Score = 118 (46.6 bits), Expect = 3.4e-06, P = 3.4e-06
Identities = 26/41 (63%), Positives = 29/41 (70%)
Query: 43 RLDVACICLGNMRDIQGIWTLRYAQAEPELEARVAALAIHL 83
RLDVA +CLGNM +G LR A+ EPELEARVA LA L
Sbjct: 10 RLDVAKVCLGNMGHARGARALREAEQEPELEARVAVLATQL 50
Parameters:
V=100
filter=SEG
E=0.001
ctxfactor=1.00
Query ----- As Used ----- ----- Computed ----
Frame MatID Matrix name Lambda K H Lambda K H
+0 0 BLOSUM62 0.327 0.139 0.420 same same same
Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a
Query
Frame MatID Length Eff.Length E S W T X E2 S2
+0 0 100 100 0.00091 102 3 11 22 0.45 29
29 0.47 31
Statistics:
Database: /share/blast/go-seqdb.fasta
Title: go_20130330-seqdb.fasta
Posted: 5:47:42 AM PDT Apr 1, 2013
Created: 5:47:42 AM PDT Apr 1, 2013
Format: XDF-1
# of letters in database: 169,044,731
# of sequences in database: 368,745
# of database sequences satisfying E: 9
No. of states in DFA: 541 (58 KB)
Total size of DFA: 112 KB (2075 KB)
Time to generate neighborhood: 0.00u 0.00s 0.00t Elapsed: 00:00:00
No. of threads or processors used: 24
Search cpu time: 9.94u 0.08s 10.02t Elapsed: 00:00:08
Total cpu time: 9.94u 0.08s 10.02t Elapsed: 00:00:08
Start: Thu Aug 15 11:14:45 2013 End: Thu Aug 15 11:14:53 2013
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment
Probab=92.53 E-value=0.3 Score=41.30 Aligned_cols=65 Identities=22% Similarity=0.331 Sum_probs=46.2
Q ss_pred HHHHHHhhcCCHHHHHHHhHhHH----------------HHHHHHHHhhcccchHHHHHHHHHhhCchHHHHHHHHHHHh
Q psy14933 20 INFSYYLNTGDLDQAFKSIAFIT----------------RLDVACICLGNMRDIQGIWTLRYAQAEPELEARVAALAIHL 83 (100)
Q Consensus 20 l~Fs~~Lt~GnmD~Afkaik~Ik----------------RlDVA~vCLG~m~~ar~A~alR~A~~e~e~ea~vA~lAi~L 83 (100)
..|...|..||+|.|+...+.++ ++++|+.|+-+.++.-+-.-|--...+-+.=.+++-.|.+-
T Consensus 323 ~rFeLAl~lg~L~~A~~~a~~~~~~~~W~~Lg~~AL~~g~~~lAe~c~~k~~d~~~L~lLy~~~g~~~~L~kl~~~a~~~ 402 (443)
T PF04053_consen 323 HRFELALQLGNLDIALEIAKELDDPEKWKQLGDEALRQGNIELAEECYQKAKDFSGLLLLYSSTGDREKLSKLAKIAEER 402 (443)
T ss_dssp HHHHHHHHCT-HHHHHHHCCCCSTHHHHHHHHHHHHHTTBHHHHHHHHHHCT-HHHHHHHHHHCT-HHHHHHHHHHHHHT
T ss_pred HHhHHHHhcCCHHHHHHHHHhcCcHHHHHHHHHHHHHcCCHHHHHHHHHhhcCccccHHHHHHhCCHHHHHHHHHHHHHc
Confidence 45999999999999999997664 89999999999999987776666655544434444444433
Q ss_pred c
Q psy14933 84 Q 84 (100)
Q Consensus 84 G 84 (100)
|
T Consensus 403 ~ 403 (443)
T PF04053_consen 403 G 403 (443)
T ss_dssp T
T ss_pred c
Confidence 3
This traffic is bidirectional, to ensure that proteins required to form vesicles are recycled. Vesicles have specific coat proteins (such as clathrin or coatomer) that are important for cargo selection and direction of transfer []. While clathrin mediates endocytic protein transport, and transport from ER to Golgi, coatomers primarily mediate intra-Golgi transport, as well as the reverse Golgi to ER transport of dilysine-tagged proteins []. For example, the coatomer COP1 (coat protein complex 1) is responsible for reverse transport of recycled proteins from Golgi and pre-Golgi compartments back to the ER, while COPII buds vesicles from the ER to the Golgi []. Coatomers reversibly associate with Golgi (non-clathrin-coated) vesicles to mediate protein transport and for budding from Golgi membranes []. Activated small guanine triphosphatases (GTPases) attract coat proteins to specific membrane export sites, thereby linking coatomers to export cargos. As coat proteins polymerise, vesicles are formed and budded from membrane-bound organelles. Coatomer complexes also influence Golgi structural integrity, as well as the processing, activity, and endocytic recycling of LDL receptors. In mammals, coatomer complexes can only be recruited by membranes associated to ADP-ribosylation factors (ARFs), which are small GTP-binding proteins. Coatomer complexes are hetero-oligomers composed of at least an alpha, beta, beta', gamma, delta, epsilon and zeta subunits. This entry represents the WD-associated region found in coatomer subunits alpha, beta and beta' subunits. The alpha-subunit (RET1P) of the coatomer complex in Saccharomyces cerevisiae (Baker's yeast), participates in membrane transport between the endoplasmic reticulum and Golgi apparatus. The protein contains six WD-40 repeat motifs in its N-terminal region []. More information about these proteins can be found at Protein of the Month: Clathrin [].; GO: 0005198 structural molecule activity, 0006886 intracellular protein transport, 0016192 vesicle-mediated transport, 0030117 membrane coat; PDB: 3MKQ_B.
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome
This entry also matches the evolutionarily related subunit 1 of the COP9 signalosome complex (CSN) from Arabidopsis []. The 26S proteasome plays a major role in ATP-dependent degradation of ubiquitinated proteins. Substrate specificity is conferred by the regulatory particle (RP), which can dissociate into stable lid and base subcomplexes. The regulatory subunit RPN7 is one of the lid subunits of the 26S proteasome and has been shown in Saccharomyces cerevisiae (Baker's yeast) to be required for structural integrity []. The COP9 signalosome is a conserved protein complex composed of eight subunits, where Individual subunits of the complex have been linked to various signal transduction pathways leading to gene expression and cell cycle control []. The overall organisation and the amino acid sequences of the COP9 signalosome subunits resemble the lid subcomplex of the 19 S regulatory particle for the 26 S proteasome []. COP9 subunit 1 (CSN1 or GPS1) of the COP9 complex is an essential subunit of the complex with regard to both structural integrity and functionality. The N-terminal region of subunit 1 (CSN1-N) can inhibit c-fos expression from either a transfected template or a chromosomal transgene (fos-lacZ), and may contain the activity domain that confers most of the repression functions of CSN1. The C-terminal region of subunit 1 (CSN1-C) allows integration of the protein into the COP9 signalosome.
>PF03130 HEAT_PBS: PBS lyase HEAT-like repeat; InterPro: IPR004155 These proteins contain a short bi-helical repeat that is related to HEAT
Cyanobacteria and red algae harvest light energy using macromolecular complexes known as phycobilisomes (PBS), peripherally attached to the photosynthetic membrane. The major components of PBS are the phycobiliproteins. These heterodimeric proteins are covalently attached to phycobilins: open-chain tetrapyrrole chromophores, which function as the photosynthetic light-harvesting pigments. Phycobiliproteins differ in sequence and in the nature and number of attached phycobilins to each of their subunits. These proteins include the lyase enzymes that specifically attach particular phycobilins to apophycobiliprotein subunits. The most comprehensively studied of these is the CpcE/Flyase P31967 from SWISSPROT, P31968 from SWISSPROT, which attaches phycocyanobilin (PCB) to the alpha subunit of apophycocyanin []. Similarly, MpeU/V attaches phycoerythrobilin to phycoerythrin II, while CpeY/Z is thought to be involved in phycoerythrobilin (PEB) attachment to phycoerythrin (PE) I (PEs I and II differ in sequence and in the number of attached molecules of PEB: PE I has five, PE II has six) []. All the reactions of the above lyases involve an apoprotein cysteine SH addition to a terminal delta 3,3'-double bond. Such a reaction is not possible in the case of phycoviolobilin (PVB), the phycobilin of alpha-phycoerythrocyanin (alpha-PEC). It is thought that in this case, PCB, not PVB, is first added to apo-alpha-PEC, and is then isomerized to PVB. The addition reaction has been shown to occur in the presence of either of the components of alpha-PEC-PVB lyase PecE or PecF (or both). The isomerisation reaction occurs only when both PecE and PecF components are present, i.e. the PecE/F phycobiliprotein lyase is also a phycobilin isomerase []. Another member of this family is the NblB protein, whose similarity to the phycobiliprotein lyases was previously noted []. This constitutively expressed protein is not known to have any lyase activity. It is thought to be involved in the coordination of PBS degradation with environmental nutrient limitation. It has been suggested that the similarity of NblB to the phycobiliprotein lyases is due to the ability to bind tetrapyrrole phycobilins via the common repeated motif [].; PDB: 1TE4_A.
