold, nucleotide binding, LIG; 2.50A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A | Back alignment and structure |
|---|
| >1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} | Back alignment and structure |
|---|
| >1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} | Back alignment and structure |
|---|
| >2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A | Back alignment and structure |
|---|
| >3do6_A Formate--tetrahydrofolate ligase; TM1766, putative formyltetrahydrofolate synthetase, structural genomics; HET: MSE; 1.85A {Thermotoga maritima} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A | Back alignment and structure |
|---|
| >2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* | Back alignment and structure |
|---|
| >3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* | Back alignment and structure |
|---|
| >3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* | Back alignment and structure |
|---|
| >3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* | Back alignment and structure |
|---|
| >3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A | Back alignment and structure |
|---|
| >2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} | Back alignment and structure |
|---|
| >4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* | Back alignment and structure |
|---|
| >3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* | Back alignment and structure |
|---|
| >1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* | Back alignment and structure |
|---|
| >2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A | Back alignment and structure |
|---|
| >2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* | Back alignment and structure |
|---|
| >3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A | Back alignment and structure |
|---|
| >3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* | Back alignment and structure |
|---|
| >1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 | Back alignment and structure |
|---|
| >1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* | Back alignment and structure |
|---|
| >1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 | Back alignment and structure |
|---|
| >2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* | Back alignment and structure |
|---|
| >3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} | Back alignment and structure |
|---|
| >3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} | Back alignment and structure |
|---|
| >1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* | Back alignment and structure |
|---|
| >1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 | Back alignment and structure |
|---|
| >2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} | Back alignment and structure |
|---|
| >2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A | Back alignment and structure |
|---|
| >1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A | Back alignment and structure |
|---|
| >2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* | Back alignment and structure |
|---|
| >1w78_A FOLC bifunctional protein; DHFS, dihydrofolate synthase, synthase, ATP-binding, folate biosynthesis, ligase, multifunctional enzyme; HET: KCX PD8 ADP; 1.82A {Escherichia coli} PDB: 1w7k_A* | Back alignment and structure |
|---|
| >2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* | Back alignment and structure |
|---|
| >2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* | Back alignment and structure |
|---|
| >2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* | Back alignment and structure |
|---|
| >2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* | Back alignment and structure |
|---|
| >3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* | Back alignment and structure |
|---|
| >2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1jbw_A Folylpolyglutamate synthase; FPGS folate AMPPCP ternary complex, ligase; HET: KCX ACQ TMF; 1.85A {Lactobacillus casei} SCOP: c.59.1.2 c.72.2.2 PDB: 1fgs_A* 1jbv_A* 2gca_A 2gc5_A* 2gc6_A* 2gcb_A | Back alignment and structure |
|---|
| >4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} | Back alignment and structure |
|---|
| >3nrs_A Dihydrofolate:folylpolyglutamate synthetase; structural genomics, center for structural genomics of infec diseases, csgid; HET: TLA MES; 1.80A {Yersinia pestis} PDB: 3n2a_A* 3pyz_A* 3qcz_A* | Back alignment and structure |
|---|
| >4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A | Back alignment and structure |
|---|
| >3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A | Back alignment and structure |
|---|
| >3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* | Back alignment and structure |
|---|
| >1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A | Back alignment and structure |
|---|
| >4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* | Back alignment and structure |
|---|
| >3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} | Back alignment and structure |
|---|
| >1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* | Back alignment and structure |
|---|
| >2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* | Back alignment and structure |
|---|
| >1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A | Back alignment and structure |
|---|
| >1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* | Back alignment and structure |
|---|
| >3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* | Back alignment and structure |
|---|
| >1o5z_A Folylpolyglutamate synthase/dihydrofolate synthas; TM0166, structural genomics, JC protein structure initiative; 2.10A {Thermotoga maritima} SCOP: c.59.1.2 c.72.2.2 | Back alignment and structure |
|---|
| >2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} | Back alignment and structure |
|---|
| >2vos_A Folylpolyglutamate synthase protein FOLC; ligase, peptidoglycan synthesis, cell division; HET: ADP; 2.0A {Mycobacterium tuberculosis} PDB: 2vor_A* | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A* | Back alignment and structure |
|---|
| >1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* | Back alignment and structure |
|---|
| >2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* | Back alignment and structure |
|---|
| >1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* | Back alignment and structure |
|---|
| >1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* | Back alignment and structure |
|---|
| >1e8c_A UDP-N-acetylmuramoylalanyl-D-glutamate--2,6- diaminopimelate ligase; peptidoglycan biosynthesis; HET: KCX UAG API; 2.00A {Escherichia coli} SCOP: c.98.1.1 c.59.1.1 c.72.2.1 | Back alignment and structure |
|---|
| >2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* | Back alignment and structure |
|---|
| >2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* | Back alignment and structure |
|---|
| >3hdt_A Putative kinase; structura genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.79A {Clostridium symbiosum atcc 14940} | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* | Back alignment and structure |
|---|
| >3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2wtz_A UDP-N-acetylmuramoyl-L-alanyl-D-glutamate- -2,6-diaminopimelate ligase; nucleotide-binding, peptidoglycan synthesis, MURE, C shape; HET: KCX UAG; 3.00A {Mycobacterium tuberculosis} PDB: 2xja_A* | Back alignment and structure |
|---|
| >3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A | Back alignment and structure |
|---|
| >3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* | Back alignment and structure |
|---|
| >4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* | Back alignment and structure |
|---|
| >2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 | Back alignment and structure |
|---|
| >3ch4_B Pmkase, phosphomevalonate kinase; parallel beta-sheet with the strand order 23145, walker A motif, cholesterol biosynthesis, lipid synthesis; 1.76A {Homo sapiens} | Back alignment and structure |
|---|
| >1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A | Back alignment and structure |
|---|
| >3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* | Back alignment and structure |
|---|
| >2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* | Back alignment and structure |
|---|
| >3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* | Back alignment and structure |
|---|
| >1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A | Back alignment and structure |
|---|
| >2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* | Back alignment and structure |
|---|
| >3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A | Back alignment and structure |
|---|
| >3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* | Back alignment and structure |
|---|
| >1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* | Back alignment and structure |
|---|
| >4ehx_A Tetraacyldisaccharide 4'-kinase; membrane protein, lipid A, P-loop, P-loop containing nucleoside triphosphate hydrolase; HET: EPE; 1.90A {Aquifex aeolicus} PDB: 4ehy_A* 4ehw_A | Back alignment and structure |
|---|
| >1j6u_A UDP-N-acetylmuramate-alanine ligase MURC; structural genomics, TM0231, JCSG, PSI, protein structure initiative; 2.30A {Thermotoga maritima} SCOP: c.5.1.1 c.59.1.1 c.72.2.1 | Back alignment and structure |
|---|
| >1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* | Back alignment and structure |
|---|
| >3hn7_A UDP-N-acetylmuramate-L-alanine ligase; ATP-binding, nucleotide-binding, structural genomics, joint for structural genomics, JCSG; HET: MSE; 1.65A {Psychrobacter arcticus 273-4} | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* | Back alignment and structure |
|---|
| >2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A | Back alignment and structure |
|---|
| >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
|---|
| >2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... | Back alignment and structure |
|---|
| >3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >3fdi_A Uncharacterized protein; cytidylate kinase like protein, PSI, MCSG, PRK04182 class ME structural genomics, protein structure initiative; 2.20A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} | Back alignment and structure |
|---|
| >3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2vo1_A CTP synthase 1; pyrimidine biosynthesis, glutamine amidotransferase, phosphorylation, amidotransferase, cytidine 5-prime triphos synthetase, UTP; 2.8A {Homo sapiens} SCOP: c.37.1.10 PDB: 3ihl_A* | Back alignment and structure |
|---|
| >1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* | Back alignment and structure |
|---|
| >1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* | Back alignment and structure |
|---|
| >2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A | Back alignment and structure |
|---|
| >1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A | Back alignment and structure |
|---|
| >2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* | Back alignment and structure |
|---|
| >1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* | Back alignment and structure |
|---|
| >3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* | Back alignment and structure |
|---|
| >3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* | Back alignment and structure |
|---|
| >1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A | Back alignment and structure |
|---|
| >3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B | Back alignment and structure |
|---|
| >2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* | Back alignment and structure |
|---|
| >1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A | Back alignment and structure |
|---|
| >4hv4_A UDP-N-acetylmuramate--L-alanine ligase; MURC, yersinia pestis peptidoglycan synthesis; HET: AMP; 2.25A {Yersinia pestis} PDB: 2f00_A | Back alignment and structure |
|---|
| >1dek_A Deoxynucleoside monophosphate kinase; transferase, phosphotransferase; HET: DGP; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 PDB: 1del_A* | Back alignment and structure |
|---|
| >4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4i1u_A Dephospho-COA kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.05A {Burkholderia vietnamiensis} PDB: 4i1v_A* | Back alignment and structure |
|---|
| >1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* | Back alignment and structure |
|---|
| >2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* | Back alignment and structure |
|---|
| >4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} | Back alignment and structure |
|---|
| >1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* | Back alignment and structure |
|---|
| >1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} | Back alignment and structure |
|---|
| >2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A | Back alignment and structure |
|---|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* | Back alignment and structure |
|---|
| >3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >1p3d_A UDP-N-acetylmuramate--alanine ligase; alpha/beta protein; HET: UMA ANP; 1.70A {Haemophilus influenzae} SCOP: c.5.1.1 c.59.1.1 c.72.2.1 PDB: 1gqq_A* 1p31_A* 1gqy_A* | Back alignment and structure |
|---|
| >2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* | Back alignment and structure |
|---|
| >2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* | Back alignment and structure |
|---|
| >3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* | Back alignment and structure |
|---|
| >2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* | Back alignment and structure |
|---|
| >4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1osn_A Thymidine kinase, VZV-TK; chickenpox, BVDU-MP, transferase; HET: BVP ADP; 3.20A {Human herpesvirus 3} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* | Back alignment and structure |
|---|
| >2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >2f00_A UDP-N-acetylmuramate--L-alanine ligase; amide bond ligase, ATPase, bacterial cell WALL; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} | Back alignment and structure |
|---|
| >4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A | Back alignment and structure |
|---|
| >1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1of1_A Thymidine kinase; transferase, antiviral drug, enzyme- prodrug gene, DNA synthesis, ATP-binding; HET: SCT; 1.95A {Herpes simplex virus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} | Back alignment and structure |
|---|
| >2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1e2k_A Thymidine kinase; transferase, antiviral drug, enzyme-prodrug gene therapy, sugar ring pucker; HET: TMC; 1.7A {Herpes simplex virus} SCOP: c.37.1.1 PDB: 1e2i_A* 1e2h_A* 1e2m_A* 1e2n_A* 1e2p_A* 1ki2_A* 1ki3_A* 1ki4_A* 1ki6_B* 1ki7_A* 1ki8_A* 3rdp_A* 2ki5_A* 1kim_A* 1qhi_A* 1p7c_A* 1vtk_A* 2vtk_A* 3vtk_A* 3f0t_A* ... | Back alignment and structure |
|---|
| >2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* | Back alignment and structure |
|---|
| >3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* | Back alignment and structure |
|---|
| >3bs4_A Uncharacterized protein PH0321; structural genomics, unknown function, PSI-2, protein struct initiative; 1.60A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* | Back alignment and structure |
|---|
| >1gg4_A UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6- diaminopimelate-D-alanyl-D-alanyl ligase...; alpha/beta sheet; 2.30A {Escherichia coli} SCOP: c.98.1.1 c.59.1.1 c.72.2.1 | Back alignment and structure |
|---|
| >1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1f0k_A MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol...; rossmann fold, transferase; 1.90A {Escherichia coli} SCOP: c.87.1.2 PDB: 1nlm_A* | Back alignment and structure |
|---|
| >1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* | Back alignment and structure |
|---|
| >2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A | Back alignment and structure |
|---|
| >2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... | Back alignment and structure |
|---|
| >1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* | Back alignment and structure |
|---|
| >3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C | Back alignment and structure |
|---|
| >1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} | Back alignment and structure |
|---|
| >4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A | Back alignment and structure |
|---|
| >1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* | Back alignment and structure |
|---|
| >2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A | Back alignment and structure |
|---|
| >3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A | Back alignment and structure |
|---|
| >3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* | Back alignment and structure |
|---|
| >3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 | Back alignment and structure |
|---|
| >2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 | Back alignment and structure |
|---|
| >3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* | Back alignment and structure |
|---|
| >2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A | Back alignment and structure |
|---|
| >2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... | Back alignment and structure |
|---|
| >3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* | Back alignment and structure |
|---|
| >1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* | Back alignment and structure |
|---|
| >4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A | Back alignment and structure |
|---|
| >3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} | Back alignment and structure |
|---|
| >4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* | Back alignment and structure |
|---|
| >3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* | Back alignment and structure |
|---|
| >3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* | Back alignment and structure |
|---|
| >3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A | Back alignment and structure |
|---|
| >3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* | Back alignment and structure |
|---|
| >2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* | Back alignment and structure |
|---|
| >1p6x_A Thymidine kinase; P-loop, LID, transferase; HET: THM; 2.00A {Equid herpesvirus 4} SCOP: c.37.1.1 PDB: 1p72_A* 1p73_A* 1p75_A* | Back alignment and structure |
|---|
| >3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E | Back alignment and structure |
|---|
| >3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* | Back alignment and structure |
|---|
| >2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* | Back alignment and structure |
|---|
| >1knx_A Probable HPR(Ser) kinase/phosphatase; HPR kinase, HPR kinase/phosphatase, HPRK/P, P-loop, walker A BOX, catabolite repression; 2.50A {Mycoplasma pneumoniae} SCOP: c.98.2.1 c.91.1.2 | Back alignment and structure |
|---|
| >2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A | Back alignment and structure |
|---|
| >2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* | Back alignment and structure |
|---|
| >2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* | Back alignment and structure |
|---|
| >2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A | Back alignment and structure |
|---|
| >3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* | Back alignment and structure |
|---|
| >4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A | Back alignment and structure |
|---|
| >2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A | Back alignment and structure |
|---|
| >1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* | Back alignment and structure |
|---|
| >3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* | Back alignment and structure |
|---|
| >2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A | Back alignment and structure |
|---|
| >3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* | Back alignment and structure |
|---|
| >2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} | Back alignment and structure |
|---|
| >1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* | Back alignment and structure |
|---|
| >3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} | Back alignment and structure |
|---|
| >2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A | Back alignment and structure |
|---|
| >2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* | Back alignment and structure |
|---|
| >2iut_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- cell division, DNA translocation, KOPS, membrane; HET: DNA SAP; 2.25A {Pseudomonas aeruginosa} PDB: 2iuu_A* | Back alignment and structure |
|---|
| >2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} | Back alignment and structure |
|---|
| >3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} | Back alignment and structure |
|---|
| >1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 | Back alignment and structure |
|---|
| >3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* | Back alignment and structure |
|---|
| >2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} | Back alignment and structure |
|---|
| >3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} | Back alignment and structure |
|---|
| >1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* | Back alignment and structure |
|---|
| >2am1_A SP protein, UDP-N-acetylmuramoylalanine-D-glutamyl-lysine-D-A alanine ligase, MURF protein; HET: 1LG; 2.50A {Streptococcus pneumoniae} PDB: 2am2_A* | Back alignment and structure |
|---|
| >1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* | Back alignment and structure |
|---|
| >1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G | Back alignment and structure |
|---|
| >3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} | Back alignment and structure |
|---|
| >3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* | Back alignment and structure |
|---|
| >3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* | Back alignment and structure |
|---|
| >1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* | Back alignment and structure |
|---|
| >3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* | Back alignment and structure |
|---|
| >2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* | Back alignment and structure |
|---|
| >2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* | Back alignment and structure |
|---|
| >2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* | Back alignment and structure |
|---|
| >1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1ko7_A HPR kinase/phosphatase; protein kinase, phosphotransfer, protein phosphatase, dual activity, product, substrate, transferase, hydrolase; 1.95A {Staphylococcus xylosus} SCOP: c.98.2.1 c.91.1.2 | Back alignment and structure |
|---|
| >3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 233 | ||||
| d1byia_ | 224 | c.37.1.10 (A:) Dethiobiotin synthetase {Escherichi | 4e-29 |
| >d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Length = 224 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Nitrogenase iron protein-like domain: Dethiobiotin synthetase species: Escherichia coli [TaxId: 562]
Score = 107 bits (266), Expect = 4e-29
Identities = 79/225 (35%), Positives = 111/225 (49%), Gaps = 5/225 (2%)
Query: 9 YFITGTNTNIGKTIISCALLSEFKKRGISCIGMKPIASGAYLNNKNKIWFNEDVNLLNKY 68
YF+TGT+T +GKT+ SCALL K G G KP+ASG + K L +
Sbjct: 4 YFVTGTDTEVGKTVASCALLQAAKAAGYRTAGYKPVASG---SEKTPEGLRNSDALALQR 60
Query: 69 SNSLYEFTKLINPYLFKYPISPYTSSNLENRIINTSHIINCYNYLSNLTDVIILEGIGGF 128
++SL +NPY F P SP+ S E R I + + L D +++EG GG+
Sbjct: 61 NSSLQLDYATVNPYTFAEPTSPHIISAQEGRPIESLVMSAGLRALEQQADWVLVEGAGGW 120
Query: 129 SVPFHDNENSADLAEKLGLPIILVIDLKIGCINNALLSLEAINSRGLKLIGWVANHTQIV 188
P D AD + LP+ILV+ +K+GCIN+A+L+ + I GL L GWVAN
Sbjct: 121 FTPLSDTFTFADWVTQEQLPVILVVGVKLGCINHAMLTAQVIQHAGLTLAGWVANDVTPP 180
Query: 189 DTLFANENYIELTKYLNVTPLGRIPYLYNL-NINLISHYLDFSSL 232
A E LT+ + LG IP+L Y++ + L
Sbjct: 181 GKRHA-EYMTTLTRMIPAPLLGEIPWLAENPENAATGKYINLALL 224
|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 233 | |||
| d1byia_ | 224 | Dethiobiotin synthetase {Escherichia coli [TaxId: | 100.0 | |
| d1hyqa_ | 232 | Cell division regulator MinD {Archaeon Archaeoglob | 99.93 | |
| d1g3qa_ | 237 | Cell division regulator MinD {Archaeon Pyrococcus | 99.91 | |
| d2afhe1 | 289 | Nitrogenase iron protein {Azotobacter vinelandii [ | 99.89 | |
| d1cp2a_ | 269 | Nitrogenase iron protein {Clostridium pasteurianum | 99.88 | |
| d1ihua1 | 296 | Arsenite-translocating ATPase ArsA {Escherichia co | 99.74 | |
| d1ihua2 | 279 | Arsenite-translocating ATPase ArsA {Escherichia co | 99.65 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 99.33 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 99.32 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 99.3 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 99.29 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 99.21 | |
| d1xjca_ | 165 | Molybdopterin-guanine dinucleotide biosynthesis pr | 98.67 | |
| d2bv3a2 | 276 | Elongation factor G (EF-G), N-terminal (G) domain | 98.43 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 98.41 | |
| d2p67a1 | 327 | LAO/AO transport system kinase ArgK {Escherichia c | 98.26 | |
| d2dy1a2 | 267 | Elongation factor G (EF-G), N-terminal (G) domain | 98.14 | |
| d2qm8a1 | 323 | Metallochaperone MeaB {Methylobacterium extorquens | 98.01 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 97.98 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 97.76 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 97.72 | |
| d1xp8a1 | 268 | RecA protein, ATPase-domain {Deinococcus radiodura | 97.62 | |
| d1u94a1 | 263 | RecA protein, ATPase-domain {Escherichia coli [Tax | 97.54 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 97.53 | |
| d2c78a3 | 204 | Elongation factor Tu (EF-Tu), N-terminal (G) domai | 97.47 | |
| d1mo6a1 | 269 | RecA protein, ATPase-domain {Mycobacterium tubercu | 97.43 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 97.31 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 97.31 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 97.29 | |
| d1g7sa4 | 227 | Initiation factor IF2/eIF5b, N-terminal (G) domain | 97.25 | |
| d1m7ga_ | 208 | Adenosine-5'phosphosulfate kinase (APS kinase) {Fu | 97.25 | |
| d2g0ta1 | 338 | Hypothetical protein TM0796 {Thermotoga maritima [ | 97.2 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 97.18 | |
| d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 97.18 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 97.15 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 97.12 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 97.12 | |
| d1nn5a_ | 209 | Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 | 97.02 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 96.99 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 96.96 | |
| d1gsia_ | 208 | Thymidylate kinase {Mycobacterium tuberculosis [Ta | 96.95 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 96.88 | |
| d1a7ja_ | 288 | Phosphoribulokinase {Rhodobacter sphaeroides [TaxI | 96.88 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 96.87 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 96.71 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 96.66 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 96.66 | |
| d1cr2a_ | 277 | Gene 4 protein (g4p, DNA primase), helicase domain | 96.61 | |
| d1e8ca3 | 234 | UDP-N-acetylmuramyl tripeptide synthetase MurE {Es | 96.58 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 96.57 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 96.53 | |
| d1s1ma2 | 266 | CTP synthase PyrG, N-terminal domain {Escherichia | 96.52 | |
| d1vhta_ | 208 | Dephospho-CoA kinase {Escherichia coli [TaxId: 562 | 96.49 | |
| d1n0ua2 | 341 | Elongation factor 2 (eEF-2), N-terminal (G) domain | 96.45 | |
| d1ckea_ | 225 | CMP kinase {Escherichia coli [TaxId: 562]} | 96.42 | |
| d1sq5a_ | 308 | Pantothenate kinase PanK {Escherichia coli [TaxId: | 96.39 | |
| d1eg7a_ | 549 | Formyltetrahydrofolate synthetase {Moorella thermo | 96.36 | |
| d1uj2a_ | 213 | Uridine-cytidine kinase 2 {Human (Homo sapiens) [T | 96.34 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 96.3 | |
| d4tmka_ | 210 | Thymidylate kinase {Escherichia coli [TaxId: 562]} | 96.28 | |
| d1vcoa2 | 272 | CTP synthase PyrG, N-terminal domain {Thermus ther | 96.28 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 96.25 | |
| d1f60a3 | 239 | Elongation factor eEF-1alpha, N-terminal (G) domai | 96.19 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 96.14 | |
| d3adka_ | 194 | Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | 96.11 | |
| d1q3ta_ | 223 | CMP kinase {Streptococcus pneumoniae [TaxId: 1313] | 96.09 | |
| d1jjva_ | 205 | Dephospho-CoA kinase {Haemophilus influenzae [TaxI | 96.05 | |
| d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 96.01 | |
| d2gc6a2 | 296 | Folylpolyglutamate synthetase {Lactobacillus casei | 95.99 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 95.99 | |
| d1d2ea3 | 196 | Elongation factor Tu (EF-Tu), N-terminal (G) domai | 95.97 | |
| d2ak3a1 | 189 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 95.97 | |
| d1nlfa_ | 274 | Hexameric replicative helicase repA {Escherichia c | 95.89 | |
| d1yrba1 | 244 | ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss | 95.88 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 95.8 | |
| d1j6ua3 | 207 | UDP-N-acetylmuramate-alanine ligase MurC {Thermoto | 95.79 | |
| d1e9ra_ | 433 | Bacterial conjugative coupling protein TrwB {Esche | 95.79 | |
| d1odfa_ | 286 | Hypothetical protein Ygr205W {Baker's yeast (Sacch | 95.74 | |
| d2cdna1 | 181 | Adenylate kinase {Mycobacterium tuberculosis [TaxI | 95.7 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 95.67 | |
| d1tf7a1 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 95.67 | |
| d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 95.64 | |
| d1nija1 | 222 | Hypothetical protein YjiA, N-terminal domain {Esch | 95.63 | |
| d1uf9a_ | 191 | Dephospho-CoA kinase {Thermus thermophilus [TaxId: | 95.59 | |
| d2jfga3 | 204 | UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase | 95.59 | |
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 95.5 | |
| d1p5zb_ | 241 | Deoxycytidine kinase {Human (Homo sapiens) [TaxId: | 95.44 | |
| d1deka_ | 241 | Deoxynucleoside monophosphate kinase {Bacteriophag | 95.38 | |
| d1gg4a4 | 214 | UDP-murNac-tripeptide D-alanyl-D-alanine-adding en | 95.36 | |
| d1p3da3 | 215 | UDP-N-acetylmuramate-alanine ligase MurC {Haemophi | 95.35 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 95.33 | |
| d2i1qa2 | 258 | DNA repair protein Rad51, catalytic domain {Archae | 95.32 | |
| d1akya1 | 180 | Adenylate kinase {Baker's yeast (Saccharomyces cer | 95.32 | |
| d1o5za2 | 296 | Folylpolyglutamate synthetase {Thermotoga maritima | 95.21 | |
| d1e4va1 | 179 | Adenylate kinase {Escherichia coli [TaxId: 562]} | 95.19 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 95.18 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 95.17 | |
| d1pzna2 | 254 | DNA repair protein Rad51, catalytic domain {Archae | 95.17 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 95.13 | |
| d1n0wa_ | 242 | DNA repair protein Rad51, catalytic domain {Human | 95.04 | |
| d2a5yb3 | 277 | CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI | 94.99 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 94.88 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 94.84 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 94.78 | |
| d1g8fa3 | 122 | ATP sulfurylase C-terminal domain {Baker's yeast ( | 94.76 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 94.7 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 94.41 | |
| d1yksa1 | 140 | YFV helicase domain {Yellow fever virus [TaxId: 11 | 94.39 | |
| d1a1va1 | 136 | HCV helicase domain {Human hepatitis C virus (HCV) | 94.25 | |
| d1osna_ | 331 | Thymidine kinase {Varicella-zoster virus [TaxId: 1 | 94.24 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 94.22 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 94.17 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 94.16 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 94.16 | |
| d2vp4a1 | 197 | Deoxyribonucleoside kinase {Fruit fly (Drosophila | 94.15 | |
| d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 94.14 | |
| d1gkub1 | 237 | Helicase-like "domain" of reverse gyrase {Archaeon | 94.13 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 94.1 | |
| d1g5ta_ | 157 | ATP:corrinoid adenosyltransferase CobA {Salmonella | 94.1 | |
| d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 94.08 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 94.04 | |
| d1pjra1 | 318 | DEXX box DNA helicase {Bacillus stearothermophilus | 94.01 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 93.98 | |
| d1tmka_ | 214 | Thymidylate kinase {Baker's yeast (Saccharomyces c | 93.97 | |
| d1uaaa1 | 306 | DEXX box DNA helicase {Escherichia coli, RepD [Tax | 93.97 | |
| d1zunb3 | 222 | Sulfate adenylate transferase subunit cysN/C, EF-T | 93.88 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 93.83 | |
| d1znwa1 | 182 | Guanylate kinase {Mycobacterium tuberculosis [TaxI | 93.36 | |
| d1lvga_ | 190 | Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 | 93.31 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 93.24 | |
| d2ocpa1 | 241 | Deoxyguanosine kinase {Human (Homo sapiens) [TaxId | 93.23 | |
| d1r6bx3 | 315 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 92.93 | |
| d1svma_ | 362 | Papillomavirus large T antigen helicase domain {Si | 92.79 | |
| d2vo1a1 | 273 | CTP synthase PyrG, N-terminal domain {Human (Homo | 92.76 | |
| d1gkya_ | 186 | Guanylate kinase {Baker's yeast (Saccharomyces cer | 92.74 | |
| d1kgda_ | 178 | Guanylate kinase-like domain of Cask {Human (Homo | 92.72 | |
| d1v5wa_ | 258 | Meiotic recombination protein DMC1/LIM15 homolog { | 92.68 | |
| d1qvra3 | 315 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 92.62 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 92.43 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 92.37 | |
| d1upta_ | 169 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 92.26 | |
| d1fjha_ | 257 | 3-alpha-hydroxysteroid dehydrogenase {Comamonas te | 92.23 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 92.08 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 91.57 | |
| d1xx6a1 | 141 | Thymidine kinase, TK1, N-terminal domain {Clostrid | 91.56 | |
| d2p6ra3 | 202 | Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 | 91.4 | |
| d1zj6a1 | 177 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 91.34 | |
| d1kkma_ | 176 | HPr kinase HprK C-terminal domain {Lactobacillus c | 91.28 | |
| d1wp9a1 | 200 | putative ATP-dependent RNA helicase PF2015 {Pyroco | 91.21 | |
| d1s96a_ | 205 | Guanylate kinase {Escherichia coli [TaxId: 562]} | 91.2 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 91.16 | |
| d1xbta1 | 133 | Thymidine kinase, TK1, N-terminal domain {Human (H | 90.77 | |
| d1um8a_ | 364 | ClpX {Helicobacter pylori [TaxId: 210]} | 90.7 | |
| d1p3da1 | 96 | UDP-N-acetylmuramate-alanine ligase MurC {Haemophi | 90.14 | |
| d1r5ba3 | 245 | Eukaryotic peptide chain release factor ERF2, G do | 90.06 | |
| d1g41a_ | 443 | HslU {Haemophilus influenzae [TaxId: 727]} | 89.9 | |
| d1knxa2 | 177 | HPr kinase HprK C-terminal domain {Mycoplasma pneu | 89.86 | |
| d2b8ta1 | 139 | Thymidine kinase, TK1, N-terminal domain {Ureaplas | 89.74 | |
| d1w44a_ | 321 | NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | 89.63 | |
| d1svia_ | 195 | Probable GTPase EngB {Bacillus subtilis [TaxId: 14 | 89.6 | |
| d1htwa_ | 158 | Hypothetical protein HI0065 {Haemophilus influenza | 89.58 | |
| d2eyqa3 | 233 | Transcription-repair coupling factor, TRCF {Escher | 89.32 | |
| d1p6xa_ | 333 | Thymidine kinase {Equine herpesvirus type 4 [TaxId | 89.15 | |
| d2fh5b1 | 207 | Signal recognition particle receptor beta-subunit | 88.79 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 88.71 | |
| d1ko7a2 | 169 | HPr kinase HprK C-terminal domain {Staphylococcus | 88.41 | |
| d1mkya1 | 171 | Probable GTPase Der, N-terminal and middle domains | 88.38 | |
| d2erya1 | 171 | r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 88.28 | |
| d3b60a1 | 253 | Multidrug resistance ABC transporter MsbA, C-termi | 88.2 | |
| d2pmka1 | 241 | Haemolysin B ATP-binding protein {Escherichia coli | 87.85 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 87.82 | |
| d1nrjb_ | 209 | Signal recognition particle receptor beta-subunit | 87.8 | |
| d1ksha_ | 165 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 87.42 | |
| d2bmfa2 | 305 | Dengue virus helicase {Dengue virus type 2 [TaxId: | 87.4 | |
| d1f6ba_ | 186 | SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: | 87.34 | |
| d1r8sa_ | 160 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 87.3 | |
| d1mv5a_ | 242 | Multidrug resistance ABC transporter LmrA, C-termi | 87.19 | |
| d1jj7a_ | 251 | Peptide transporter Tap1, C-terminal ABC domain {H | 86.83 | |
| d3dhwc1 | 240 | Methionine import ATP-binding protein MetN {Escher | 86.71 | |
| d1xtqa1 | 167 | GTP-binding protein RheB {Human (Homo sapiens) [Ta | 86.55 | |
| d1gm5a3 | 264 | RecG helicase domain {Thermotoga maritima [TaxId: | 86.54 | |
| d1e2ka_ | 329 | Thymidine kinase {Herpes simplex virus type 1, dif | 86.51 | |
| d1r0wa_ | 281 | Cystic fibrosis transmembrane conductance regulato | 86.46 | |
| d1u0la2 | 225 | Probable GTPase EngC (YjeQ), C-terminal domain {Th | 86.35 | |
| g1qhh.1 | 623 | DEXX box DNA helicase {Bacillus stearothermophilus | 86.34 | |
| d2gnoa2 | 198 | gamma subunit of DNA polymerase III, N-domain {The | 86.25 | |
| d2awna2 | 232 | Maltose transport protein MalK, N-terminal domain | 86.24 | |
| d1g2912 | 240 | Maltose transport protein MalK, N-terminal domain | 85.98 | |
| d1xg5a_ | 257 | Putative dehydrogenase ARPG836 (MGC4172) {Human (H | 85.87 | |
| d1l2ta_ | 230 | MJ0796 {Archaeon Methanococcus jannaschii [TaxId: | 85.85 | |
| d1ae1a_ | 258 | Tropinone reductase {Jimsonweed (Datura stramonium | 85.63 | |
| d1rzua_ | 477 | Glycogen synthase 1, GlgA {Agrobacterium tumefacie | 85.55 | |
| d1sgwa_ | 200 | Putative ABC transporter PF0895 {Pyrococcus furios | 85.14 | |
| d2q46a1 | 252 | Hypothetical protein At5g02240 (T7H20_290) {Thale | 85.09 | |
| d2cxxa1 | 184 | GTP-binding protein engB {Pyrococcus horikoshii [T | 84.76 | |
| d1egaa1 | 179 | GTPase Era, N-terminal domain {Escherichia coli [T | 84.54 | |
| d2qtvb1 | 166 | SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 84.46 | |
| d2c5aa1 | 363 | GDP-mannose-3', 5'-epimerase {Thale cress (Arabido | 84.44 | |
| d1mkya2 | 186 | Probable GTPase Der, N-terminal and middle domains | 84.37 | |
| d1dhra_ | 236 | Dihydropteridin reductase (pteridine reductase) {R | 84.25 | |
| d1wf3a1 | 178 | GTPase Era, N-terminal domain {Thermus thermophilu | 84.15 | |
| d2atxa1 | 185 | RhoQ {Human (Homo sapiens) [TaxId: 9606]} | 84.15 | |
| d2fz4a1 | 206 | DNA repair protein RAD25 {Archaeoglobus fulgidus [ | 83.93 | |
| d1tf5a3 | 273 | Translocation ATPase SecA, nucleotide-binding doma | 83.86 | |
| d2erxa1 | 171 | di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 83.83 | |
| d2f7sa1 | 186 | Rab27b {Human (Homo sapiens) [TaxId: 9606]} | 83.79 | |
| d1v43a3 | 239 | Hypothetical protein PH0022, N-terminal domain {Py | 83.78 | |
| d3d31a2 | 229 | Sulfate/molybdate ABC transporter, ATP-binding pro | 83.75 | |
| d1svsa1 | 195 | Transducin (alpha subunit) {Rat (Rattus norvegicus | 83.74 | |
| d1z0fa1 | 166 | Rab14 {Human (Homo sapiens) [TaxId: 9606]} | 83.74 | |
| d3raba_ | 169 | Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | 83.71 | |
| d1wb1a4 | 179 | Elongation factor SelB, N-terminal domain {Methano | 83.67 | |
| d2bcjq2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 83.55 | |
| d1rifa_ | 282 | DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] | 83.51 | |
| d1pzga1 | 154 | Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 | 83.4 | |
| d2gj8a1 | 161 | Probable tRNA modification GTPase TrmE (MnmE), G d | 83.4 | |
| d1b0ua_ | 258 | ATP-binding subunit of the histidine permease {Sal | 83.35 | |
| d2ew1a1 | 171 | Rab30 {Human (Homo sapiens) [TaxId: 9606]} | 83.32 | |
| d1ky3a_ | 175 | Rab-related protein ypt7p {Baker's yeast (Saccharo | 83.18 | |
| d1kaoa_ | 167 | Rap2a {Human (Homo sapiens) [TaxId: 9606]} | 83.12 | |
| d1kmqa_ | 177 | RhoA {Human (Homo sapiens) [TaxId: 9606]} | 83.1 | |
| d1luaa1 | 191 | Methylene-tetrahydromethanopterin dehydrogenase {M | 83.05 | |
| d2onka1 | 240 | Molybdate/tungstate import ATP-binding protein Wtp | 83.01 | |
| d1moza_ | 182 | ADP-ribosylation factor {Baker's yeast (Saccharomy | 82.96 | |
| d1pr9a_ | 244 | Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 | 82.95 | |
| d2o23a1 | 248 | Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho | 82.94 | |
| d2gdza1 | 254 | 15-hydroxyprostaglandin dehydrogenase, PGDH {Human | 82.83 | |
| d1yb1a_ | 244 | 17-beta-hydroxysteroid dehydrogenase type XI {Huma | 82.81 | |
| d2bmea1 | 174 | Rab4a {Human (Homo sapiens) [TaxId: 9606]} | 82.79 | |
| d1fzqa_ | 176 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 82.78 | |
| d1z08a1 | 167 | Rab21 {Human (Homo sapiens) [TaxId: 9606]} | 82.77 | |
| d1z2aa1 | 164 | Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | 82.67 | |
| d2a5ja1 | 173 | Rab2b {Human (Homo sapiens) [TaxId: 9606]} | 82.56 | |
| d1ulsa_ | 242 | beta-keto acyl carrier protein reductase {Thermus | 82.51 | |
| d2jfga1 | 93 | UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase | 82.45 | |
| d1g8pa_ | 333 | ATPase subunit of magnesium chelatase, BchI {Rhodo | 82.4 | |
| d1kk1a3 | 195 | Initiation factor eIF2 gamma subunit, N-terminal ( | 82.39 | |
| d1r2qa_ | 170 | Rab5a {Human (Homo sapiens) [TaxId: 9606]} | 82.32 | |
| d1yzqa1 | 164 | Rab6 {Human (Homo sapiens) [TaxId: 9606]} | 82.3 | |
| d1oxxk2 | 242 | Glucose transport protein GlcV, N-terminal domain | 82.25 | |
| d1uaya_ | 241 | Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t | 82.17 | |
| d2hyda1 | 255 | Putative multidrug export ATP-binding/permease pro | 82.16 | |
| d1udxa2 | 180 | Obg GTP-binding protein middle domain {Thermus the | 82.03 | |
| d1g16a_ | 166 | Rab-related protein Sec4 {Baker's yeast (Saccharom | 81.91 | |
| d1z06a1 | 165 | Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | 81.89 | |
| d2qn6a3 | 205 | Initiation factor eIF2 gamma subunit, N-terminal ( | 81.86 | |
| d1lnza2 | 185 | Obg GTP-binding protein middle domain {Bacillus su | 81.69 | |
| d1z0ja1 | 167 | Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | 81.62 | |
| d1vl8a_ | 251 | Gluconate 5-dehydrogenase {Thermotoga maritima [Ta | 81.6 | |
| d1mh1a_ | 183 | Rac {Human (Homo sapiens) [TaxId: 9606]} | 81.45 | |
| d2gjsa1 | 168 | Rad {Human (Homo sapiens) [TaxId: 9606]} | 81.31 | |
| d1k2wa_ | 256 | Sorbitol dehydrogenase {Rhodobacter sphaeroides [T | 81.3 | |
| d2g6ba1 | 170 | Rab26 {Human (Homo sapiens) [TaxId: 9606]} | 81.21 | |
| d1ctqa_ | 166 | cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 | 81.19 | |
| d2d1ya1 | 248 | Hypothetical protein TTHA0369 {Thermus thermophilu | 81.0 | |
| d1w6ua_ | 294 | 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H | 80.87 | |
| d1vg8a_ | 184 | Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | 80.81 | |
| d1xpua3 | 289 | Transcription termination factor Rho, ATPase domai | 80.74 | |
| d1puia_ | 188 | Probable GTPase EngB {Escherichia coli [TaxId: 562 | 80.64 | |
| d2bcgy1 | 194 | GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi | 80.51 | |
| d1zd9a1 | 164 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 80.5 | |
| d1bdba_ | 276 | Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps | 80.43 | |
| d2atva1 | 168 | Ras-like estrogen-regulated growth inhibitor, RERG | 80.43 | |
| d1cyda_ | 242 | Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 | 80.19 | |
| d1e0sa_ | 173 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 80.15 | |
| d1wmsa_ | 174 | Rab9a {Human (Homo sapiens) [TaxId: 9606]} | 80.1 |
| >d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Nitrogenase iron protein-like domain: Dethiobiotin synthetase species: Escherichia coli [TaxId: 562]
Probab=100.00 E-value=1.8e-32 Score=216.58 Aligned_cols=223 Identities=35% Similarity=0.552 Sum_probs=174.8
Q ss_pred ceeEEEEeCCCCCcHHHHHHHHHHHHHHcCCeeeEEeeeecCcccCCCCCCccchHHHHHHHHhCCCcccccceeeeeec
Q psy14904 6 FLHYFITGTNTNIGKTIISCALLSEFKKRGISCIGMKPIASGAYLNNKNKIWFNEDVNLLNKYSNSLYEFTKLINPYLFK 85 (233)
Q Consensus 6 ~~~i~i~~~kggvGKTt~a~~La~~l~~~G~~Vl~~dp~~~~~~~~~~~~~l~~~d~~~~~~~~~~~~~~~~~~~~~~~~ 85 (233)
.|.|+|+|+.+||||||+|+|||.+|+++|+||+++||+.++..... .+....+...+....+..... ....+....
T Consensus 1 ~~~~~i~gt~~GVGKTtvs~~La~aLa~~G~rVl~id~d~~g~~~~~--~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~ 77 (224)
T d1byia_ 1 SKRYFVTGTDTEVGKTVASCALLQAAKAAGYRTAGYKPVASGSEKTP--EGLRNSDALALQRNSSLQLDY-ATVNPYTFA 77 (224)
T ss_dssp CEEEEEEESSTTSCHHHHHHHHHHHHHHTTCCEEEECSEEESCBCCT--TSCBCHHHHHHHHTCSSCCCH-HHHCSEEES
T ss_pred CceEEEEECCCCccHHHHHHHHHHHHHHCCCeEEEECccccCCCCCC--CCcchhHHHHHHHhhccCccc-ccccccccc
Confidence 37899999988999999999999999999999999998877655332 233334555555555543322 222333344
Q ss_pred CCCChhhhhhhcCCCCCHHHHHHHHHHhhcCCCeEEEeccCcccCccCCCCchHHHHHHhCCCEEEEEcCCCCcHHHHHH
Q psy14904 86 YPISPYTSSNLENRIINTSHIINCYNYLSNLTDVIILEGIGGFSVPFHDNENSADLAEKLGLPIILVIDLKIGCINNALL 165 (233)
Q Consensus 86 ~~~~~~~~~~~~~~~~~~~~l~~~~~~l~~~~D~vlID~~~g~~~p~~~~~~~~~l~~~~~~~vllV~~~~~~~~~~~~~ 165 (233)
....+......+........+.+.+.++...+|++++|++++...+.......+++......++++|+.........+..
T Consensus 78 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~V~~~~~~~~~~~~~ 157 (224)
T d1byia_ 78 EPTSPHIISAQEGRPIESLVMSAGLRALEQQADWVLVEGAGGWFTPLSDTFTFADWVTQEQLPVILVVGVKLGCINHAML 157 (224)
T ss_dssp SCSCHHHHHHHHTCCCCHHHHHHHHHHHHTTCSEEEEECSSSTTCEEETTEEHHHHHHHHTCCEEEEEECSTTHHHHHHH
T ss_pred cchhhhhhhhhhhhhhhHHHHHHHHhhhhhccceEeecccccccccccccchhhcccccccceeeEEEeeccchhHHHHH
Confidence 33333333344455566788999999999999999999998887665566778889888899999999999988888888
Q ss_pred HHHHHHhCCCcEEEEEEcccCCCchhhhhhhHHHHHhhcCCCceEecCCCCCCC-hhhhhhhcCCCCC
Q psy14904 166 SLEAINSRGLKLIGWVANHTQIVDTLFANENYIELTKYLNVTPLGRIPYLYNLN-INLISHYLDFSSL 232 (233)
Q Consensus 166 ~~~~l~~~~~~i~GiVlN~~~~~~~~~~~~~~~~l~~~~~~pvlg~IP~~~~l~-~~~~~~~~~~~~~ 232 (233)
..+.+++.+..+.|+|+|+++ ++...+++..+.+++.+|+|++|.||+.++.. ..+.++|||++++
T Consensus 158 ~~~~~~~~~~~~~gvv~N~~~-~~~~~~~~~~~~l~~~~gi~vlG~IP~~~~~~e~~~~~~~l~l~~l 224 (224)
T d1byia_ 158 TAQVIQHAGLTLAGWVANDVT-PPGKRHAEYMTTLTRMIPAPLLGEIPWLAENPENAATGKYINLALL 224 (224)
T ss_dssp HHHHHHHTTCCEEEEEEECCS-SCCTTHHHHHHHHHHHSSSCEEEEECCCTTCTTCCCCGGGCCGGGC
T ss_pred HHHHHhccCCccEEEEEeCcC-CCchHHHHHHHHHHHHhCCCEEEECCCCCCCccccccccccCcCcC
Confidence 999999999999999999998 55556678889999999999999999988875 4589999998864
|
| >d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} | Back information, alignment and structure |
|---|
| >d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d2g0ta1 c.37.1.10 (A:1-338) Hypothetical protein TM0796 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} | Back information, alignment and structure |
|---|
| >d1e8ca3 c.72.2.1 (A:104-337) UDP-N-acetylmuramyl tripeptide synthetase MurE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1s1ma2 c.37.1.10 (A:1-266) CTP synthase PyrG, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1eg7a_ c.37.1.10 (A:) Formyltetrahydrofolate synthetase {Moorella thermoacetica [TaxId: 1525]} | Back information, alignment and structure |
|---|
| >d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vcoa2 c.37.1.10 (A:11-282) CTP synthase PyrG, N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gc6a2 c.72.2.2 (A:1-296) Folylpolyglutamate synthetase {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1j6ua3 c.72.2.1 (A:89-295) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2jfga3 c.72.2.1 (A:94-297) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1gg4a4 c.72.2.1 (A:99-312) UDP-murNac-tripeptide D-alanyl-D-alanine-adding enzyme MurF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1p3da3 c.72.2.1 (A:107-321) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} | Back information, alignment and structure |
|---|
| >d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1g5ta_ c.37.1.11 (A:) ATP:corrinoid adenosyltransferase CobA {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d2vo1a1 c.37.1.10 (A:1-273) CTP synthase PyrG, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} | Back information, alignment and structure |
|---|
| >d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} | Back information, alignment and structure |
|---|
| >d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | Back information, alignment and structure |
|---|
| >d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} | Back information, alignment and structure |
|---|
| >d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} | Back information, alignment and structure |
|---|
| >d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} | Back information, alignment and structure |
|---|
| >d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} | Back information, alignment and structure |
|---|
| >d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} | Back information, alignment and structure |
|---|
| >d1rzua_ c.87.1.8 (A:) Glycogen synthase 1, GlgA {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} | Back information, alignment and structure |
|---|
| >d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} | Back information, alignment and structure |
|---|
| >d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} | Back information, alignment and structure |
|---|
| >d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|