Psyllid ID: psy14977

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------47
MADEEFAELGEINLSHEYLLRSGVGALHGNGGGAVWGRSPGSILPISQYRTMYHADQCRAAEAEDIMGHYNPRASHRSKAGLYYSPPGTSYTIVERPPPPPPVPLPQPPKPRGTYLGTNGSSYRTQPSSTEYRSNSPSNNTSSSYRNTSSHSHGTKKGALSPEQVLKMLTSGGGGKKSAEGSEEHHHHPRHRRLTPPDIDQLPVRTINMNRSQDANHGFGICVKGGANNPGVGVYISRVEEGSIAERAGLRPGDSILQVNGIPFTGISHEEALKMCFFEGYKEGQMLKSNRELSMTVRSPSIPPQAPRNHPLPPPPAWTMRQAYSWIDRQGRPCSPPLDYARSVIPMPPPPPPPPRWNYSARSSKDTVRKVELNIEPGQSLGLMIRGGVEYNLGIFITGVDKDSVAERAGLLVSQLTLYQFIKEFLILSDHDKDFDTVISFSHEQTSPSMYGVQATLLSSSSGSIVITL
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccccccEEEEEEccccccccEEEEEEcccccccccEEEEEEccccHHHHcccccccEEEEEcccccccccHHHHHHHHHHcccccEEEEEEccEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEccccEEcEEEEccccccccEEEEEEccccHHHHHccccccEEEEEccEEccccccHHHHHHHHHHcccEEEEEEEccccEEEEcccccEEEEcc
cccHHHHHHcccccHHHHHHHcccccEEcccccccccccccccccHHHHHHHcccccccHHHHHHcccccccccccccccccccccccccccEcccccccccccccccccccccccccccccEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEcccccccEEEEEccccccccEEEEEEEccccccHHcccccccEEEEEcccccccccHHHHHHHHHHccccEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEccccccEEEEEccccccccEEEEEEccccccHccccccccEEEEEccccccccccHHHHHHHHHHcccHHEEEEEccccEEEEEEcccEEEEEc
MADEEFAELGEINLSHEYLLRsgvgalhgngggavwgrspgsilpisqyrtmyhADQCRAAEAEDImghynprashrskaglyysppgtsytiverppppppvplpqppkprgtylgtngssyrtqpssteyrsnspsnntsssyrntsshshgtkkgalsPEQVLKMLtsggggkksaegseehhhhprhrrltppdidqlpvrtinmnrsqdanhgfgicvkggannpgvGVYISRVeegsiaeraglrpgdsilqvngipftgiSHEEALKMCFFegykegqmlksnrelsmtvrspsippqaprnhplppppawtmrQAYSWidrqgrpcsppldyarsvipmpppppppprwnysarsskdTVRKVelniepgqslglmirggveynLGIFITGVDKDSVAERAGLLVSQLTLYQFIKEFLIlsdhdkdfdtvisfsheqtspsmyGVQATLLssssgsivitl
MADEEFAELGEINLSHEYLLRSGVGALHGNGGGAVWGRSPGSILPISQYRTMYHADQCRAAEAEDIMGHYNPRASHRSKAGLYYSPPGTSYTIVERPPPPPPVPLPQPPKPRGTYLGTNGssyrtqpssteyrsnspsnntsssyrntsshshgtkkgalspEQVLKMLTSGGGGKKSAEGSEEhhhhprhrrltppdidqlpVRTINMNRSQDANHGFGICVKGGANNPGVGVYISRVEEGSIAEraglrpgdsilQVNGIPFTGISHEEALKMCFFEGYKEGQMLKSNRELSMTVRspsippqaprnhpLPPPPAWTMRQAYSWIDRQGRPCSPPLDYARSVIPMPPPPPPPPRWNYSARSSKDTVRKVELNiepgqslglmIRGGVEYNLGIFITGVDKDSVAERAGLLVSQLTLYQFIKEFLILSDHDKDFDTVISFSheqtspsmyGVQAtllssssgsivitl
MADEEFAELGEINLSHEYLLRSgvgalhgngggavwgRSPGSILPISQYRTMYHADQCRAAEAEDIMGHYNPRASHRSKAGLYYSPPGTSYTIVERppppppvplpqppkpRGTYLGTNGSSYRTQPSSTEyrsnspsnntsssyrntsshshGTKKGALSPEQVLKMLTsggggkksaegseehhhhprhrrLTPPDIDQLPVRTINMNRSQDANHGFGICVKGGANNPGVGVYISRVEEGSIAERAGLRPGDSILQVNGIPFTGISHEEALKMCFFEGYKEGQMLKSNRELSMTVRSPSIppqaprnhplppppAWTMRQAYSWIDRQGRPCSPPLDYARSVIpmppppppppRWNYSARSSKDTVRKVELNIEPGQSLGLMIRGGVEYNLGIFITGVDKDSVAERAGLLVSQLTLYQFIKEFLILSDHDKDFDTVISFSHEQTSPSMYGVQATLLSSSSGSIVITL
********LGEINLSHEYLLRSGVGALHGNGGGAVWGRSPGSILPISQYRTMYHADQCRAAEAEDIMGH**************************************************************************************************************************************************NHGFGICVKGGANNPGVGVYISRVEEGSIAERAGLRPGDSILQVNGIPFTGISHEEALKMCFFEGYK*************************************MRQAYSWID********************************************LNIEPGQSLGLMIRGGVEYNLGIFITGVDKDSVAERAGLLVSQLTLYQFIKEFLILSDHDKDFDTVISFS***************************
**************************************************************************************************************************************************************************************************************INMNRSQDANHGFGICVKGGANNPGVGVYISRVEEGSIAERAGLRPGDSILQVNGIPFTGISHEEALKMCFFEGYKEGQMLKSNRE******************************************************************************VELNIEPGQSLGLMIRGGVEYNLGIFITGVDKDSVAERAGLLVSQLTLYQFIKEFLILSDHDKDFDTVISFSHEQTS***************GSIVITL
********LGEINLSHEYLLRSGVGALHGNGGGAVWGRSPGSILPISQYRTMYHADQCRAAEAEDIMGHYNPRASHRSKAGLYYSPPGTSYTIVERPPPPPPVPLPQPPKPRGTYLGTNGS*************************************ALSPEQVLKML************************LTPPDIDQLPVRTINMNRSQDANHGFGICVKGGANNPGVGVYISRVEEGSIAERAGLRPGDSILQVNGIPFTGISHEEALKMCFFEGYKEGQMLKSNRELSMTVRSPSIPPQAPRNHPLPPPPAWTMRQAYSWIDRQGRPCSPPLDYARSVIPMPPPPPPPPRWNYSARSSKDTVRKVELNIEPGQSLGLMIRGGVEYNLGIFITGVDKDSVAERAGLLVSQLTLYQFIKEFLILSDHDKDFDTVISFSHEQTSPSMYGVQATLLSSS********
***EEFAELGEINLSHEYLLRSGVGALHGNGGGAVWGRSPGSILPISQYRTMYHAD*************************L*YSPPGTSYTIVERPPPPPPVPLPQ*********************************************************************************************QLPVRTINMNRSQDANHGFGICVKGGANNPGVGVYISRVEEGSIAERAGLRPGDSILQVNGIPFTGISHEEALKMCFFEGYKEGQMLKSNRELSMTVRSPS***************************************************************KDTVRKVELNIEPGQSLGLMIRGGVEYNLGIFITGVDKDSVAERAGLLVSQLTLYQFIKEFLILSDHDKDFDTVISFSHEQTSPSMYGVQATLLSSSSGSIVITL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MADEEFAELGEINLSHEYLLRSGVGALHGNGGGAVWGRSPGSILPISQYRTMYHADQCRAAEAEDIMGHYNPRASHRSKAGLYYSPPGTSYTIVERPPPPPPVPLPQPPKPRGTYLGTNGSSYRTQPSSTEYRSNSPSNNTSSSYRNTSSHSHGTKKGALSPEQVLKMLTSGGGGKKSAEGSEEHHHHPRHRRLTPPDIDQLPVRTINMNRSQDANHGFGICVKGGANNPGVGVYISRVEEGSIAERAGLRPGDSILQVNGIPFTGISHEEALKMCFFEGYKEGQMLKSNRELSMTVRSPSIPPQAPRNHPLPPPPAWTMRQAYSWIDRQGRPCSPPLDYARSVIPMPPPPPPPPRWNYSARSSKDTVRKVELNIEPGQSLGLMIRGGVEYNLGIFITGVDKDSVAERAGLLVSQLTLYQFIKEFLILSDHDKDFDTVISFSHEQTSPSMYGVQATLLSSSSGSIVITL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query469 2.2.26 [Sep-21-2011]
Q80VW5 918 Whirlin OS=Mus musculus G yes N/A 0.439 0.224 0.370 1e-26
Q9P202 907 Whirlin OS=Homo sapiens G yes N/A 0.441 0.228 0.364 6e-26
Q810W9 920 Whirlin OS=Rattus norvegi yes N/A 0.437 0.222 0.360 1e-25
Q9H5P4 517 PDZ domain-containing pro no N/A 0.402 0.365 0.283 5e-13
Q5RBI7 528 PDZ domain-containing pro yes N/A 0.402 0.357 0.275 3e-12
A1A5G41107 Membrane-associated guany no N/A 0.430 0.182 0.282 3e-09
Q5EBL8140 PDZ domain-containing pro no N/A 0.204 0.685 0.368 1e-08
Q5ZIK2140 PDZ domain-containing pro no N/A 0.204 0.685 0.350 3e-08
Q6QA76140 PDZ domain-containing pro no N/A 0.204 0.685 0.350 6e-08
Q32LE7140 PDZ domain-containing pro no N/A 0.204 0.685 0.350 6e-08
>sp|Q80VW5|WHRN_MOUSE Whirlin OS=Mus musculus GN=Dfnb31 PE=1 SV=3 Back     alignment and function desciption
 Score =  121 bits (303), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 92/248 (37%), Positives = 127/248 (51%), Gaps = 42/248 (16%)

Query: 204 VRTINMNRSQDANHGFGICVKGGANNPGVGVYISRVEEGSIAERAGLRPGDSILQVNGIP 263
           VR +++ R++ A+ G G  ++GG+ + GVG+Y+S VE GS+AE+ GLR GD IL+VN   
Sbjct: 139 VRLVSLRRAK-AHEGLGFSIRGGSEH-GVGIYVSLVEPGSLAEKEGLRVGDQILRVNDKS 196

Query: 264 FTGISHEEALKMCFFEGYKEGQMLKSNRELSMTVRSPS-IPPQAPRNHPLPPPPAWTMRQ 322
              ++H EA+K            LK +++L ++V S   IP     NH            
Sbjct: 197 LARVTHAEAVKA-----------LKGSKKLVLSVYSAGRIPGGYVTNH------------ 233

Query: 323 AYSWIDRQGRPCSPPLDYARSVIPMPPPPPPPPRWNYSARSSKDTV------RKVELNIE 376
            Y+W+D QGR  SPP         +P P     R     R S   +      +KV L + 
Sbjct: 234 IYTWVDPQGRSTSPPSS-------LPQPHGSTLRQREDDRRSTLHLLQSGDEKKVNLVLG 286

Query: 377 PGQSLGLMIRGGVEYNLGIFITGVDKDSVAERAGLLVSQLTLYQFIKEFL-ILSDHDKDF 435
            G+SLGL IRGG EY LGI+ITGVD  S AE +GL V    L    + FL IL  HD+  
Sbjct: 287 DGRSLGLTIRGGAEYGLGIYITGVDPGSEAESSGLKVGDQILEVNGRSFLNIL--HDEAV 344

Query: 436 DTVISFSH 443
             + S  H
Sbjct: 345 KLLKSSRH 352
Necessary for elongation and maintenance of inner and outer hair cell stereocilia in the organ of Corti in the inner ear.
Mus musculus (taxid: 10090)
>sp|Q9P202|WHRN_HUMAN Whirlin OS=Homo sapiens GN=DFNB31 PE=1 SV=3 Back     alignment and function description
>sp|Q810W9|WHRN_RAT Whirlin OS=Rattus norvegicus GN=Dfnb31 PE=1 SV=1 Back     alignment and function description
>sp|Q9H5P4|PDZD7_HUMAN PDZ domain-containing protein 7 OS=Homo sapiens GN=PDZD7 PE=1 SV=1 Back     alignment and function description
>sp|Q5RBI7|PDZD7_PONAB PDZ domain-containing protein 7 OS=Pongo abelii GN=PDZD7 PE=2 SV=1 Back     alignment and function description
>sp|A1A5G4|MAGI3_XENTR Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Xenopus tropicalis GN=magi3 PE=2 SV=1 Back     alignment and function description
>sp|Q5EBL8|PDZ11_HUMAN PDZ domain-containing protein 11 OS=Homo sapiens GN=PDZD11 PE=1 SV=2 Back     alignment and function description
>sp|Q5ZIK2|PDZ11_CHICK PDZ domain-containing protein 11 OS=Gallus gallus GN=PDZD11 PE=2 SV=1 Back     alignment and function description
>sp|Q6QA76|PDZ11_PIG PDZ domain-containing protein 11 OS=Sus scrofa GN=PDZD11 PE=2 SV=1 Back     alignment and function description
>sp|Q32LE7|PDZ11_BOVIN PDZ domain-containing protein 11 OS=Bos taurus GN=PDZD11 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query469
328710190 746 PREDICTED: hypothetical protein LOC10016 0.778 0.489 0.457 3e-75
242013892536 whirlin, putative [Pediculus humanus cor 0.831 0.727 0.439 2e-72
221331148 866 dyschronic, isoform E [Drosophila melano 0.695 0.376 0.4 2e-62
221331144 864 dyschronic, isoform D [Drosophila melano 0.695 0.377 0.4 2e-62
221331146 689 dyschronic, isoform F [Drosophila melano 0.695 0.473 0.4 3e-62
221331142 990 dyschronic, isoform C [Drosophila melano 0.695 0.329 0.4 3e-62
442632180 986 dyschronic, isoform I [Drosophila melano 0.695 0.330 0.4 4e-62
442632176 1254 dyschronic, isoform G [Drosophila melano 0.695 0.259 0.4 4e-62
442632178 1015 dyschronic, isoform H [Drosophila melano 0.695 0.321 0.4 4e-62
125660220473 IP18016p [Drosophila melanogaster] 0.654 0.649 0.407 4e-61
>gi|328710190|ref|XP_001942736.2| PREDICTED: hypothetical protein LOC100168602 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  288 bits (738), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 202/442 (45%), Positives = 252/442 (57%), Gaps = 77/442 (17%)

Query: 36  WGRSPGS--------------ILPISQYRTMYHADQC----RAAEAEDIMGHY--NPRAS 75
           WGRSPGS              +LP+   RT   +       RAAEAED+MGHY       
Sbjct: 6   WGRSPGSSGSVPPSGQRTGHRLLPLPFNRTGGGSGSGGSGGRAAEAEDVMGHYGRTKGGV 65

Query: 76  HRSKAGLYYSPPGTSYTIVERPPPPPPVPLPQPPKPRGTYLGTNGSSYRTQPSSTEYRSN 135
           ++ + GLYYSPPGTSYTI+E+PP   P     PP PR TYL    S+  + P+     SN
Sbjct: 66  NKIRTGLYYSPPGTSYTILEKPPAASP----PPPPPRATYL-RESSAGVSGPNHPGTGSN 120

Query: 136 SPSNNTSSSYRNTSSHSHGTKKGALSPEQVLKMLTSGGGGKKSA-------------EGS 182
           S  +N      N  S     KK  +SPEQVLKM  +      S+              GS
Sbjct: 121 SNRSN------NAGSRGSSGKKRPISPEQVLKMFAAPNYNPSSSYHVSSAKPQSPPPHGS 174

Query: 183 EEHHHHPRHRRLTPPDIDQLPVRTINMNRSQD-----ANHGFGICVKGGANNPGVGVYIS 237
             +   P +   +    D L VRTI+M+R        +N GFGICVKGGA+   VGVYIS
Sbjct: 175 --NTSQPHNNTSSTIHNDNLTVRTISMSRPNATSGSPSNQGFGICVKGGADESNVGVYIS 232

Query: 238 RVEEGSIAERAGLRPGDSILQVNGIPFTGISHEEALKMCFFEGYKEGQMLKSNRELSMTV 297
           RVEEGSIAE  GL+PGDSIL+VNG PF+ ISHEEALK           + KS R+++MTV
Sbjct: 233 RVEEGSIAESVGLKPGDSILEVNGRPFSTISHEEALK-----------IFKSYRQITMTV 281

Query: 298 RSPSIPPQAPRNHP------LPPPPAWTMRQAYSWIDRQGRPCSPPLDYARSVIPMPPPP 351
           + PS P   P  H            AW + + YSWI+R+G+P SPPL+YA+       P 
Sbjct: 282 KCPSPPQSMPTMHKKDDDENTNQDDAWRLSRTYSWINRKGQPVSPPLEYAK-------PI 334

Query: 352 PPPPRWNYSARSSKDTVRKVELNIEPGQSLGLMIRGGVEYNLGIFITGVDKDSVAERAGL 411
            P  +W+Y+ RSSKD +RKVEL IEPGQSLGLMIRGG EYNLGIFITG+DK+SVA+R+GL
Sbjct: 335 SPYSKWSYT-RSSKDKIRKVELVIEPGQSLGLMIRGGTEYNLGIFITGIDKESVADRSGL 393

Query: 412 LVSQLTLYQFIKEFLILSDHDK 433
           ++    L    + FL LS HD+
Sbjct: 394 MIGDQILEVNGQSFLNLS-HDE 414

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|242013892|ref|XP_002427634.1| whirlin, putative [Pediculus humanus corporis] gi|212512055|gb|EEB14896.1| whirlin, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|221331148|ref|NP_001137947.1| dyschronic, isoform E [Drosophila melanogaster] gi|220902585|gb|ACL83302.1| dyschronic, isoform E [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|221331144|ref|NP_001097603.2| dyschronic, isoform D [Drosophila melanogaster] gi|220902583|gb|ABW08538.2| dyschronic, isoform D [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|221331146|ref|NP_001137946.1| dyschronic, isoform F [Drosophila melanogaster] gi|220902584|gb|ACL83301.1| dyschronic, isoform F [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|221331142|ref|NP_648668.3| dyschronic, isoform C [Drosophila melanogaster] gi|220902582|gb|AAF49791.3| dyschronic, isoform C [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|442632180|ref|NP_001261812.1| dyschronic, isoform I [Drosophila melanogaster] gi|440215749|gb|AGB94505.1| dyschronic, isoform I [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|442632176|ref|NP_001261810.1| dyschronic, isoform G [Drosophila melanogaster] gi|440215747|gb|AGB94503.1| dyschronic, isoform G [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|442632178|ref|NP_001261811.1| dyschronic, isoform H [Drosophila melanogaster] gi|440215748|gb|AGB94504.1| dyschronic, isoform H [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|125660220|gb|ABN49338.1| IP18016p [Drosophila melanogaster] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query469
FB|FBgn0264006 990 dysc "dyschronic" [Drosophila 0.204 0.096 0.625 1e-65
MGI|MGI:2682003 918 Whrn "whirlin" [Mus musculus ( 0.251 0.128 0.391 7.7e-22
UNIPROTKB|E2R2H6 927 DFNB31 "Uncharacterized protei 0.251 0.127 0.375 8.5e-22
RGD|631330 920 Dfnb31 "deafness, autosomal re 0.247 0.126 0.391 2.9e-21
UNIPROTKB|E1B914 918 LOC533033 "Uncharacterized pro 0.251 0.128 0.375 3.7e-21
UNIPROTKB|Q9P202 907 DFNB31 "Whirlin" [Homo sapiens 0.226 0.116 0.416 6.1e-21
UNIPROTKB|F1NVH8 824 F1NVH8 "Uncharacterized protei 0.170 0.097 0.470 3.5e-12
UNIPROTKB|Q9H5P4 517 PDZD7 "PDZ domain-containing p 0.147 0.133 0.388 1.3e-10
ZFIN|ZDB-GENE-090313-191 956 pdzd7a "PDZ domain containing 0.155 0.076 0.394 3.9e-10
UNIPROTKB|Q5EBL8140 PDZD11 "PDZ domain-containing 0.185 0.621 0.366 2.6e-08
FB|FBgn0264006 dysc "dyschronic" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 333 (122.3 bits), Expect = 1.0e-65, Sum P(4) = 1.0e-65
 Identities = 65/104 (62%), Positives = 84/104 (80%)

Query:   197 PDIDQLPVRTINMNRSQDANHGFGICVKGGANNPGVGVYISRVEEGSIAERAGLRPGDSI 256
             P+I +L  RT++M+R Q  +HGFGICVKGG ++ G+GVYISR+EE S+AERAGLRPGD+I
Sbjct:   287 PNIHELTTRTVSMSRDQQIDHGFGICVKGGKDS-GLGVYISRIEENSVAERAGLRPGDTI 345

Query:   257 LQVNGIPFTGISHEEALKMCFFEGYKEGQMLKSNRELSMTVRSP 300
             L+VNG PFT I+HEEALK C        Q+LKS+R++SMTVR+P
Sbjct:   346 LEVNGTPFTSINHEEALKRCV-------QILKSSRQISMTVRAP 382
GO:0003674 "molecular_function" evidence=ND
GO:0005575 "cellular_component" evidence=ND
GO:0046716 "muscle cell homeostasis" evidence=IGI;IMP
GO:0042052 "rhabdomere development" evidence=IMP
GO:0072499 "photoreceptor cell axon guidance" evidence=IMP
GO:0045475 "locomotor rhythm" evidence=IMP
GO:0032414 "positive regulation of ion transmembrane transporter activity" evidence=IMP
MGI|MGI:2682003 Whrn "whirlin" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E2R2H6 DFNB31 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|631330 Dfnb31 "deafness, autosomal recessive 31" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1B914 LOC533033 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q9P202 DFNB31 "Whirlin" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1NVH8 F1NVH8 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q9H5P4 PDZD7 "PDZ domain-containing protein 7" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-090313-191 pdzd7a "PDZ domain containing 7a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q5EBL8 PDZD11 "PDZ domain-containing protein 11" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query469
cd0099282 cd00992, PDZ_signaling, PDZ domain found in a vari 5e-22
smart0022885 smart00228, PDZ, Domain present in PSD-95, Dlg, an 8e-18
pfam0059580 pfam00595, PDZ, PDZ domain (Also known as DHR or G 2e-16
cd0013670 cd00136, PDZ, PDZ domain, also called DHR (Dlg hom 5e-14
cd0099282 cd00992, PDZ_signaling, PDZ domain found in a vari 2e-10
cd0098790 cd00987, PDZ_serine_protease, PDZ domain of tryspi 2e-09
cd0098979 cd00989, PDZ_metalloprotease, PDZ domain of bacter 3e-09
COG0793406 COG0793, Prc, Periplasmic protease [Cell envelope 1e-08
cd0098885 cd00988, PDZ_CTP_protease, PDZ domain of C-termina 2e-08
smart0022885 smart00228, PDZ, Domain present in PSD-95, Dlg, an 2e-07
pfam1318081 pfam13180, PDZ_2, PDZ domain 1e-05
TIGR02037428 TIGR02037, degP_htrA_DO, periplasmic serine protea 1e-05
pfam0059580 pfam00595, PDZ, PDZ domain (Also known as DHR or G 3e-04
TIGR02037428 TIGR02037, degP_htrA_DO, periplasmic serine protea 4e-04
cd0099080 cd00990, PDZ_glycyl_aminopeptidase, PDZ domain ass 0.003
COG0265347 COG0265, DegQ, Trypsin-like serine proteases, typi 0.003
TIGR00225334 TIGR00225, prc, C-terminal peptidase (prc) 0.004
>gnl|CDD|238492 cd00992, PDZ_signaling, PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information 
 Score = 89.5 bits (223), Expect = 5e-22
 Identities = 38/95 (40%), Positives = 59/95 (62%), Gaps = 13/95 (13%)

Query: 204 VRTINMNRSQDANHGFGICVKGGANNPGVGVYISRVEEGSIAERAGLRPGDSILQVNGIP 263
           VRT+ + +  D   G G  ++GG ++ G G+++SRVE G  AER GLR GD IL+VNG+ 
Sbjct: 1   VRTVTLRK--DPGGGLGFSLRGGKDSGG-GIFVSRVEPGGPAERGGLRVGDRILEVNGVS 57

Query: 264 FTGISHEEALKMCFFEGYKEGQMLKSNRELSMTVR 298
             G++HEEA+++          +  S  E+++TVR
Sbjct: 58  VEGLTHEEAVEL----------LKNSGDEVTLTVR 82

May be responsible for specific protein-protein interactions, as most PDZ domains bind C-terminal polypeptides, and binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. In this subfamily of PDZ domains an N-terminal beta-strand forms the peptide-binding groove base, a circular permutation with respect to PDZ domains found in proteases. Length = 82
>gnl|CDD|214570 smart00228, PDZ, Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>gnl|CDD|201332 pfam00595, PDZ, PDZ domain (Also known as DHR or GLGF) Back     alignment and domain information
>gnl|CDD|238080 cd00136, PDZ, PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>gnl|CDD|238492 cd00992, PDZ_signaling, PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
>gnl|CDD|238487 cd00987, PDZ_serine_protease, PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis Back     alignment and domain information
>gnl|CDD|238489 cd00989, PDZ_metalloprotease, PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>gnl|CDD|223864 COG0793, Prc, Periplasmic protease [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|238488 cd00988, PDZ_CTP_protease, PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts Back     alignment and domain information
>gnl|CDD|214570 smart00228, PDZ, Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>gnl|CDD|221961 pfam13180, PDZ_2, PDZ domain Back     alignment and domain information
>gnl|CDD|233695 TIGR02037, degP_htrA_DO, periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>gnl|CDD|201332 pfam00595, PDZ, PDZ domain (Also known as DHR or GLGF) Back     alignment and domain information
>gnl|CDD|233695 TIGR02037, degP_htrA_DO, periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>gnl|CDD|238490 cd00990, PDZ_glycyl_aminopeptidase, PDZ domain associated with archaeal and bacterial M61 glycyl-aminopeptidases Back     alignment and domain information
>gnl|CDD|223343 COG0265, DegQ, Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|232883 TIGR00225, prc, C-terminal peptidase (prc) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 469
KOG3209|consensus984 99.94
KOG3209|consensus 984 99.9
KOG3580|consensus 1027 99.77
KOG3580|consensus 1027 99.74
KOG3605|consensus829 99.55
TIGR02037428 degP_htrA_DO periplasmic serine protease, Do/DeqQ 99.47
PRK10942473 serine endoprotease; Provisional 99.42
PRK10139455 serine endoprotease; Provisional 99.39
PRK10779 449 zinc metallopeptidase RseP; Provisional 99.39
PF0059581 PDZ: PDZ domain (Also known as DHR or GLGF) Coordi 99.36
PF0059581 PDZ: PDZ domain (Also known as DHR or GLGF) Coordi 99.35
KOG3550|consensus207 99.25
KOG3551|consensus 506 99.23
TIGR00054 420 RIP metalloprotease RseP. A model that detects fra 99.2
KOG3550|consensus207 99.12
KOG3551|consensus 506 99.1
KOG3549|consensus 505 99.0
KOG3553|consensus124 98.99
cd0013670 PDZ PDZ domain, also called DHR (Dlg homologous re 98.98
cd0099282 PDZ_signaling PDZ domain found in a variety of Eum 98.98
cd0099282 PDZ_signaling PDZ domain found in a variety of Eum 98.97
KOG3549|consensus 505 98.94
smart0022885 PDZ Domain present in PSD-95, Dlg, and ZO-1/2. Als 98.87
cd0013670 PDZ PDZ domain, also called DHR (Dlg homologous re 98.83
PF1318082 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_ 98.79
cd0098885 PDZ_CTP_protease PDZ domain of C-terminal processi 98.77
KOG3553|consensus124 98.76
smart0022885 PDZ Domain present in PSD-95, Dlg, and ZO-1/2. Als 98.74
COG0793406 Prc Periplasmic protease [Cell envelope biogenesis 98.72
KOG3571|consensus 626 98.61
PLN00049389 carboxyl-terminal processing protease; Provisional 98.53
KOG3542|consensus 1283 98.52
PF1318082 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_ 98.51
TIGR00225334 prc C-terminal peptidase (prc). A C-terminal pepti 98.46
KOG1892|consensus 1629 98.46
PRK11186 667 carboxy-terminal protease; Provisional 98.46
KOG1892|consensus 1629 98.45
cd0098885 PDZ_CTP_protease PDZ domain of C-terminal processi 98.44
cd0099080 PDZ_glycyl_aminopeptidase PDZ domain associated wi 98.44
KOG3571|consensus 626 98.32
cd0099179 PDZ_archaeal_metalloprotease PDZ domain of archaea 98.29
cd0098979 PDZ_metalloprotease PDZ domain of bacterial and pl 98.29
KOG3651|consensus 429 98.24
KOG3542|consensus 1283 98.24
KOG3606|consensus358 98.22
cd0098979 PDZ_metalloprotease PDZ domain of bacterial and pl 98.13
cd0099179 PDZ_archaeal_metalloprotease PDZ domain of archaea 98.13
KOG3606|consensus358 98.12
cd0098790 PDZ_serine_protease PDZ domain of tryspin-like ser 98.09
cd0099080 PDZ_glycyl_aminopeptidase PDZ domain associated wi 98.05
KOG3552|consensus 1298 98.03
KOG3651|consensus 429 98.0
cd0098679 PDZ_LON_protease PDZ domain of ATP-dependent LON s 97.98
TIGR01713259 typeII_sec_gspC general secretion pathway protein 97.95
cd0098790 PDZ_serine_protease PDZ domain of tryspin-like ser 97.9
KOG3605|consensus829 97.85
KOG3552|consensus 1298 97.84
cd0098679 PDZ_LON_protease PDZ domain of ATP-dependent LON s 97.78
PLN00049 389 carboxyl-terminal processing protease; Provisional 97.76
TIGR00225 334 prc C-terminal peptidase (prc). A C-terminal pepti 97.75
PF04495138 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: 97.74
PRK10898353 serine endoprotease; Provisional 97.64
COG0793 406 Prc Periplasmic protease [Cell envelope biogenesis 97.63
TIGR02038351 protease_degS periplasmic serine pepetdase DegS. T 97.61
TIGR00054420 RIP metalloprotease RseP. A model that detects fra 97.55
TIGR01713259 typeII_sec_gspC general secretion pathway protein 97.53
TIGR02037428 degP_htrA_DO periplasmic serine protease, Do/DeqQ 97.51
KOG0609|consensus 542 97.51
PRK10139455 serine endoprotease; Provisional 97.45
KOG0609|consensus 542 97.42
KOG1421|consensus955 97.42
KOG3834|consensus 462 97.38
KOG4371|consensus1332 97.38
TIGR03279 433 cyano_FeS_chp putative FeS-containing Cyanobacteri 97.37
PRK10779449 zinc metallopeptidase RseP; Provisional 97.37
KOG1421|consensus 955 97.32
KOG3938|consensus334 97.28
PRK10942473 serine endoprotease; Provisional 97.25
PRK11186 667 carboxy-terminal protease; Provisional 97.24
TIGR02038351 protease_degS periplasmic serine pepetdase DegS. T 97.22
PRK10898353 serine endoprotease; Provisional 97.14
KOG0606|consensus 1205 97.12
TIGR02860402 spore_IV_B stage IV sporulation protein B. SpoIVB, 97.08
KOG4407|consensus 1973 97.07
PF04495138 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: 97.03
KOG3129|consensus231 97.0
TIGR03279 433 cyano_FeS_chp putative FeS-containing Cyanobacteri 96.81
COG3975558 Predicted protease with the C-terminal PDZ domain 96.74
PF1468588 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6 96.67
KOG3938|consensus 334 96.38
PRK09681276 putative type II secretion protein GspC; Provision 96.36
KOG1320|consensus473 96.34
COG0265347 DegQ Trypsin-like serine proteases, typically peri 96.28
TIGR02860 402 spore_IV_B stage IV sporulation protein B. SpoIVB, 96.08
COG3975558 Predicted protease with the C-terminal PDZ domain 95.95
KOG0606|consensus 1205 95.74
KOG1320|consensus473 95.57
KOG3129|consensus231 95.54
PF1468588 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6 95.31
COG0265347 DegQ Trypsin-like serine proteases, typically peri 95.1
KOG1738|consensus 638 95.02
KOG4371|consensus1332 94.73
KOG1738|consensus 638 94.49
KOG3532|consensus 1051 94.31
COG3031275 PulC Type II secretory pathway, component PulC [In 93.43
PF1281278 PDZ_1: PDZ-like domain 93.18
COG3480342 SdrC Predicted secreted protein containing a PDZ d 93.03
KOG3532|consensus 1051 92.31
COG3480 342 SdrC Predicted secreted protein containing a PDZ d 91.6
KOG3834|consensus 462 91.35
PRK09681276 putative type II secretion protein GspC; Provision 91.3
COG3031275 PulC Type II secretory pathway, component PulC [In 84.67
PF1281278 PDZ_1: PDZ-like domain 83.91
KOG4407|consensus 1973 81.92
COG0750 375 Predicted membrane-associated Zn-dependent proteas 81.04
>KOG3209|consensus Back     alignment and domain information 
Probab=99.94  E-value=2.7e-26  Score=241.78  Aligned_cols=248  Identities=25%  Similarity=0.407  Sum_probs=166.0

Q ss_pred             CCHHHHHHHhhcCCCCCC-------CCCCCCCCCCCCCCCCCCcccCCCCCeEEEEEecCCCCcceEEEEEEcCCCCCCC
Q psy14977        160 LSPEQVLKMLTSGGGGKK-------SAEGSEEHHHHPRHRRLTPPDIDQLPVRTINMNRSQDANHGFGICVKGGANNPGV  232 (469)
Q Consensus       160 ~S~eq~l~~~~~~~~~~~-------s~~~s~~~~~~p~~~~~~~~~~~~~~~~~V~L~r~~~~~~GlGf~i~gg~~~~~~  232 (469)
                      -||.+|++++..+..+.-       ... ...+.+.|.      .+.....+..|.|+|.+  +.||||.|......+..
T Consensus       710 ksH~~vv~Lm~~AArnghV~LtVRRkv~-~~~~~rsp~------~s~~~~~~yDV~lhR~E--NeGFGFVi~sS~~kp~s  780 (984)
T KOG3209|consen  710 KSHSEVVDLMEAAARNGHVNLTVRRKVR-TGPARRSPR------NSAAPSGPYDVVLHRKE--NEGFGFVIMSSQNKPES  780 (984)
T ss_pred             ccHHHHHHHHHHHHhcCceEEEEeeeee-eccccCCcc------cccCCCCCeeeEEeccc--CCceeEEEEecccCCCC
Confidence            389999999987776321       000 000111111      12222335679999984  79999999998876555


Q ss_pred             cEEEEEeCCCCHHHHcC-CCCCCEEEEECCEEcCCCCHHHHHHHhhhcCcccceEeecCcEEEEEEECCCCCCCC---CC
Q psy14977        233 GVYISRVEEGSIAERAG-LRPGDSILQVNGIPFTGISHEEALKMCFFEGYKEGQMLKSNRELSMTVRSPSIPPQA---PR  308 (469)
Q Consensus       233 gi~V~~V~pgspA~~aG-L~~GD~Il~VNG~~v~~~s~~~av~~ir~~~~~~~~Ilr~g~~v~l~V~~~~~~~~~---~~  308 (469)
                      +  |.+|.+|+||+++| |++||+|++|||+.|.+++|.+++++||          ..|-.|+|+|.........   ..
T Consensus       781 g--iGrIieGSPAdRCgkLkVGDrilAVNG~sI~~lsHadiv~LIK----------daGlsVtLtIip~ee~~~~~~~~s  848 (984)
T KOG3209|consen  781 G--IGRIIEGSPADRCGKLKVGDRILAVNGQSILNLSHADIVSLIK----------DAGLSVTLTIIPPEEAGPPTSMTS  848 (984)
T ss_pred             C--ccccccCChhHhhccccccceEEEecCeeeeccCchhHHHHHH----------hcCceEEEEEcChhccCCCCCCcc
Confidence            5  99999999999999 9999999999999999999999999976          5578899998765432111   11


Q ss_pred             CCCCCCCCcccccccccccccCCCCCCCCCCccCCCCCCCCCCCCCCCCcccc----CCCCCcceEEEEEecCCC-cccE
Q psy14977        309 NHPLPPPPAWTMRQAYSWIDRQGRPCSPPLDYARSVIPMPPPPPPPPRWNYSA----RSSKDTVRKVELNIEPGQ-SLGL  383 (469)
Q Consensus       309 ~~~~~~~~~~~~~~~~s~~~~~~~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~----~~~~~~~~~V~L~~~~g~-~LGf  383 (469)
                      .+.+.+....   ..  .....+-+...+.-+...    ++    +..+.+..    .........|+|  +++. +|||
T Consensus       849 a~~~s~~t~~---~~--~~q~~glp~~~~s~~~~~----pq----pdt~~~~~~~~r~~qn~~~~~Vel--ErG~kGFGF  913 (984)
T KOG3209|consen  849 AEKQSPFTQN---GP--YEQQYGLPGPRPSVYEEH----PQ----PDTFQGLSINDRMSQNGDLYTVEL--ERGAKGFGF  913 (984)
T ss_pred             hhhcCccccc---CC--HhHccCCCCCCccccccC----CC----CccccceeccccccccCCeeEEEe--eccccccce
Confidence            1111111100   00  000000000000000000    01    11122211    111224555555  6665 9999


Q ss_pred             EEecccccCCcEEEEEecCCCHHHHcC-CCCCcEEEEEecEEecCcchHHHHHHHHHhCCCc
Q psy14977        384 MIRGGVEYNLGIFITGVDKDSVAERAG-LLVSQLTLYQFIKEFLILSDHDKDFDTVISFSHE  444 (469)
Q Consensus       384 si~Gg~e~~~GI~V~~V~pgs~A~~aG-Lr~GD~IL~VNG~sv~~~s~h~eav~~Lk~~g~~  444 (469)
                      +|+||.+|+.++||-.+.+++||.++| |++||+|++|||+++++|+ |+.|+++||+.+..
T Consensus       914 SiRGGreynM~LfVLRlAeDGPA~rdGrm~VGDqi~eINGesTkgmt-H~rAIelIk~gg~~  974 (984)
T KOG3209|consen  914 SIRGGREYNMDLFVLRLAEDGPAIRDGRMRVGDQITEINGESTKGMT-HDRAIELIKQGGRR  974 (984)
T ss_pred             EeecccccccceEEEEeccCCCccccCceeecceEEEecCcccCCCc-HHHHHHHHHhCCeE
Confidence            999999999999999999999999999 9999999999999999999 99999999998763

>KOG3209|consensus Back     alignment and domain information
>KOG3580|consensus Back     alignment and domain information
>KOG3580|consensus Back     alignment and domain information
>KOG3605|consensus Back     alignment and domain information
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information
>PRK10779 zinc metallopeptidase RseP; Provisional Back     alignment and domain information
>PF00595 PDZ: PDZ domain (Also known as DHR or GLGF) Coordinates are not yet available; InterPro: IPR001478 PDZ domains are found in diverse signalling proteins in bacteria, yeasts, plants, insects and vertebrates [, ] Back     alignment and domain information
>PF00595 PDZ: PDZ domain (Also known as DHR or GLGF) Coordinates are not yet available; InterPro: IPR001478 PDZ domains are found in diverse signalling proteins in bacteria, yeasts, plants, insects and vertebrates [, ] Back     alignment and domain information
>KOG3550|consensus Back     alignment and domain information
>KOG3551|consensus Back     alignment and domain information
>TIGR00054 RIP metalloprotease RseP Back     alignment and domain information
>KOG3550|consensus Back     alignment and domain information
>KOG3551|consensus Back     alignment and domain information
>KOG3549|consensus Back     alignment and domain information
>KOG3553|consensus Back     alignment and domain information
>cd00136 PDZ PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>cd00992 PDZ_signaling PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
>cd00992 PDZ_signaling PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
>KOG3549|consensus Back     alignment and domain information
>smart00228 PDZ Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>cd00136 PDZ PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>PF13180 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_A 2PZD_B 2P3W_A 1VCW_C 1TE0_B 1SOZ_C 1SOT_C Back     alignment and domain information
>cd00988 PDZ_CTP_protease PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts Back     alignment and domain information
>KOG3553|consensus Back     alignment and domain information
>smart00228 PDZ Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>COG0793 Prc Periplasmic protease [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG3571|consensus Back     alignment and domain information
>PLN00049 carboxyl-terminal processing protease; Provisional Back     alignment and domain information
>KOG3542|consensus Back     alignment and domain information
>PF13180 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_A 2PZD_B 2P3W_A 1VCW_C 1TE0_B 1SOZ_C 1SOT_C Back     alignment and domain information
>TIGR00225 prc C-terminal peptidase (prc) Back     alignment and domain information
>KOG1892|consensus Back     alignment and domain information
>PRK11186 carboxy-terminal protease; Provisional Back     alignment and domain information
>KOG1892|consensus Back     alignment and domain information
>cd00988 PDZ_CTP_protease PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts Back     alignment and domain information
>cd00990 PDZ_glycyl_aminopeptidase PDZ domain associated with archaeal and bacterial M61 glycyl-aminopeptidases Back     alignment and domain information
>KOG3571|consensus Back     alignment and domain information
>cd00991 PDZ_archaeal_metalloprotease PDZ domain of archaeal zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>cd00989 PDZ_metalloprotease PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>KOG3651|consensus Back     alignment and domain information
>KOG3542|consensus Back     alignment and domain information
>KOG3606|consensus Back     alignment and domain information
>cd00989 PDZ_metalloprotease PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>cd00991 PDZ_archaeal_metalloprotease PDZ domain of archaeal zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>KOG3606|consensus Back     alignment and domain information
>cd00987 PDZ_serine_protease PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis Back     alignment and domain information
>cd00990 PDZ_glycyl_aminopeptidase PDZ domain associated with archaeal and bacterial M61 glycyl-aminopeptidases Back     alignment and domain information
>KOG3552|consensus Back     alignment and domain information
>KOG3651|consensus Back     alignment and domain information
>cd00986 PDZ_LON_protease PDZ domain of ATP-dependent LON serine proteases Back     alignment and domain information
>TIGR01713 typeII_sec_gspC general secretion pathway protein C Back     alignment and domain information
>cd00987 PDZ_serine_protease PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis Back     alignment and domain information
>KOG3605|consensus Back     alignment and domain information
>KOG3552|consensus Back     alignment and domain information
>cd00986 PDZ_LON_protease PDZ domain of ATP-dependent LON serine proteases Back     alignment and domain information
>PLN00049 carboxyl-terminal processing protease; Provisional Back     alignment and domain information
>TIGR00225 prc C-terminal peptidase (prc) Back     alignment and domain information
>PF04495 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: IPR007583 GRASP55 (Golgi reassembly stacking protein of 55 kDa) and GRASP65 (a 65 kDa) protein are highly homologous Back     alignment and domain information
>PRK10898 serine endoprotease; Provisional Back     alignment and domain information
>COG0793 Prc Periplasmic protease [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR02038 protease_degS periplasmic serine pepetdase DegS Back     alignment and domain information
>TIGR00054 RIP metalloprotease RseP Back     alignment and domain information
>TIGR01713 typeII_sec_gspC general secretion pathway protein C Back     alignment and domain information
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>KOG0609|consensus Back     alignment and domain information
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information
>KOG0609|consensus Back     alignment and domain information
>KOG1421|consensus Back     alignment and domain information
>KOG3834|consensus Back     alignment and domain information
>KOG4371|consensus Back     alignment and domain information
>TIGR03279 cyano_FeS_chp putative FeS-containing Cyanobacterial-specific oxidoreductase Back     alignment and domain information
>PRK10779 zinc metallopeptidase RseP; Provisional Back     alignment and domain information
>KOG1421|consensus Back     alignment and domain information
>KOG3938|consensus Back     alignment and domain information
>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>PRK11186 carboxy-terminal protease; Provisional Back     alignment and domain information
>TIGR02038 protease_degS periplasmic serine pepetdase DegS Back     alignment and domain information
>PRK10898 serine endoprotease; Provisional Back     alignment and domain information
>KOG0606|consensus Back     alignment and domain information
>TIGR02860 spore_IV_B stage IV sporulation protein B Back     alignment and domain information
>KOG4407|consensus Back     alignment and domain information
>PF04495 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: IPR007583 GRASP55 (Golgi reassembly stacking protein of 55 kDa) and GRASP65 (a 65 kDa) protein are highly homologous Back     alignment and domain information
>KOG3129|consensus Back     alignment and domain information
>TIGR03279 cyano_FeS_chp putative FeS-containing Cyanobacterial-specific oxidoreductase Back     alignment and domain information
>COG3975 Predicted protease with the C-terminal PDZ domain [General function prediction only] Back     alignment and domain information
>PF14685 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6F_D 1N6D_C 1N6E_C 1K32_A Back     alignment and domain information
>KOG3938|consensus Back     alignment and domain information
>PRK09681 putative type II secretion protein GspC; Provisional Back     alignment and domain information
>KOG1320|consensus Back     alignment and domain information
>COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02860 spore_IV_B stage IV sporulation protein B Back     alignment and domain information
>COG3975 Predicted protease with the C-terminal PDZ domain [General function prediction only] Back     alignment and domain information
>KOG0606|consensus Back     alignment and domain information
>KOG1320|consensus Back     alignment and domain information
>KOG3129|consensus Back     alignment and domain information
>PF14685 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6F_D 1N6D_C 1N6E_C 1K32_A Back     alignment and domain information
>COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1738|consensus Back     alignment and domain information
>KOG4371|consensus Back     alignment and domain information
>KOG1738|consensus Back     alignment and domain information
>KOG3532|consensus Back     alignment and domain information
>COG3031 PulC Type II secretory pathway, component PulC [Intracellular trafficking and secretion] Back     alignment and domain information
>PF12812 PDZ_1: PDZ-like domain Back     alignment and domain information
>COG3480 SdrC Predicted secreted protein containing a PDZ domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG3532|consensus Back     alignment and domain information
>COG3480 SdrC Predicted secreted protein containing a PDZ domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG3834|consensus Back     alignment and domain information
>PRK09681 putative type II secretion protein GspC; Provisional Back     alignment and domain information
>COG3031 PulC Type II secretory pathway, component PulC [Intracellular trafficking and secretion] Back     alignment and domain information
>PF12812 PDZ_1: PDZ-like domain Back     alignment and domain information
>KOG4407|consensus Back     alignment and domain information
>COG0750 Predicted membrane-associated Zn-dependent proteases 1 [Cell envelope biogenesis, outer membrane] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query469
1uez_A101 Solution Structure Of The First Pdz Domain Of Human 2e-10
1uf1_A128 Solution Structure Of The Second Pdz Domain Of Huma 3e-09
1uf1_A128 Solution Structure Of The Second Pdz Domain Of Huma 6e-08
1wi2_A104 Solution Structure Of The Pdz Domain From Riken Cdn 2e-07
1wi2_A104 Solution Structure Of The Pdz Domain From Riken Cdn 6e-04
2eeh_A100 Solution Structure Of First Pdz Domain Of Pdz Domai 4e-07
2eeh_A100 Solution Structure Of First Pdz Domain Of Pdz Domai 2e-05
2w4f_A97 Crystal Structure Of The First Pdz Domain Of Human 3e-06
2vz5_A139 Structure Of The Pdz Domain Of Tax1 (Human T-Cell L 4e-06
3diw_A124 C-Terminal Beta-Catenin Bound Tip-1 Structure Lengt 4e-06
3gj9_A124 Crystal Structure Of Tip-1 In Complex With C-Termin 5e-06
2kg2_A124 Solution Structure Of A Pdz Protein Length = 124 5e-06
3dj3_A113 Crystal Structure Of C-Terminal Truncated Tip-1 (6- 5e-06
1x5q_A110 Solution Structure Of The First Pdz Domain Of Scrib 7e-06
3sfj_A104 Crystal Structure Of Tax-Interacting Protein-1 (Tip 7e-06
4e3b_A102 Crystal Structure Of Tax-Interacting Protein-1 (Tip 7e-06
1x5n_A114 Solution Structure Of The Second Pdz Domain Of Harm 7e-06
2kbs_A92 Solution Structure Of Harmonin Pdz2 In Complex With 7e-06
2jil_A97 Crystal Structure Of 2nd Pdz Domain Of Glutamate Re 3e-05
3k1r_A192 Structure Of Harmonin Npdz1 In Complex With The Sam 5e-05
2dkr_A93 Solution Structure Of The Pdz Domain From Human Lin 6e-05
2qt5_A200 Crystal Structure Of Grip1 Pdz12 In Complex With Th 7e-05
2kaw_A90 Nmr Structure Of The Mdvl1 Pdz Domain In Complex Wi 9e-05
2omj_A89 Solution Structure Of Larg Pdz Domain Length = 89 1e-04
1mc7_A95 Solution Structure Of Mdvl1 Pdz Domain Length = 95 1e-04
3shw_A 468 Crystal Structure Of Zo-1 Pdz3-Sh3-Guk Supramodule 1e-04
4e34_A87 Crystal Structure Of Cftr Associated Ligand (Cal) P 1e-04
2dc2_A103 Solution Structure Of Pdz Domain Length = 103 2e-04
3tsw_A 391 Crystal Structure Of The Pdz3-Sh3-Guk Core Module O 2e-04
2lob_A112 Pdz Domain Of Cal (Cystic Fibrosis Transmembrane Re 3e-04
3tsw_B194 Crystal Structure Of The Pdz3-Sh3-Guk Core Module O 3e-04
3tsv_A124 Crystal Structure Of The Third Pdz Domain Of The Hu 3e-04
3shu_A95 Crystal Structure Of Zo-1 Pdz3 Length = 95 3e-04
2dm8_A116 Solution Structure Of The Eighth Pdz Domain Of Huma 3e-04
2ego_A96 Crystal Structure Of Tamalin Pdz Domain Length = 96 5e-04
2yub_A118 Solution Structure Of The Pdz Domain From Mouse Lim 5e-04
1wh1_A124 Solution Structure Of The Fourth Pdz Domain Of Kiaa 5e-04
2egk_A101 Crystal Structure Of Tamalin Pdz-Intrinsic Ligand F 5e-04
1wha_A105 Solution Structure Of The Second Pdz Domain Of Huma 6e-04
2pnt_A98 Crystal Structure Of The Pdz Domain Of Human Grasp 6e-04
2ocs_A88 The Crystal Structure Of The First Pdz Domain Of Hu 7e-04
2wl7_A102 Crystal Structure Of The Psd93 Pdz1 Domain Length = 7e-04
2vrf_A95 Crystal Structure Of The Human Beta-2-Syntrophin Pd 8e-04
2jik_A101 Crystal Structure Of Pdz Domain Of Synaptojanin-2 B 8e-04
2css_A121 Solution Structure Of The Pdz Domain Of Human Kiaa0 8e-04
2jin_A102 Crystal Structure Of Pdz Domain Of Synaptojanin-2 B 9e-04
2dls_A93 Solution Structure Of The Pdz Domain Of Human Rho G 9e-04
2xkx_A 721 Single Particle Analysis Of Psd-95 In Negative Stai 9e-04
>pdb|1UEZ|A Chain A, Solution Structure Of The First Pdz Domain Of Human Kiaa1526 Protein Length = 101 Back     alignment and structure 
Iteration: 1

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 60/97 (61%), Gaps = 13/97 (13%)
Query: 204 VRTINMNRSQDANHGFGICVKGGANNPGVGVYISRVEEGSIAERAGLRPGDSILQVNGIP 263
           VR +++ R++ A+ G G  ++GG+ + GVG+Y+S VE GS+AE+ GLR GD IL+VN   
Sbjct: 9   VRLVSLRRAK-AHEGLGFSIRGGSEH-GVGIYVSLVEPGSLAEKEGLRVGDQILRVNDKS 66
Query: 264 FTGISHEEALKMCFFEGYKEGQMLKSNRELSMTVRSP 300
              ++H EA+K            LK +++L ++V S 
Sbjct: 67  LARVTHAEAVK-----------ALKGSKKLVLSVYSA 92
>pdb|1UF1|A Chain A, Solution Structure Of The Second Pdz Domain Of Human Kiaa1526 Protein Length = 128 Back     alignment and structure
>pdb|1UF1|A Chain A, Solution Structure Of The Second Pdz Domain Of Human Kiaa1526 Protein Length = 128 Back     alignment and structure
>pdb|1WI2|A Chain A, Solution Structure Of The Pdz Domain From Riken Cdna 2700099c19 Length = 104 Back     alignment and structure
>pdb|1WI2|A Chain A, Solution Structure Of The Pdz Domain From Riken Cdna 2700099c19 Length = 104 Back     alignment and structure
>pdb|2EEH|A Chain A, Solution Structure Of First Pdz Domain Of Pdz Domain Containing Protein 7 Length = 100 Back     alignment and structure
>pdb|2EEH|A Chain A, Solution Structure Of First Pdz Domain Of Pdz Domain Containing Protein 7 Length = 100 Back     alignment and structure
>pdb|2W4F|A Chain A, Crystal Structure Of The First Pdz Domain Of Human Scrib1 Length = 97 Back     alignment and structure
>pdb|2VZ5|A Chain A, Structure Of The Pdz Domain Of Tax1 (Human T-Cell Leukemia Virus Type I) Binding Protein 3 Length = 139 Back     alignment and structure
>pdb|3DIW|A Chain A, C-Terminal Beta-Catenin Bound Tip-1 Structure Length = 124 Back     alignment and structure
>pdb|3GJ9|A Chain A, Crystal Structure Of Tip-1 In Complex With C-Terminal Of Kir2.3 Length = 124 Back     alignment and structure
>pdb|2KG2|A Chain A, Solution Structure Of A Pdz Protein Length = 124 Back     alignment and structure
>pdb|3DJ3|A Chain A, Crystal Structure Of C-Terminal Truncated Tip-1 (6-113) Length = 113 Back     alignment and structure
>pdb|1X5Q|A Chain A, Solution Structure Of The First Pdz Domain Of Scribble Homolog Protein (Hscrib) Length = 110 Back     alignment and structure
>pdb|3SFJ|A Chain A, Crystal Structure Of Tax-Interacting Protein-1 (Tip-1) Pdz Domain Bound To Ical36 Inhibitor Peptide Length = 104 Back     alignment and structure
>pdb|4E3B|A Chain A, Crystal Structure Of Tax-Interacting Protein-1 (Tip-1) Pdz Domain Bound To Ical36-L (Ansrwptsil) Peptide Length = 102 Back     alignment and structure
>pdb|1X5N|A Chain A, Solution Structure Of The Second Pdz Domain Of Harmonin Protein Length = 114 Back     alignment and structure
>pdb|2KBS|A Chain A, Solution Structure Of Harmonin Pdz2 In Complex With The Carboxyl Tail Peptide Of Cadherin23 Length = 92 Back     alignment and structure
>pdb|2JIL|A Chain A, Crystal Structure Of 2nd Pdz Domain Of Glutamate Receptor Interacting Protein-1 (Grip1) Length = 97 Back     alignment and structure
>pdb|3K1R|A Chain A, Structure Of Harmonin Npdz1 In Complex With The Sam-Pbm Of Sans Length = 192 Back     alignment and structure
>pdb|2DKR|A Chain A, Solution Structure Of The Pdz Domain From Human Lin-7 Homolog B Length = 93 Back     alignment and structure
>pdb|2QT5|A Chain A, Crystal Structure Of Grip1 Pdz12 In Complex With The Fras1 Peptide Length = 200 Back     alignment and structure
>pdb|2KAW|A Chain A, Nmr Structure Of The Mdvl1 Pdz Domain In Complex With Its Inhibitor Length = 90 Back     alignment and structure
>pdb|2OMJ|A Chain A, Solution Structure Of Larg Pdz Domain Length = 89 Back     alignment and structure
>pdb|1MC7|A Chain A, Solution Structure Of Mdvl1 Pdz Domain Length = 95 Back     alignment and structure
>pdb|3SHW|A Chain A, Crystal Structure Of Zo-1 Pdz3-Sh3-Guk Supramodule Complex With Connexin-45 Peptide Length = 468 Back     alignment and structure
>pdb|4E34|A Chain A, Crystal Structure Of Cftr Associated Ligand (Cal) Pdz Domain Bound To Ical36 (Ansrwptsii) Peptide Length = 87 Back     alignment and structure
>pdb|2DC2|A Chain A, Solution Structure Of Pdz Domain Length = 103 Back     alignment and structure
>pdb|3TSW|A Chain A, Crystal Structure Of The Pdz3-Sh3-Guk Core Module Of Human Zo-1 Length = 391 Back     alignment and structure
>pdb|2LOB|A Chain A, Pdz Domain Of Cal (Cystic Fibrosis Transmembrane Regulator-Associated Ligand) Length = 112 Back     alignment and structure
>pdb|3TSV|A Chain A, Crystal Structure Of The Third Pdz Domain Of The Human Zo-1 Maguk Protein Length = 124 Back     alignment and structure
>pdb|3SHU|A Chain A, Crystal Structure Of Zo-1 Pdz3 Length = 95 Back     alignment and structure
>pdb|2DM8|A Chain A, Solution Structure Of The Eighth Pdz Domain Of Human Inad- Like Protein Length = 116 Back     alignment and structure
>pdb|2EGO|A Chain A, Crystal Structure Of Tamalin Pdz Domain Length = 96 Back     alignment and structure
>pdb|2YUB|A Chain A, Solution Structure Of The Pdz Domain From Mouse Lim Domain Kinase Length = 118 Back     alignment and structure
>pdb|1WH1|A Chain A, Solution Structure Of The Fourth Pdz Domain Of Kiaa1095 Protein Length = 124 Back     alignment and structure
>pdb|2EGK|A Chain A, Crystal Structure Of Tamalin Pdz-Intrinsic Ligand Fusion Protein Length = 101 Back     alignment and structure
>pdb|1WHA|A Chain A, Solution Structure Of The Second Pdz Domain Of Human Scribble (Kiaa0147 Protein) Length = 105 Back     alignment and structure
>pdb|2PNT|A Chain A, Crystal Structure Of The Pdz Domain Of Human Grasp (Grp1) In Complex With The C-Terminal Peptide Of The Metabotropic Glutamate Receptor Type 1 Length = 98 Back     alignment and structure
>pdb|2OCS|A Chain A, The Crystal Structure Of The First Pdz Domain Of Human Nherf-2 (slc9a3r2) Length = 88 Back     alignment and structure
>pdb|2WL7|A Chain A, Crystal Structure Of The Psd93 Pdz1 Domain Length = 102 Back     alignment and structure
>pdb|2VRF|A Chain A, Crystal Structure Of The Human Beta-2-Syntrophin Pdz Domain Length = 95 Back     alignment and structure
>pdb|2JIK|A Chain A, Crystal Structure Of Pdz Domain Of Synaptojanin-2 Binding Protein Length = 101 Back     alignment and structure
>pdb|2CSS|A Chain A, Solution Structure Of The Pdz Domain Of Human Kiaa0340 Protein Length = 121 Back     alignment and structure
>pdb|2JIN|A Chain A, Crystal Structure Of Pdz Domain Of Synaptojanin-2 Binding Protein Length = 102 Back     alignment and structure
>pdb|2DLS|A Chain A, Solution Structure Of The Pdz Domain Of Human Rho Guanine Nucleotide Exchange Factor 11 Length = 93 Back     alignment and structure
>pdb|2XKX|A Chain A, Single Particle Analysis Of Psd-95 In Negative Stain Length = 721 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query469
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 3e-25
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 1e-12
2eeh_A100 PDZ domain-containing protein 7; structural genomi 4e-25
2eeh_A100 PDZ domain-containing protein 7; structural genomi 4e-12
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 1e-24
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 9e-12
3k1r_A192 Harmonin; protein-protein complex, alternative spl 7e-24
3k1r_A192 Harmonin; protein-protein complex, alternative spl 1e-13
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 8e-23
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 2e-11
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 3e-22
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 3e-17
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 3e-22
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 2e-12
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducin 2e-21
2eaq_A90 LIM domain only protein 7; conserved hypothetical 2e-21
2eaq_A90 LIM domain only protein 7; conserved hypothetical 7e-07
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 2e-20
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 9e-08
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 2e-20
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 6e-20
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 7e-20
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 4e-05
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 1e-19
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 8e-07
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 2e-19
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 4e-11
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 3e-19
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 6e-11
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 3e-19
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 6e-08
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 3e-19
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 1e-04
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 4e-19
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 2e-07
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 4e-19
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 2e-05
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 5e-19
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 5e-19
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 2e-06
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 6e-19
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 1e-05
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 6e-19
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 3e-08
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 7e-19
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 4e-05
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 7e-19
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 2e-08
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 8e-19
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 3e-07
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 1e-18
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 3e-05
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 1e-18
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 1e-04
2v90_A96 PDZ domain-containing protein 3; membrane, protein 2e-18
2v90_A96 PDZ domain-containing protein 3; membrane, protein 2e-04
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 2e-18
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 3e-11
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 2e-18
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 1e-05
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 3e-18
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 2e-05
2ego_A96 General receptor for phosphoinositides 1- associat 3e-18
2ego_A96 General receptor for phosphoinositides 1- associat 1e-05
2opg_A98 Multiple PDZ domain protein; structural protein, s 3e-18
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 3e-18
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 1e-04
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 3e-18
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 7e-08
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 3e-18
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 4e-18
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 8e-07
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 5e-18
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 5e-08
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 5e-18
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 1e-06
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 6e-18
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 8e-18
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 6e-07
2eei_A106 PDZ domain-containing protein 1; regulatory factor 8e-18
2eei_A106 PDZ domain-containing protein 1; regulatory factor 8e-05
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 1e-17
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 1e-17
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 8e-05
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 1e-17
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 1e-17
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 8e-05
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 2e-17
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 2e-16
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 1e-07
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 7e-05
2d90_A102 PDZ domain containing protein 1; structural genomi 2e-17
2d90_A102 PDZ domain containing protein 1; structural genomi 7e-05
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 2e-17
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 8e-08
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 2e-17
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 1e-05
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 2e-17
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 2e-04
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 3e-17
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 1e-07
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 4e-17
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 3e-07
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 6e-17
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 1e-05
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 6e-17
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 2e-06
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 7e-17
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 2e-06
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 7e-17
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 3e-05
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 7e-17
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 2e-06
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 9e-17
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 3e-15
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 1e-04
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 1e-16
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 1e-16
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 7e-04
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 1e-16
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 1e-16
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 2e-04
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 1e-16
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 9e-05
2fne_A117 Multiple PDZ domain protein; structural protein, s 1e-16
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 1e-16
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 8e-07
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 2e-16
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 7e-06
3khf_A99 Microtubule-associated serine/threonine-protein ki 2e-16
2byg_A117 Channel associated protein of synapse-110; DLG2, P 2e-16
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 2e-16
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 4e-06
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 2e-16
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 2e-16
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 3e-16
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 4e-05
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 3e-16
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 4e-16
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 3e-04
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 4e-16
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 4e-16
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 1e-04
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 4e-16
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 7e-06
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 5e-16
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 7e-07
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 1e-05
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 5e-16
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 1e-04
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 5e-16
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 2e-04
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 5e-16
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 1e-04
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 6e-16
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 7e-15
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 4e-13
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 3e-04
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 8e-16
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 4e-08
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 8e-16
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 1e-04
2djt_A104 Unnamed protein product; PDZ domain, structural ge 8e-16
2djt_A104 Unnamed protein product; PDZ domain, structural ge 3e-04
2krg_A216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 9e-16
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 1e-15
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 1e-15
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 2e-05
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 1e-15
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 4e-07
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 1e-15
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 6e-07
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 2e-15
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 2e-15
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 2e-15
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 7e-04
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 2e-15
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 8e-04
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 3e-15
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 2e-07
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 3e-15
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 3e-15
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 4e-04
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 4e-15
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 4e-15
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 2e-04
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 5e-15
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 6e-06
2awx_A105 Synapse associated protein 97; membrane protein, s 5e-15
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 5e-15
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 5e-15
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 5e-04
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 6e-15
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 2e-07
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 7e-15
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 7e-15
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 7e-15
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 9e-15
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 6e-04
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 1e-14
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 2e-04
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 1e-14
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 1e-14
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 5e-07
3tsz_A 391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 1e-14
3tsz_A 391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 8e-05
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 1e-14
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 1e-14
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 2e-14
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 4e-06
2o2t_A117 Multiple PDZ domain protein; structural protein, s 2e-14
2o2t_A117 Multiple PDZ domain protein; structural protein, s 1e-06
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 2e-14
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 7e-06
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 3e-14
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 6e-05
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 3e-14
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 4e-08
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 3e-14
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 3e-04
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 3e-14
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 4e-04
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 3e-14
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 1e-05
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 3e-14
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 4e-04
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 3e-14
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 5e-14
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 7e-14
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 3e-04
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 7e-14
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 8e-14
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 8e-14
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 1e-13
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 1e-13
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 2e-13
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 2e-13
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 2e-13
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 8e-04
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 2e-13
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 2e-04
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 3e-13
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 3e-13
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 3e-13
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 3e-13
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 4e-13
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 3e-07
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 5e-13
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 1e-06
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 6e-13
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 7e-13
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 9e-13
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 1e-12
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 1e-12
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 2e-12
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 2e-09
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 5e-04
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 2e-12
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 1e-11
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 2e-11
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 1e-10
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 2e-10
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 2e-10
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 8e-10
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 1e-09
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 5e-05
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 1e-08
2pzd_A113 Serine protease HTRA2; PDZ domain, apoptosis, mito 7e-08
2p3w_A112 Probable serine protease HTRA3; PDZ domain, phage 1e-07
3k50_A403 Putative S41 protease; structural genomics, joint 2e-07
2yub_A118 LIMK-2, LIM domain kinase 2; PDZ domain, structura 2e-07
1y8t_A324 Hypothetical protein RV0983; serine protease, stru 3e-07
1lcy_A325 HTRA2 serine protease; apoptosis, PDZ domain, casp 1e-06
2i4s_A105 General secretion pathway protein C; EPSC, GSPC, P 1e-06
3num_A332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 2e-06
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 3e-06
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 1e-05
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 3e-06
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 4e-05
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 3e-06
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 3e-05
2kjp_A91 Uncharacterized protein YLBL; mixed alpha-beta pro 3e-06
2i6v_A87 General secretion pathway protein C; EPSC, GSPC, P 4e-06
1fc6_A388 Photosystem II D1 protease; D1 C-terminal processi 5e-06
2kl1_A94 YLBL protein; structure genomics, structural genom 9e-06
1te0_A318 Protease DEGS; two domains, serine protease, PDZ, 1e-05
2zpm_A91 Regulator of sigma E protease; metalloproteinase, 2e-05
3i18_A100 LMO2051 protein; alpha-beta protein, structural ge 2e-05
2hga_A125 Conserved protein MTH1368; GFT structural genomics 3e-05
3stj_A345 Protease DEGQ; serine protease, PDZ domain, protea 3e-05
2l97_A134 HTRA, putative serine protease; HTRA-PDZ, protein 6e-05
3id1_A95 Regulator of sigma E protease; hydrolase, cell inn 7e-05
4fgm_A597 Aminopeptidase N family protein; structural genomi 7e-05
3rle_A209 Golgi reassembly-stacking protein 2; PDZ, tether, 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
3qo6_A348 Protease DO-like 1, chloroplastic; protease, HTRA, 9e-04
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 104 Back     alignment and structure
 Score = 98.6 bits (246), Expect = 3e-25
 Identities = 34/110 (30%), Positives = 55/110 (50%), Gaps = 14/110 (12%)

Query: 195 TPPDIDQLPVRTINMNRSQDANHGFGICVKGGANNPGVGVYISRVEEGSIAERAGLRPGD 254
              ++ Q   R + + +        G  ++GG  +  +G++IS+V   S A RAGL+ GD
Sbjct: 7   GNNELTQFLPRIVTLKKPP--GAQLGFNIRGGKAS-QLGIFISKVIPDSDAHRAGLQEGD 63

Query: 255 SILQVNGIPFTGISHEEALKMCFFEGYKEGQMLKSNRELSMTVRSPSIPP 304
            +L VN + F  I H +A+           ++LK+ RE+SM VR  S P 
Sbjct: 64  QVLAVNDVDFQDIEHSKAV-----------EILKTAREISMRVRFFSGPS 102
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 104 Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 128 Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 128 Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A Length = 192 Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A Length = 192 Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 101 Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 101 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Length = 196 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Length = 196 Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Length = 114 Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Length = 114 Back     alignment and structure
>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Length = 94 Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Length = 90 Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Length = 90 Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Length = 124 Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Length = 124 Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Length = 109 Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Length = 139 Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Length = 139 Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Length = 85 Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Length = 85 Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Length = 90 Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Length = 90 Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Length = 93 Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Length = 120 Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Length = 120 Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Length = 88 Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Length = 88 Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Length = 89 Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Length = 89 Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Length = 87 Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Length = 87 Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Length = 91 Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Length = 91 Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Length = 96 Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Length = 96 Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Length = 90 Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Length = 90 Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Length = 97 Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Length = 97 Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Length = 96 Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Length = 96 Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Length = 98 Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} PDB: 3r69_A* Length = 95 Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} PDB: 3r69_A* Length = 95 Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 94 Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 94 Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Length = 118 Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Length = 118 Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Length = 112 Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Length = 112 Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Length = 98 Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Length = 98 Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Length = 91 Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Length = 91 Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Length = 91 Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Length = 100 Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Length = 132 Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Length = 132 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Length = 200 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Length = 200 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Length = 200 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Length = 200 Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 102 Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 102 Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Length = 114 Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Length = 114 Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Length = 98 Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Length = 98 Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Length = 123 Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Length = 123 Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Length = 114 Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Length = 114 Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Length = 131 Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Length = 131 Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Length = 128 Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Length = 128 Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} Length = 106 Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} Length = 106 Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Length = 104 Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Length = 104 Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Length = 92 Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Length = 92 Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Length = 196 Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Length = 196 Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Length = 196 Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Length = 109 Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Length = 109 Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 127 Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Length = 95 Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Length = 95 Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Length = 97 Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Length = 97 Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 117 Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 117 Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Length = 104 Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Length = 104 Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Length = 99 Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 93 Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 93 Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Length = 118 Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Length = 108 Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Length = 108 Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 90 Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Length = 82 Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Length = 82 Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 119 Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 119 Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Length = 166 Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Length = 166 Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Length = 166 Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 119 Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 119 Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Length = 112 Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Length = 112 Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Length = 90 Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Length = 90 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Length = 119 Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Length = 119 Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Length = 216 Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Length = 111 Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 114 Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 114 Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} PDB: 3nfl_A 2vph_A Length = 107 Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} PDB: 3nfl_A 2vph_A Length = 107 Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Length = 102 Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Length = 107 Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Length = 107 Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 124 Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 124 Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Length = 125 Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Length = 125 Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Length = 106 Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} Length = 93 Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} Length = 93 Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Length = 85 Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 122 Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 122 Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Length = 105 Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Length = 97 Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Length = 101 Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Length = 101 Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Length = 97 Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Length = 97 Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Length = 94 Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 129 Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 129 Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Length = 96 Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Length = 96 Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 111 Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 111 Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Length = 391 Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Length = 391 Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Length = 106 Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Length = 95 Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Length = 117 Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Length = 117 Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Length = 97 Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Length = 97 Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Length = 108 Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Length = 108 Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Length = 96 Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Length = 96 Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Length = 127 Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Length = 127 Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 105 Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 105 Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Length = 109 Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Length = 88 Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Length = 88 Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 130 Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Length = 88 Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Length = 81 Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 123 Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Length = 95 Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Length = 111 Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Length = 103 Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Length = 103 Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Length = 468 Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Length = 468 Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Length = 129 Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Length = 113 Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 126 Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Length = 263 Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Length = 263 Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Length = 92 Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 108 Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Length = 88 Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Length = 206 Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Length = 206 Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Length = 206 Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Length = 170 Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 126 Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Length = 388 Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Length = 388 Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Length = 195 Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 96 Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Length = 113 Back     alignment and structure
>2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 Length = 113 Back     alignment and structure
>2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} Length = 112 Back     alignment and structure
>3k50_A Putative S41 protease; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Length = 403 Back     alignment and structure
>2yub_A LIMK-2, LIM domain kinase 2; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 118 Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Length = 324 Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Length = 325 Back     alignment and structure
>2i4s_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.92A {Vibrio cholerae} SCOP: b.36.1.5 Length = 105 Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 3nwu_A 2ytw_A 2joa_A Length = 332 Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Length = 451 Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Length = 451 Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Length = 448 Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Length = 448 Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Length = 436 Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Length = 436 Back     alignment and structure
>2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} Length = 91 Back     alignment and structure
>2i6v_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.63A {Vibrio cholerae} SCOP: b.36.1.5 Length = 87 Back     alignment and structure
>1fc6_A Photosystem II D1 protease; D1 C-terminal processing protease, serine protease, serine- lysine catalytic DYAD, PDZ domain, photosynthesis; 1.80A {Scenedesmus obliquus} SCOP: b.36.1.3 c.14.1.2 PDB: 1fc9_A 1fc7_A 1fcf_A Length = 388 Back     alignment and structure
>2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} Length = 94 Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Length = 318 Back     alignment and structure
>2zpm_A Regulator of sigma E protease; metalloproteinase, membrane protein, PDZ domain, hydrolase, inner membrane, membrane, metal-binding; HET: MLY MSE; 0.98A {Escherichia coli} PDB: 3id2_A 3id3_A 3id4_A Length = 91 Back     alignment and structure
>3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A Length = 100 Back     alignment and structure
>2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 Length = 125 Back     alignment and structure
>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Length = 345 Back     alignment and structure
>2l97_A HTRA, putative serine protease; HTRA-PDZ, protein binding; NMR {Streptococcus pneumoniae} Length = 134 Back     alignment and structure
>3id1_A Regulator of sigma E protease; hydrolase, cell inner membrane, cell membrane, membrane, metal-binding, metalloprotease, transmembrane; 1.67A {Escherichia coli k-12} PDB: 2zpl_A Length = 95 Back     alignment and structure
>4fgm_A Aminopeptidase N family protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, peptidase_M61, PDZ; 2.39A {Idiomarina loihiensis L2TR} Length = 597 Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} Length = 209 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Length = 348 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query469
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 99.92
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 99.92
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 99.88
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 99.86
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 99.85
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 99.83
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 99.79
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 99.79
3rle_A209 Golgi reassembly-stacking protein 2; PDZ, tether, 99.64
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 99.57
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 99.52
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 99.49
2byg_A117 Channel associated protein of synapse-110; DLG2, P 99.47
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 99.46
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 99.45
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 99.45
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 99.44
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 99.44
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 99.43
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 99.43
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 99.42
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 99.42
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 99.41
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 99.41
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 99.41
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 99.41
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 99.41
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 99.41
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 99.41
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 99.4
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 99.4
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 99.4
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 99.4
2awx_A105 Synapse associated protein 97; membrane protein, s 99.39
4e34_A87 Golgi-associated PDZ and coiled-coil motif-contai 99.39
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 99.39
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 99.39
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 99.39
4e34_A87 Golgi-associated PDZ and coiled-coil motif-contai 99.38
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 99.38
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 99.38
2v90_A96 PDZ domain-containing protein 3; membrane, protein 99.38
2ego_A96 General receptor for phosphoinositides 1- associat 99.37
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 99.37
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 99.37
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 99.37
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 99.37
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 99.37
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.37
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 99.37
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 99.37
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 99.37
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 99.37
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 99.36
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 99.36
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 99.36
2opg_A98 Multiple PDZ domain protein; structural protein, s 99.36
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 99.36
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 99.36
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 99.36
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 99.36
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 99.36
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 99.36
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 99.35
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 99.35
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 99.35
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 99.35
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 99.34
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 99.34
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 99.34
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 99.34
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 99.34
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 99.34
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 99.34
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 99.34
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 99.34
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 99.34
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 99.34
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 99.34
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 99.33
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 99.33
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 99.33
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 99.33
2djt_A104 Unnamed protein product; PDZ domain, structural ge 99.33
2fne_A117 Multiple PDZ domain protein; structural protein, s 99.33
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 99.32
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 99.32
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 99.32
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducin 99.32
2ego_A96 General receptor for phosphoinositides 1- associat 99.32
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 99.32
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.32
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 99.32
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 99.31
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 99.31
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 99.31
2d90_A102 PDZ domain containing protein 1; structural genomi 99.31
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 99.31
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 99.31
2eeh_A100 PDZ domain-containing protein 7; structural genomi 99.31
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 99.31
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 99.31
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 99.31
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 99.31
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 99.31
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 99.31
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 99.3
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 99.3
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 99.3
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 99.3
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 99.3
4amh_A106 Disks large homolog 1; permutation, protein foldin 99.3
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 99.3
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 99.29
2eei_A106 PDZ domain-containing protein 1; regulatory factor 99.29
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 99.29
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 99.29
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 99.29
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 99.29
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 99.29
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 99.29
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 99.29
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 99.28
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 99.28
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 99.28
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 99.28
3khf_A99 Microtubule-associated serine/threonine-protein ki 99.28
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 99.28
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 99.28
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 99.27
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 99.27
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 99.27
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 99.27
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 99.27
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 99.27
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 99.27
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 99.27
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 99.27
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 99.27
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 99.26
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 99.26
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 99.26
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 99.26
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 99.26
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 99.26
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 99.26
3sfj_A104 TAX1-binding protein 3; PDZ:peptide complex, signa 99.26
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 99.25
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 99.25
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 99.25
2awx_A105 Synapse associated protein 97; membrane protein, s 99.25
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 99.25
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 99.25
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 99.25
2o2t_A117 Multiple PDZ domain protein; structural protein, s 99.25
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 99.25
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 99.25
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.25
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 99.25
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 99.24
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 99.24
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 99.24
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 99.24
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 99.24
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 99.24
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 99.24
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 99.24
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 99.24
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 99.24
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 99.24
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 99.24
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 99.24
2byg_A117 Channel associated protein of synapse-110; DLG2, P 99.24
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 99.24
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 99.24
2fne_A117 Multiple PDZ domain protein; structural protein, s 99.24
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 99.23
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 99.23
2eeh_A100 PDZ domain-containing protein 7; structural genomi 99.23
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 99.23
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 99.22
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 99.22
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 99.22
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 99.22
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 99.22
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 99.22
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 99.22
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 99.21
4amh_A106 Disks large homolog 1; permutation, protein foldin 99.21
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 99.21
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 99.21
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 99.21
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 99.21
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 99.21
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 99.2
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 99.2
3k1r_A192 Harmonin; protein-protein complex, alternative spl 99.2
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 99.2
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 99.2
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 99.2
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 99.2
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 99.2
2opg_A98 Multiple PDZ domain protein; structural protein, s 99.2
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 99.19
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.19
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 99.19
2v90_A96 PDZ domain-containing protein 3; membrane, protein 99.19
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 99.19
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 99.19
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 99.18
2o2t_A117 Multiple PDZ domain protein; structural protein, s 99.18
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 99.18
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 99.18
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 99.18
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 99.18
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 99.18
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 98.79
2djt_A104 Unnamed protein product; PDZ domain, structural ge 99.17
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 99.17
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 99.17
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 99.17
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 99.16
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 99.16
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 99.16
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 99.16
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 99.16
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 99.16
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 99.16
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 99.16
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 99.16
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 99.16
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 99.16
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 99.15
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 99.15
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 99.15
2eaq_A90 LIM domain only protein 7; conserved hypothetical 99.15
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 99.15
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 99.15
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 99.15
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 99.15
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 99.15
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 99.14
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 99.14
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 99.14
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 99.14
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 99.14
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 99.14
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 98.74
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 99.13
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 99.13
3k1r_A192 Harmonin; protein-protein complex, alternative spl 99.13
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 99.13
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.13
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 99.12
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 99.12
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 99.12
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 99.12
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 99.12
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 99.12
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 99.12
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 99.12
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 99.11
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 99.11
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 99.1
4fln_A539 Protease DO-like 2, chloroplastic; protease, DEG, 99.1
3sfj_A104 TAX1-binding protein 3; PDZ:peptide complex, signa 99.1
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 99.1
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 99.09
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 99.09
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 99.09
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 99.09
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducin 99.08
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 99.08
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 99.08
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 99.08
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 99.07
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.07
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 99.06
2eei_A106 PDZ domain-containing protein 1; regulatory factor 99.06
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 99.05
2d90_A102 PDZ domain containing protein 1; structural genomi 99.05
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 99.05
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 99.05
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 99.04
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 99.04
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 99.04
3khf_A99 Microtubule-associated serine/threonine-protein ki 99.04
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 99.04
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 99.03
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 99.03
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 99.02
3qik_A101 Phosphatidylinositol 3,4,5-trisphosphate-dependen 99.02
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 99.02
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 99.01
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 99.01
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 99.0
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 99.0
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 99.0
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 98.99
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 98.99
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 98.98
2krg_A216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 98.98
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 98.98
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 98.95
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 98.95
2eaq_A90 LIM domain only protein 7; conserved hypothetical 98.95
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 98.94
3tsz_A 391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 98.94
2yub_A118 LIMK-2, LIM domain kinase 2; PDZ domain, structura 98.93
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 98.92
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 98.92
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 98.92
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 98.91
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 98.9
3tsz_A 391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 98.9
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 98.9
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 98.89
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 98.88
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 98.88
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 98.86
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 98.85
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 98.85
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 98.82
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 98.82
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 98.8
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 98.79
3qik_A101 Phosphatidylinositol 3,4,5-trisphosphate-dependen 98.77
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 98.66
2krg_A 216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 98.66
2yub_A118 LIMK-2, LIM domain kinase 2; PDZ domain, structura 98.65
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 98.64
1fc6_A388 Photosystem II D1 protease; D1 C-terminal processi 98.56
2i6v_A87 General secretion pathway protein C; EPSC, GSPC, P 98.47
2pzd_A113 Serine protease HTRA2; PDZ domain, apoptosis, mito 98.42
2p3w_A112 Probable serine protease HTRA3; PDZ domain, phage 98.38
2i4s_A105 General secretion pathway protein C; EPSC, GSPC, P 98.33
3i18_A100 LMO2051 protein; alpha-beta protein, structural ge 98.32
2l97_A134 HTRA, putative serine protease; HTRA-PDZ, protein 98.31
3id1_A95 Regulator of sigma E protease; hydrolase, cell inn 98.27
2zpm_A91 Regulator of sigma E protease; metalloproteinase, 98.24
2i6v_A87 General secretion pathway protein C; EPSC, GSPC, P 98.21
2kl1_A94 YLBL protein; structure genomics, structural genom 98.18
2kjp_A91 Uncharacterized protein YLBL; mixed alpha-beta pro 98.16
4fgm_A597 Aminopeptidase N family protein; structural genomi 98.12
2pzd_A113 Serine protease HTRA2; PDZ domain, apoptosis, mito 98.11
3id1_A95 Regulator of sigma E protease; hydrolase, cell inn 98.06
3k50_A403 Putative S41 protease; structural genomics, joint 98.06
3rle_A 209 Golgi reassembly-stacking protein 2; PDZ, tether, 98.05
2p3w_A112 Probable serine protease HTRA3; PDZ domain, phage 98.03
1y8t_A324 Hypothetical protein RV0983; serine protease, stru 98.02
1lcy_A325 HTRA2 serine protease; apoptosis, PDZ domain, casp 98.02
3stj_A345 Protease DEGQ; serine protease, PDZ domain, protea 98.02
2i4s_A105 General secretion pathway protein C; EPSC, GSPC, P 98.02
2zpm_A91 Regulator of sigma E protease; metalloproteinase, 98.0
2l97_A134 HTRA, putative serine protease; HTRA-PDZ, protein 98.0
3i18_A100 LMO2051 protein; alpha-beta protein, structural ge 97.99
2kjp_A91 Uncharacterized protein YLBL; mixed alpha-beta pro 97.92
2hga_A125 Conserved protein MTH1368; GFT structural genomics 97.92
2kl1_A94 YLBL protein; structure genomics, structural genom 97.87
1fc6_A 388 Photosystem II D1 protease; D1 C-terminal processi 97.86
1te0_A318 Protease DEGS; two domains, serine protease, PDZ, 97.85
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 97.77
3qo6_A348 Protease DO-like 1, chloroplastic; protease, HTRA, 97.75
3stj_A345 Protease DEGQ; serine protease, PDZ domain, protea 97.7
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 97.7
1te0_A318 Protease DEGS; two domains, serine protease, PDZ, 97.63
2hga_A125 Conserved protein MTH1368; GFT structural genomics 97.58
3num_A332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 97.57
1y8t_A324 Hypothetical protein RV0983; serine protease, stru 97.55
1lcy_A325 HTRA2 serine protease; apoptosis, PDZ domain, casp 97.55
1k32_A1045 Tricorn protease; protein degradation, substrate g 97.53
3k50_A 403 Putative S41 protease; structural genomics, joint 97.48
4fgm_A597 Aminopeptidase N family protein; structural genomi 97.45
3qo6_A348 Protease DO-like 1, chloroplastic; protease, HTRA, 97.2
3num_A332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 97.11
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 97.09
1k32_A 1045 Tricorn protease; protein degradation, substrate g 96.18
4fln_A539 Protease DO-like 2, chloroplastic; protease, DEG, 95.87
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Back     alignment and structure
Probab=99.92  E-value=9.9e-24  Score=196.08  Aligned_cols=166  Identities=23%  Similarity=0.407  Sum_probs=136.3

Q ss_pred             CCeEEEEEecCCCCcceEEEEEEcCCCCC----CCcEEEEEeCCCCHHHHcC-CCCCCEEEEECCEEcCCCCHHHHHHHh
Q psy14977        202 LPVRTINMNRSQDANHGFGICVKGGANNP----GVGVYISRVEEGSIAERAG-LRPGDSILQVNGIPFTGISHEEALKMC  276 (469)
Q Consensus       202 ~~~~~V~L~r~~~~~~GlGf~i~gg~~~~----~~gi~V~~V~pgspA~~aG-L~~GD~Il~VNG~~v~~~s~~~av~~i  276 (469)
                      +..++|+|.|+.   .||||+|.++.+..    ..+++|..|.+++||+++| |+.||+|++|||+++.++++.+++..+
T Consensus         4 ~~~~~v~l~~~~---~~lG~~i~~g~~~~~~~~~~g~~V~~V~~~spA~~aG~l~~GD~I~~vng~~v~~~~~~~~~~~~   80 (196)
T 3gsl_A            4 MEYEEITLERGN---SGLGFSIAGGTDNPHIGDDPSIFITKIIPGGAAAQDGRLRVNDSILFVNEVDVREVTHSAAVEAL   80 (196)
T ss_dssp             EEEEEEEEECBT---TBSSEEEECCTTSCTTSSCCCEEEEEECTTSHHHHHCCCCTTCEEEEETTEECTTCCHHHHHHHH
T ss_pred             cEEEEEEEEECC---CCCCEEEEcccCCcccCCCCCEEEEEECCCChHHhcCCCCCCCEEEEECCEECCCCCHHHHHHHH
Confidence            456889999985   78999999987642    4689999999999999999 999999999999999999998888875


Q ss_pred             hhcCcccceEeecCcEEEEEEECCCCCCCCCCCCCCCCCCcccccccccccccCCCCCCCCCCccCCCCCCCCCCCCCCC
Q psy14977        277 FFEGYKEGQMLKSNRELSMTVRSPSIPPQAPRNHPLPPPPAWTMRQAYSWIDRQGRPCSPPLDYARSVIPMPPPPPPPPR  356 (469)
Q Consensus       277 r~~~~~~~~Ilr~g~~v~l~V~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~s~~~~~~~~~~~~~~~~~~~~~  356 (469)
                      +          ..+..+.|+|.+.....                                                    
T Consensus        81 ~----------~~g~~v~l~v~r~~~~~----------------------------------------------------   98 (196)
T 3gsl_A           81 K----------EAGSIVRLYVMRRKPPA----------------------------------------------------   98 (196)
T ss_dssp             H----------TSCSEEEEEEEEECCCC----------------------------------------------------
T ss_pred             H----------hCCCcEEEEEEecCCCc----------------------------------------------------
Confidence            4          44788999988753210                                                    


Q ss_pred             CccccCCCCCcceEEEEEecCCCcccEEEeccccc-----CCcEEEEEecCCCHHHHcC-CCCCcEEEEEecEEecCcch
Q psy14977        357 WNYSARSSKDTVRKVELNIEPGQSLGLMIRGGVEY-----NLGIFITGVDKDSVAERAG-LLVSQLTLYQFIKEFLILSD  430 (469)
Q Consensus       357 ~~~~~~~~~~~~~~V~L~~~~g~~LGfsi~Gg~e~-----~~GI~V~~V~pgs~A~~aG-Lr~GD~IL~VNG~sv~~~s~  430 (469)
                               .....+++... ..+|||.+.++.+.     ..|++|..|.++|+|+++| |++||+|++|||+++.+++ 
T Consensus        99 ---------~~~~~v~l~~~-~~~lG~~~~~~~~~~~~~~~~gv~V~~V~~gs~A~~aG~L~~GD~Il~Vng~~v~~~~-  167 (196)
T 3gsl_A           99 ---------EKVMEIKLIKG-PKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGRLQIGDKILAVNSVGLEDVM-  167 (196)
T ss_dssp             ---------EEEEEEEEEEB-TTBSCEEEEESBTSCSBTTBCCEEEEEECTTSHHHHHCCCCTTCEEEEETTEECSSCB-
T ss_pred             ---------cccEEEEEecC-CCCceEEEEccCCCcCCCCCCCEEEEEECCCChHHhcCCCCCCCEEEEECCCcCCCCC-
Confidence                     01233444332 24899999876542     3589999999999999999 9999999999999999999 


Q ss_pred             HHHHHHHHHhCCC
Q psy14977        431 HDKDFDTVISFSH  443 (469)
Q Consensus       431 h~eav~~Lk~~g~  443 (469)
                      +++++++|++.++
T Consensus       168 ~~~~~~~l~~~~~  180 (196)
T 3gsl_A          168 HEDAVAALKNTYD  180 (196)
T ss_dssp             HHHHHHHHHSCCE
T ss_pred             HHHHHHHHHcCCC
Confidence            9999999997654
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Back     alignment and structure
>4e34_A Golgi-associated PDZ and coiled-coil motif-contai protein; PDZ-peptide complex, protein transport-inhibitor complex; 1.40A {Homo sapiens} PDB: 4e35_A Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Back     alignment and structure
>4e34_A Golgi-associated PDZ and coiled-coil motif-contai protein; PDZ-peptide complex, protein transport-inhibitor complex; 1.40A {Homo sapiens} PDB: 4e35_A Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.36.1.1 PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} SCOP: b.36.1.0 PDB: 3r69_A* Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} SCOP: b.36.1.1 PDB: 3nfl_A 2vph_A Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} SCOP: b.36.1.0 Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Back     alignment and structure
>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>4amh_A Disks large homolog 1; permutation, protein folding, structural protein; 2.30A {Homo sapiens} Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} SCOP: b.36.1.0 Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} SCOP: b.36.1.1 PDB: 3nfl_A 2vph_A Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} SCOP: b.36.1.0 Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3sfj_A TAX1-binding protein 3; PDZ:peptide complex, signaling protein-inhibitor complex; 1.24A {Homo sapiens} PDB: 3dj3_A Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4amh_A Disks large homolog 1; permutation, protein folding, structural protein; 2.30A {Homo sapiens} Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A 2lsr_A Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} SCOP: b.36.1.0 PDB: 3r69_A* Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} SCOP: b.36.1.0 Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.36.1.1 PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A 2lsr_A Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Back     alignment and structure
>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} Back     alignment and structure
>3sfj_A TAX1-binding protein 3; PDZ:peptide complex, signaling protein-inhibitor complex; 1.24A {Homo sapiens} PDB: 3dj3_A Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>3qik_A Phosphatidylinositol 3,4,5-trisphosphate-dependen exchanger 1 protein; PDZ domain, structural genomics consortium, SGC, hydrolase R; 2.29A {Homo sapiens} Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Back     alignment and structure
>2yub_A LIMK-2, LIM domain kinase 2; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Back     alignment and structure
>3qik_A Phosphatidylinositol 3,4,5-trisphosphate-dependen exchanger 1 protein; PDZ domain, structural genomics consortium, SGC, hydrolase R; 2.29A {Homo sapiens} Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2yub_A LIMK-2, LIM domain kinase 2; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1fc6_A Photosystem II D1 protease; D1 C-terminal processing protease, serine protease, serine- lysine catalytic DYAD, PDZ domain, photosynthesis; 1.80A {Scenedesmus obliquus} SCOP: b.36.1.3 c.14.1.2 PDB: 1fc9_A 1fc7_A 1fcf_A Back     alignment and structure
>2i6v_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.63A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 Back     alignment and structure
>2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} Back     alignment and structure
>2i4s_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.92A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A Back     alignment and structure
>2l97_A HTRA, putative serine protease; HTRA-PDZ, protein binding; NMR {Streptococcus pneumoniae} Back     alignment and structure
>3id1_A Regulator of sigma E protease; hydrolase, cell inner membrane, cell membrane, membrane, metal-binding, metalloprotease, transmembrane; 1.67A {Escherichia coli k-12} PDB: 2zpl_A Back     alignment and structure
>2zpm_A Regulator of sigma E protease; metalloproteinase, membrane protein, PDZ domain, hydrolase, inner membrane, membrane, metal-binding; HET: MLY MSE; 0.98A {Escherichia coli} PDB: 3id2_A 3id3_A 3id4_A Back     alignment and structure
>2i6v_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.63A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} Back     alignment and structure
>2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} Back     alignment and structure
>4fgm_A Aminopeptidase N family protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, peptidase_M61, PDZ; 2.39A {Idiomarina loihiensis L2TR} Back     alignment and structure
>2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 Back     alignment and structure
>3id1_A Regulator of sigma E protease; hydrolase, cell inner membrane, cell membrane, membrane, metal-binding, metalloprotease, transmembrane; 1.67A {Escherichia coli k-12} PDB: 2zpl_A Back     alignment and structure
>3k50_A Putative S41 protease; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A Back     alignment and structure
>2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Back     alignment and structure
>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>2i4s_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.92A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>2zpm_A Regulator of sigma E protease; metalloproteinase, membrane protein, PDZ domain, hydrolase, inner membrane, membrane, metal-binding; HET: MLY MSE; 0.98A {Escherichia coli} PDB: 3id2_A 3id3_A 3id4_A Back     alignment and structure
>2l97_A HTRA, putative serine protease; HTRA-PDZ, protein binding; NMR {Streptococcus pneumoniae} Back     alignment and structure
>3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A Back     alignment and structure
>2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} Back     alignment and structure
>2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 Back     alignment and structure
>2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} Back     alignment and structure
>1fc6_A Photosystem II D1 protease; D1 C-terminal processing protease, serine protease, serine- lysine catalytic DYAD, PDZ domain, photosynthesis; 1.80A {Scenedesmus obliquus} SCOP: b.36.1.3 c.14.1.2 PDB: 1fc9_A 1fc7_A 1fcf_A Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Back     alignment and structure
>2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3k50_A Putative S41 protease; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>4fgm_A Aminopeptidase N family protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, peptidase_M61, PDZ; 2.39A {Idiomarina loihiensis L2TR} Back     alignment and structure
>3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 469
d1uf1a_128 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 4e-17
d1uf1a_128 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 9e-09
d1ueza_101 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 4e-17
d1ueza_101 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 8e-08
d2csja1104 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tj 5e-17
d2csja1104 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tj 4e-04
d1g9oa_91 b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, 5e-17
d1g9oa_91 b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, 9e-05
d1wi2a_104 b.36.1.1 (A:) PDZ domain containing protein 11, Pd 5e-17
d1wi2a_104 b.36.1.1 (A:) PDZ domain containing protein 11, Pd 1e-07
d1q3oa_104 b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norv 3e-16
d1q3oa_104 b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norv 2e-06
d2f0aa192 b.36.1.1 (A:251-342) Segment polarity protein dish 4e-16
d2f0aa192 b.36.1.1 (A:251-342) Segment polarity protein dish 9e-08
d2cs5a1106 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase no 6e-16
d2cs5a1106 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase no 1e-05
d1ihja_94 b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanoga 9e-16
d1ihja_94 b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanoga 3e-08
d1qava_90 b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [Ta 1e-15
d1qava_90 b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [Ta 3e-08
d2fcfa196 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein 2e-15
d2fcfa196 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein 1e-07
d2f5ya177 b.36.1.1 (A:19-95) Regulator of G-protein signalin 2e-15
d1y7na179 b.36.1.1 (A:12-90) Amyloid beta A4 precursor prote 2e-15
d1y7na179 b.36.1.1 (A:12-90) Amyloid beta A4 precursor prote 0.002
d1n7ea_95 b.36.1.1 (A:) Glutamate receptor-interacting prote 4e-15
d1n7ea_95 b.36.1.1 (A:) Glutamate receptor-interacting prote 2e-06
d1x5qa197 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Hom 5e-15
d1x5qa197 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Hom 0.002
d1ufxa_103 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 6e-15
d1ufxa_103 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 0.004
d1x5na1101 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) 6e-15
d1x5na1101 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) 5e-10
d1x6da1107 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sap 6e-15
d1x6da1107 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sap 2e-08
d1v6ba_118 b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxI 7e-15
d1v6ba_118 b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxI 4e-04
d1x5ra199 b.36.1.1 (A:8-106) Glutamate receptor interacting 1e-14
d1x5ra199 b.36.1.1 (A:8-106) Glutamate receptor interacting 1e-07
d1m5za_91 b.36.1.1 (A:) Glutamate receptor interacting prote 1e-14
d1m5za_91 b.36.1.1 (A:) Glutamate receptor interacting prote 3e-04
d1wi4a196 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mou 2e-14
d1wi4a196 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mou 0.002
d2fnea188 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein 3e-14
d2fnea188 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein 1e-04
d2cssa1108 b.36.1.1 (A:8-115) Regulating synaptic membrane ex 3e-14
d2cssa1108 b.36.1.1 (A:8-115) Regulating synaptic membrane ex 4e-06
d1w9ea185 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapie 8e-14
d1w9ea185 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapie 8e-06
d1ujda_117 b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human 1e-13
d1ujda_117 b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human 2e-04
d1p1da299 b.36.1.1 (A:115-213) Glutamate receptor interactin 2e-13
d1p1da299 b.36.1.1 (A:115-213) Glutamate receptor interactin 2e-06
d1ueqa_123 b.36.1.1 (A:) Membrane associated guanylate kinase 2e-13
d1ueqa_123 b.36.1.1 (A:) Membrane associated guanylate kinase 2e-04
d2h3la1103 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) 2e-13
d2h3la1103 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) 1e-05
d1rgwa_85 b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo 2e-13
d1rgwa_85 b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo 0.001
d1wf8a194 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens 2e-13
d1wf8a194 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens 2e-04
d2fe5a192 b.36.1.1 (A:223-314) Synapse-associated protein 10 2e-13
d2fe5a192 b.36.1.1 (A:223-314) Synapse-associated protein 10 1e-04
d1uita_117 b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Huma 3e-13
d1kwaa_88 b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [Ta 3e-13
d1kwaa_88 b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [Ta 1e-06
d1rgra_93 b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus 3e-13
d1rgra_93 b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus 3e-04
d1x45a185 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protei 4e-13
d1x45a185 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protei 5e-06
d1tp5a1102 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat 9e-13
d1tp5a1102 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat 6e-04
d1rzxa_98 b.36.1.1 (A:) GTPase-binding domain of the cell po 1e-12
d1rzxa_98 b.36.1.1 (A:) GTPase-binding domain of the cell po 1e-05
d1t2ma192 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [Ta 2e-12
d1t2ma192 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [Ta 9e-06
d1v5qa_122 b.36.1.1 (A:) Glutamate receptor interacting prote 2e-12
d1v5qa_122 b.36.1.1 (A:) Glutamate receptor interacting prote 8e-05
d1uepa_103 b.36.1.1 (A:) Membrane associated guanylate kinase 2e-12
d1uepa_103 b.36.1.1 (A:) Membrane associated guanylate kinase 3e-05
d1vb7a_94 b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus 2e-12
d1wg6a_127 b.36.1.1 (A:) Partitioning-defective 3-like protei 3e-12
d1wg6a_127 b.36.1.1 (A:) Partitioning-defective 3-like protei 3e-04
d1wfva_103 b.36.1.1 (A:) Membrane associated guanylate kinase 4e-12
d1wfva_103 b.36.1.1 (A:) Membrane associated guanylate kinase 4e-05
d1v62a_117 b.36.1.1 (A:) Glutamate receptor interacting prote 4e-12
d1v62a_117 b.36.1.1 (A:) Glutamate receptor interacting prote 2e-06
d1um1a_110 b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human 9e-12
d1um1a_110 b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human 1e-04
d1ozia_99 b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus muscu 2e-11
d1ozia_99 b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus muscu 0.002
d1i16a_130 b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) 2e-11
d1i16a_130 b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) 2e-04
d1va8a1100 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {M 2e-11
d1va8a1100 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {M 8e-06
d1wf7a_103 b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus muscu 7e-11
d2i6va187 b.36.1.5 (A:219-305) General secretion pathway pro 8e-11
d1whaa_105 b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sap 8e-11
d1uhpa_107 b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human 9e-11
d1uhpa_107 b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human 7e-04
d1vaea_111 b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [T 2e-10
d1qaua_112 b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS 2e-10
d1wh1a_124 b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human 2e-10
d1wh1a_124 b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human 0.001
d1v5la_103 b.36.1.1 (A:) Alpha-actinin-2 associated LIM prote 3e-10
d1ujua_111 b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sap 2e-09
d1ujua_111 b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sap 4e-08
d1uewa_114 b.36.1.1 (A:) Membrane associated guanylate kinase 2e-09
d1uewa_114 b.36.1.1 (A:) Membrane associated guanylate kinase 2e-04
d1wifa_126 b.36.1.1 (A:) hypothetical PDZ domain containing p 2e-09
d1r6ja_82 b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [Ta 7e-09
d2z9ia188 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium 1e-08
d1ujva_96 b.36.1.1 (A:) Membrane associated guanylate kinase 1e-08
d1ky9b288 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-t 2e-07
d1fc6a392 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal 3e-06
d1lcya1100 b.36.1.4 (A:226-325) Mitochondrial serine protease 4e-06
d2hgaa1103 b.36.1.6 (A:23-125) Uncharacterized protein MTH136 0.004
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure

class: All beta proteins
fold: PDZ domain-like
superfamily: PDZ domain-like
family: PDZ domain
domain: KIAA1526 protein
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 75.4 bits (185), Expect = 4e-17
 Identities = 45/145 (31%), Positives = 66/145 (45%), Gaps = 25/145 (17%)

Query: 191 HRRLTPPDIDQLPVRTINMNRSQDANHGFGICVKGGANNPGVGVYISRVEEGSIAERAGL 250
            RR T   +     + +N+          G+ ++GGA   G+G+YI+ V+ GS AE +GL
Sbjct: 8   DRRSTLHLLQGGDEKKVNLVLGD--GRSLGLTIRGGAEY-GLGIYITGVDPGSEAEGSGL 64

Query: 251 RPGDSILQVNGIPFTGISHEEALKMCFFEGYKEGQMLKSNRELSMTVRSPSIPPQAPRNH 310
           + GD IL+VNG  F  I H+EA+           ++LKS+R L +TV+     P A    
Sbjct: 65  KVGDQILEVNGRSFLNILHDEAV-----------RLLKSSRHLILTVKDVGRLPHAR--- 110

Query: 311 PLPPPPAWTMRQAYSWIDRQGRPCS 335
                   T      WI     P S
Sbjct: 111 --------TTVDETKWIASSSGPSS 127
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 104 Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 104 Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 92 Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 92 Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 94 Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 94 Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Length = 90 Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Length = 90 Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 95 Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 95 Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Length = 118 Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Length = 118 Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 91 Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 91 Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 96 Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 96 Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 99 Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 99 Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 123 Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 123 Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 93 Back     information, alignment and structure
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 93 Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 102 Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 102 Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 98 Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 98 Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 122 Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 122 Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Length = 127 Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Length = 127 Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 100 Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 100 Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 Back     information, alignment and structure
>d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} Length = 87 Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 112 Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 126 Back     information, alignment and structure
>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 88 Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Length = 88 Back     information, alignment and structure
>d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Length = 92 Back     information, alignment and structure
>d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d2hgaa1 b.36.1.6 (A:23-125) Uncharacterized protein MTH1368 {Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 103 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query469
d1wi2a_104 PDZ domain containing protein 11, Pdzk11 {Mouse (M 99.65
d1g9oa_91 Na+/H+ exchanger regulatory factor, NHERF {Human ( 99.62
d1wi2a_104 PDZ domain containing protein 11, Pdzk11 {Mouse (M 99.61
d1qava_90 Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} 99.61
d1rgwa_85 Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [Tax 99.61
d1rgra_93 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 99.6
d2fe5a192 Synapse-associated protein 102 {Human (Homo sapien 99.6
d1qava_90 Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} 99.59
d2fcfa196 Multiple PDZ domain protein {Human (Homo sapiens) 99.59
d1uf1a_128 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.58
d1m5za_91 Glutamate receptor interacting protein {Rat (Rattu 99.58
d1uf1a_128 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.58
d2fcfa196 Multiple PDZ domain protein {Human (Homo sapiens) 99.58
d1uhpa_107 Hypothetical protein KIAA1095 {Human (Homo sapiens 99.56
d1t2ma192 Afadin {Human (Homo sapiens) [TaxId: 9606]} 99.56
d1x5na1101 Harmonin {Human (Homo sapiens) [TaxId: 9606]} 99.55
d1x5qa197 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.55
d1ozia_99 Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 1 99.55
d1w9ea185 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.55
d1rgwa_85 Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [Tax 99.55
d1tp5a1102 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 99.54
d1n7ea_95 Glutamate receptor-interacting protein 1, GRIP1 {R 99.54
d1ihja_94 Inad {Fruit fly (Drosophila melanogaster) [TaxId: 99.54
d1t2ma192 Afadin {Human (Homo sapiens) [TaxId: 9606]} 99.54
d2fe5a192 Synapse-associated protein 102 {Human (Homo sapien 99.54
d1uita_117 Discs large 5 protein KIAA0583 {Human (Homo sapien 99.54
d1x6da1107 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 99.53
d2f0aa192 Segment polarity protein dishevelled homolog Dvl-2 99.53
d1uhpa_107 Hypothetical protein KIAA1095 {Human (Homo sapiens 99.53
d2f0aa192 Segment polarity protein dishevelled homolog Dvl-2 99.53
d1qaua_112 Neuronal nitric oxide synthase, NNOS {Rat (Rattus 99.52
d1x45a185 Amyloid beta A4 precursor protein-binding family A 99.52
d1ueqa_123 Membrane associated guanylate kinase inverted-2 (M 99.52
d2f5ya177 Regulator of G-protein signaling 3, RGS3 {Human (H 99.52
d1rgra_93 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 99.52
d1um1a_110 Hypothetical protein KIAA1849 {Human (Homo sapiens 99.52
d1ueza_101 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.52
d1wf8a194 Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} 99.52
d1tp5a1102 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 99.52
d1whaa_105 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.52
d1ujua_111 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.52
d1r6ja_82 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.51
d1q3oa_104 Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId 99.51
d1ueza_101 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.51
d1ihja_94 Inad {Fruit fly (Drosophila melanogaster) [TaxId: 99.51
d1n7ea_95 Glutamate receptor-interacting protein 1, GRIP1 {R 99.51
d1wi4a196 Syntaxin binding protein 4 {Mouse (Mus musculus) [ 99.51
d1x6da1107 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 99.5
d1kwaa_88 Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} 99.5
d1uepa_103 Membrane associated guanylate kinase inverted-2 (M 99.5
d1i16a_130 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 99.5
d1vb7a_94 PDZ-LIM protein mystique {Mouse (Mus musculus) [Ta 99.5
d2fnea188 Multiple PDZ domain protein {Human (Homo sapiens) 99.49
d1g9oa_91 Na+/H+ exchanger regulatory factor, NHERF {Human ( 99.49
d1wfva_103 Membrane associated guanylate kinase inverted-2 (M 99.49
d2fnea188 Multiple PDZ domain protein {Human (Homo sapiens) 99.49
d1kwaa_88 Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} 99.49
d1uepa_103 Membrane associated guanylate kinase inverted-2 (M 99.48
d1rzxa_98 GTPase-binding domain of the cell polarity protein 99.48
d1ozia_99 Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 1 99.48
d1r6ja_82 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.48
d1vb7a_94 PDZ-LIM protein mystique {Mouse (Mus musculus) [Ta 99.48
d2h3la1103 Erbin {Human (Homo sapiens) [TaxId: 9606]} 99.48
d1uewa_114 Membrane associated guanylate kinase inverted-2 (M 99.48
d1w9ea185 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.48
d1q3oa_104 Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId 99.48
d1p1da299 Glutamate receptor interacting protein {Rat (Rattu 99.48
d1m5za_91 Glutamate receptor interacting protein {Rat (Rattu 99.48
d1wi4a196 Syntaxin binding protein 4 {Mouse (Mus musculus) [ 99.48
d1ujua_111 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.48
d1v62a_117 Glutamate receptor interacting protein 2, GRIP2 (K 99.48
d1uita_117 Discs large 5 protein KIAA0583 {Human (Homo sapien 99.47
d1rzxa_98 GTPase-binding domain of the cell polarity protein 99.47
d1x5na1101 Harmonin {Human (Homo sapiens) [TaxId: 9606]} 99.47
d1v62a_117 Glutamate receptor interacting protein 2, GRIP2 (K 99.47
d1wf8a194 Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} 99.47
d1x5qa197 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.47
d1qaua_112 Neuronal nitric oxide synthase, NNOS {Rat (Rattus 99.46
d1x45a185 Amyloid beta A4 precursor protein-binding family A 99.46
d1p1da299 Glutamate receptor interacting protein {Rat (Rattu 99.46
d1wf7a_103 Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 1 99.46
d1um1a_110 Hypothetical protein KIAA1849 {Human (Homo sapiens 99.46
d1y7na179 Amyloid beta A4 precursor protein-binding family A 99.46
d1vaea_111 Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} 99.45
d1v5qa_122 Glutamate receptor interacting protein {Mouse (Mus 99.45
d1ueqa_123 Membrane associated guanylate kinase inverted-2 (M 99.44
d2h3la1103 Erbin {Human (Homo sapiens) [TaxId: 9606]} 99.44
d1i16a_130 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 99.44
d1x5ra199 Glutamate receptor interacting protein 2, GRIP2 (K 99.44
d1whaa_105 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.43
d1ufxa_103 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.43
d1va8a1100 Maguk p55 subfamily member 5 {Mouse (Mus musculus) 99.43
d1wf7a_103 Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 1 99.43
d1wfva_103 Membrane associated guanylate kinase inverted-2 (M 99.43
d1uewa_114 Membrane associated guanylate kinase inverted-2 (M 99.43
d2cs5a1106 Tyrosine-protein phosphatase non-receptor type 4, 99.43
d2cs5a1106 Tyrosine-protein phosphatase non-receptor type 4, 99.42
d2cssa1108 Regulating synaptic membrane exocytosis protein 1, 99.42
d2csja1104 Tight junction protein ZO-2, Tjp2 {Mouse (Mus musc 99.42
d2f5ya177 Regulator of G-protein signaling 3, RGS3 {Human (H 99.41
d1ujda_117 Hypothetical protein KIAA0559 {Human (Homo sapiens 99.41
d1v6ba_118 Harmonin {Mouse (Mus musculus) [TaxId: 10090]} 99.41
d1va8a1100 Maguk p55 subfamily member 5 {Mouse (Mus musculus) 99.4
d1ufxa_103 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.39
d1x5ra199 Glutamate receptor interacting protein 2, GRIP2 (K 99.38
d1wg6a_127 Partitioning-defective 3-like protein, PAR3-L (RIK 99.38
d1v5qa_122 Glutamate receptor interacting protein {Mouse (Mus 99.38
d1y7na179 Amyloid beta A4 precursor protein-binding family A 99.38
d2cssa1108 Regulating synaptic membrane exocytosis protein 1, 99.38
d1wg6a_127 Partitioning-defective 3-like protein, PAR3-L (RIK 99.38
d1v6ba_118 Harmonin {Mouse (Mus musculus) [TaxId: 10090]} 99.37
d1wifa_126 hypothetical PDZ domain containing protein Uqcrc2 99.37
d2csja1104 Tight junction protein ZO-2, Tjp2 {Mouse (Mus musc 99.37
d1vaea_111 Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} 99.37
d1ujda_117 Hypothetical protein KIAA0559 {Human (Homo sapiens 99.35
d1v5la_103 Alpha-actinin-2 associated LIM protein {Mouse (Mus 99.35
d1fc6a392 Photosystem II D1 C-terminal processing protease { 99.35
d1wh1a_124 Hypothetical protein KIAA1095 {Human (Homo sapiens 99.31
d1v5la_103 Alpha-actinin-2 associated LIM protein {Mouse (Mus 99.3
d1ujva_96 Membrane associated guanylate kinase inverted-2 (M 99.28
d1wh1a_124 Hypothetical protein KIAA1095 {Human (Homo sapiens 99.26
d1wifa_126 hypothetical PDZ domain containing protein Uqcrc2 99.18
d1fc6a392 Photosystem II D1 C-terminal processing protease { 99.13
d1ujva_96 Membrane associated guanylate kinase inverted-2 (M 99.01
d2z9ia188 Protease PepD {Mycobacterium tuberculosis [TaxId: 98.91
d1lcya1100 Mitochondrial serine protease HtrA2 {Human (Homo s 98.76
d1ky9b288 Protease Do (DegP, HtrA), C-terminal domains {Esch 98.7
d2z9ia188 Protease PepD {Mycobacterium tuberculosis [TaxId: 98.63
d1k32a191 Tricorn protease {Archaeon Thermoplasma acidophilu 98.54
d2i6va187 General secretion pathway protein C, EpsC {Vibrio 98.49
d1ky9b288 Protease Do (DegP, HtrA), C-terminal domains {Esch 98.4
d1lcya1100 Mitochondrial serine protease HtrA2 {Human (Homo s 98.4
d1ky9a194 Protease Do (DegP, HtrA), C-terminal domains {Esch 98.36
d1sota199 Stress sensor protease DegS, C-terminal domain {Es 98.32
d2hgaa1103 Uncharacterized protein MTH1368 {Methanobacterium 98.29
d1k32a191 Tricorn protease {Archaeon Thermoplasma acidophilu 98.14
d2i6va187 General secretion pathway protein C, EpsC {Vibrio 98.04
d2hgaa1103 Uncharacterized protein MTH1368 {Methanobacterium 98.04
d1sota199 Stress sensor protease DegS, C-terminal domain {Es 98.01
d1ky9a194 Protease Do (DegP, HtrA), C-terminal domains {Esch 98.0
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All beta proteins
fold: PDZ domain-like
superfamily: PDZ domain-like
family: PDZ domain
domain: PDZ domain containing protein 11, Pdzk11
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.65  E-value=4.4e-16  Score=130.09  Aligned_cols=90  Identities=34%  Similarity=0.577  Sum_probs=77.5

Q ss_pred             CCCCCeEEEEEecCCCCcceEEEEEEcCCCCCCCcEEEEEeCCCCHHHHcCCCCCCEEEEECCEEcCCCCHHHHHHHhhh
Q psy14977        199 IDQLPVRTINMNRSQDANHGFGICVKGGANNPGVGVYISRVEEGSIAERAGLRPGDSILQVNGIPFTGISHEEALKMCFF  278 (469)
Q Consensus       199 ~~~~~~~~V~L~r~~~~~~GlGf~i~gg~~~~~~gi~V~~V~pgspA~~aGL~~GD~Il~VNG~~v~~~s~~~av~~ir~  278 (469)
                      ...+.+++|+|.|.+  +.+|||+|+++++. ..++||..|.+++||+++||++||+|++|||+++.+++|++++++|| 
T Consensus        11 ~~~~~pr~V~l~r~~--~~~lGf~i~gg~~~-~~gi~V~~V~~~s~A~~~GL~~GD~Il~VNg~~v~~~~~~ev~~llk-   86 (104)
T d1wi2a_          11 LTQFLPRIVTLKKPP--GAQLGFNIRGGKAS-QLGIFISKVIPDSDAHRAGLQEGDQVLAVNDVDFQDIEHSKAVEILK-   86 (104)
T ss_dssp             CCSSCCEEEEECCCT--TCCCSEEEECCSSS-CCCCEEEEECTTSHHHHHTCCTTCEEEEETTEECSSCCHHHHHHHHH-
T ss_pred             cccCcCEEEEEEeCC--CCCcceEEEccccC-CCCEEEEEECCCChhHhcccccCCEEEEECCEECCCCCHHHHHHHHh-
Confidence            345557999999985  47899999998875 67899999999999999999999999999999999999999999954 


Q ss_pred             cCcccceEeecCcEEEEEEECCCC
Q psy14977        279 EGYKEGQMLKSNRELSMTVRSPSI  302 (469)
Q Consensus       279 ~~~~~~~Ilr~g~~v~l~V~~~~~  302 (469)
                                ....+.|+|++...
T Consensus        87 ----------~~~~v~l~V~~~~~  100 (104)
T d1wi2a_          87 ----------TAREISMRVRFFSG  100 (104)
T ss_dssp             ----------HSSSEEEEEECCCC
T ss_pred             ----------cCCeEEEEEEECCC
Confidence                      34568888877544
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1k32a1 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky9a1 b.36.1.4 (A:260-353) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sota1 b.36.1.4 (A:255-353) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hgaa1 b.36.1.6 (A:23-125) Uncharacterized protein MTH1368 {Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1k32a1 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2hgaa1 b.36.1.6 (A:23-125) Uncharacterized protein MTH1368 {Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1sota1 b.36.1.4 (A:255-353) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ky9a1 b.36.1.4 (A:260-353) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure