Psyllid ID: psy15004


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------
PEECIANYETPHGFIIVYSTIDLASFHVAEQCLQALWKKDSIRSKAVILVANKTDLVRCRVVTDEDGKDMATAYDCKFIETSVGINHNVDELLVGILTQIRLKLDNPPEPVLTREQFSCRRRRSKSPGGFRKLRGHRTSASLKVKGLLSKVWQRDSKSKSCQNLHVL
ccccccccccccEEEEEEEcccHHHHHHHHHHHHHHHHHHccccccEEEEcccccccccccccHHHHHHHHHHccccEEEccccccccHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccccccccccccc
ccccHHHHccccEEEEEEEcccHHHHHHHccHHHHHHHHHccccccEEEEEEcHHHHHHccccHHHHHHHHHHHcccEEEEccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccHHHHHHHccccHHHHcccccccccccc
peecianyetphgFIIVYSTIDLASFHVAEQCLQALWKKDSIRSKAVILVANKTdlvrcrvvtdedgkdmataYDCKFIETSVGINHNVDELLVGILTQIRlkldnppepvltreqfscrrrrskspggfrklrghrtsaSLKVKGLLSKVwqrdskskscqnlhvl
PEECIANYETPHGFIIVYSTIDLASFHVAEQCLQALwkkdsirsKAVIlvanktdlvrcrvvtdedgkdmATAYDCKFIETSVGINHNVDELLVGILTQIrlkldnppepvltreqfscrrrrskspggfrklrghrtsaslkvkgllskvwqrdskskscqnlhvl
PEECIANYETPHGFIIVYSTIDLASFHVAEQCLQALWKKDSIRSKAVILVANKTDLVRCRVVTDEDGKDMATAYDCKFIETSVGINHNVDELLVGILTQIRLKLDNPPEPVLTREQFSCRRRRSKSPGGFRKLRGHRTSASLKVKGLLSKVWQRDSKSKSCQNLHVL
***CIANYETPHGFIIVYSTIDLASFHVAEQCLQALWKKDSIRSKAVILVANKTDLVRCRVVTDEDGKDMATAYDCKFIETSVGINHNVDELLVGILTQIRLKLD**************************************************************
**ECIANYETPHGFIIVYSTIDLASFHVAEQCLQALWKKDSIRSKAVILVANKTDLVRCRVVTDEDGKDMATAYDCKFIETSVGINHNVDELLVGILT**************************************************************CQNLHVL
PEECIANYETPHGFIIVYSTIDLASFHVAEQCLQALWKKDSIRSKAVILVANKTDLVRCRVVTDEDGKDMATAYDCKFIETSVGINHNVDELLVGILTQIRLKLDNPPEPVLTREQF**********GGFRKLRGHRTSASLKVKGLLSK*****************
*EECIANYETPHGFIIVYSTIDLASFHVAEQCLQALWKKDSIRSKAVILVANKTDLVRCRVVTDEDGKDMATAYDCKFIETSVGINHNVDELLVGILTQIRLKLD**************************************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PEECIANYETPHGFIIVYSTIDLASFHVAEQCLQALWKKDSIRSKAVILVANKTDLVRCRVVTDEDGKDMATAYDCKFIETSVGINHNVDELLVGILTQIRLKLDNPPEPVLTREQFSCRRRRSKSPGGFRKLRGHRTSASLKVKGLLSKVWQRDSKSKSCQNLHVL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query167 2.2.26 [Sep-21-2011]
P55041295 GTP-binding protein GEM O yes N/A 0.868 0.491 0.374 3e-19
O35929297 GTP-binding protein REM 1 no N/A 0.856 0.481 0.380 3e-19
Q5R541296 GTP-binding protein GEM O yes N/A 0.868 0.489 0.367 4e-19
P55040296 GTP-binding protein GEM O yes N/A 0.868 0.489 0.367 5e-19
P55042308 GTP-binding protein RAD O no N/A 0.880 0.477 0.356 9e-19
O88667308 GTP-binding protein RAD O no N/A 0.880 0.477 0.356 1e-18
P55043306 GTP-binding protein RAD O no N/A 0.874 0.477 0.356 1e-17
O75628298 GTP-binding protein REM 1 no N/A 0.826 0.463 0.356 6e-15
Q8IYK8340 GTP-binding protein REM 2 no N/A 0.898 0.441 0.347 7e-15
Q9WTY2341 GTP-binding protein REM 2 no N/A 0.898 0.439 0.347 3e-14
>sp|P55041|GEM_MOUSE GTP-binding protein GEM OS=Mus musculus GN=Gem PE=1 SV=2 Back     alignment and function desciption
 Score = 94.7 bits (234), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 58/155 (37%), Positives = 82/155 (52%), Gaps = 10/155 (6%)

Query: 13  GFIIVYSTIDLASFHVAEQCLQALWKKDSIRSKAVILVANKTDLVRCRVVTDEDGKDMAT 72
            ++IVYS  D ASF  A +    L +        +ILV NK+DLVRCR V+  +G+  A 
Sbjct: 151 AYLIVYSITDRASFEKASELRIQLRRARQTEDIPIILVGNKSDLVRCREVSVSEGRACAV 210

Query: 73  AYDCKFIETSVGINHNVDELLVGILTQIRLKLDNPPEPVLTREQFSCRRRRSKSPGGFRK 132
            +DCKFIETS  + HNV EL  GI+ Q+RL+ D+  +      + + ++RR   P   R+
Sbjct: 211 VFDCKFIETSAAVQHNVKELFEGIVRQVRLRRDSKEK---NERRLAYQKRRESIPRKARR 267

Query: 133 LRGHRTSASLKVKGLLSKVWQRDSKSKSCQNLHVL 167
             G       K+    +K      KSKSC +L VL
Sbjct: 268 FWG-------KIVAKNNKNMAFKLKSKSCHDLSVL 295




Could be a regulatory protein, possibly participating in receptor-mediated signal transduction at the plasma membrane. Has guanine nucleotide-binding activity but undetectable intrinsic GTPase activity.
Mus musculus (taxid: 10090)
>sp|O35929|REM1_MOUSE GTP-binding protein REM 1 OS=Mus musculus GN=Rem1 PE=1 SV=1 Back     alignment and function description
>sp|Q5R541|GEM_PONAB GTP-binding protein GEM OS=Pongo abelii GN=GEM PE=2 SV=1 Back     alignment and function description
>sp|P55040|GEM_HUMAN GTP-binding protein GEM OS=Homo sapiens GN=GEM PE=1 SV=1 Back     alignment and function description
>sp|P55042|RAD_HUMAN GTP-binding protein RAD OS=Homo sapiens GN=RRAD PE=1 SV=2 Back     alignment and function description
>sp|O88667|RAD_MOUSE GTP-binding protein RAD OS=Mus musculus GN=Rrad PE=1 SV=1 Back     alignment and function description
>sp|P55043|RAD_RAT GTP-binding protein RAD OS=Rattus norvegicus GN=Rrad PE=2 SV=2 Back     alignment and function description
>sp|O75628|REM1_HUMAN GTP-binding protein REM 1 OS=Homo sapiens GN=REM1 PE=1 SV=2 Back     alignment and function description
>sp|Q8IYK8|REM2_HUMAN GTP-binding protein REM 2 OS=Homo sapiens GN=REM2 PE=1 SV=2 Back     alignment and function description
>sp|Q9WTY2|REM2_RAT GTP-binding protein REM 2 OS=Rattus norvegicus GN=Rem2 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query167
332030734 728 GTP-binding protein RAD [Acromyrmex echi 0.976 0.223 0.642 1e-55
380028675 811 PREDICTED: uncharacterized protein LOC10 0.976 0.200 0.642 3e-55
307176416 839 GTP-binding protein RAD [Camponotus flor 0.970 0.193 0.651 3e-55
383865009 838 PREDICTED: uncharacterized protein LOC10 0.976 0.194 0.642 4e-55
307207070 713 GTP-binding protein RAD [Harpegnathos sa 0.976 0.228 0.642 4e-55
442624206 1379 Rgk1, isoform B [Drosophila melanogaster 0.976 0.118 0.557 3e-52
195487181 536 GE13853 [Drosophila yakuba] gi|194177902 0.976 0.304 0.557 5e-52
195584844 536 GD25328 [Drosophila simulans] gi|1941942 0.976 0.304 0.557 5e-52
195335836 532 GM19838 [Drosophila sechellia] gi|194126 0.976 0.306 0.557 5e-52
242022806 274 GTP-binding protein REM, putative [Pedic 0.976 0.594 0.619 6e-52
>gi|332030734|gb|EGI70410.1| GTP-binding protein RAD [Acromyrmex echinatior] Back     alignment and taxonomy information
 Score =  220 bits (561), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 113/176 (64%), Positives = 131/176 (74%), Gaps = 13/176 (7%)

Query: 1   PEECIANYETPHGFIIVYSTIDLASFHVAEQCLQALWKKDSIRSKAVILVANKTDLVRCR 60
           PE CI+ YE PH + +VYST D  S  VAE+ LQ+LW+ D + ++AVILV NK DLVR R
Sbjct: 557 PENCISTYE-PHAYCVVYSTTDRTSVRVAEEVLQSLWRSDHVSARAVILVGNKVDLVRSR 615

Query: 61  VVTDEDGKDMATAYDCKFIETSVGINHNVDELLVGILTQIRLKLDNPPEPVLTREQFSCR 120
           +V+ E+GK MAT+YDCKFIETSVGINHNVDELLVG+LTQIRLKL+NP     TRE F  R
Sbjct: 616 LVSTEEGKSMATSYDCKFIETSVGINHNVDELLVGLLTQIRLKLENPER---TREMFRKR 672

Query: 121 RR--RSKSPGGF-------RKLRGHRTSASLKVKGLLSKVWQRDSKSKSCQNLHVL 167
            R  RSKSP G        +K RG RTS SLKV+ LL KVW RDSKSKSC+NLHVL
Sbjct: 673 SRKNRSKSPLGSCSENNSPKKYRGSRTSTSLKVRNLLDKVWARDSKSKSCENLHVL 728




Source: Acromyrmex echinatior

Species: Acromyrmex echinatior

Genus: Acromyrmex

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|380028675|ref|XP_003698017.1| PREDICTED: uncharacterized protein LOC100865163 [Apis florea] Back     alignment and taxonomy information
>gi|307176416|gb|EFN65990.1| GTP-binding protein RAD [Camponotus floridanus] Back     alignment and taxonomy information
>gi|383865009|ref|XP_003707969.1| PREDICTED: uncharacterized protein LOC100876031 [Megachile rotundata] Back     alignment and taxonomy information
>gi|307207070|gb|EFN84879.1| GTP-binding protein RAD [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|442624206|ref|NP_725875.3| Rgk1, isoform B [Drosophila melanogaster] gi|440214522|gb|AAM70848.3| Rgk1, isoform B [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195487181|ref|XP_002091801.1| GE13853 [Drosophila yakuba] gi|194177902|gb|EDW91513.1| GE13853 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|195584844|ref|XP_002082214.1| GD25328 [Drosophila simulans] gi|194194223|gb|EDX07799.1| GD25328 [Drosophila simulans] Back     alignment and taxonomy information
>gi|195335836|ref|XP_002034569.1| GM19838 [Drosophila sechellia] gi|194126539|gb|EDW48582.1| GM19838 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|242022806|ref|XP_002431829.1| GTP-binding protein REM, putative [Pediculus humanus corporis] gi|212517161|gb|EEB19091.1| GTP-binding protein REM, putative [Pediculus humanus corporis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query167
FB|FBgn0085419740 Rgk2 "Rad, Gem/Kir family memb 0.892 0.201 0.463 2.2e-27
FB|FBgn0085426449 Rgk3 "Rad, Gem/Kir family memb 0.892 0.331 0.456 2.5e-24
UNIPROTKB|A4IFA1296 GEM "Uncharacterized protein" 0.862 0.486 0.376 1.2e-19
UNIPROTKB|J9P6J7296 GEM "Uncharacterized protein" 0.862 0.486 0.376 1.2e-19
UNIPROTKB|F1RY45296 GEM "Uncharacterized protein" 0.862 0.486 0.376 1.2e-19
MGI|MGI:99844295 Gem "GTP binding protein (gene 0.862 0.488 0.376 1.2e-19
RGD|1307386295 Gem "GTP binding protein overe 0.862 0.488 0.376 1.2e-19
UNIPROTKB|F1P5M4297 GEM "Uncharacterized protein" 0.862 0.484 0.376 1.9e-19
UNIPROTKB|P55040296 GEM "GTP-binding protein GEM" 0.862 0.486 0.370 1.9e-19
ZFIN|ZDB-GENE-030131-5607300 rrad "Ras-related associated w 0.862 0.48 0.409 1.9e-19
FB|FBgn0085419 Rgk2 "Rad, Gem/Kir family member 2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 316 (116.3 bits), Expect = 2.2e-27, P = 2.2e-27
 Identities = 77/166 (46%), Positives = 103/166 (62%)

Query:     2 EECIANYETPHGFIIVYSTIDLASFHVAEQCLQALWKKDSIRSKAVILVANKTDLVRCRV 61
             E  ++ YE PHG ++V+S +D +SF VAE+ +  LW+++  + KAVILV NK DL R R+
Sbjct:   592 ENSLSTYE-PHGCVVVFSVVDRSSFRVAEEIINYLWQENYTKDKAVILVGNKADLARARL 650

Query:    62 VTDEDGKDMATAYDCKFIETSVGINHNVDELLVGILTQIRLKLDNPPEPVLTREQFSCRR 121
             +T ++GK +A + D KFIETS GI HNVDELLVGIL Q+RLK     E    RE+   + 
Sbjct:   651 ITSQEGKALAASRDAKFIETSSGIQHNVDELLVGILKQMRLK-----EK---REK---KA 699

Query:   122 RRSKSPGGFRKLRGHRTSASLKVKGLLSKVWQRDSKSKSCQNLHVL 167
               SK       +  H     L+ K  LS +    SKSKSC+NLHVL
Sbjct:   700 TASKMKTSRTHISLHLAKELLQ-KICLSDI----SKSKSCENLHVL 740




GO:0003924 "GTPase activity" evidence=ISS
GO:0005525 "GTP binding" evidence=ISS
GO:0007264 "small GTPase mediated signal transduction" evidence=IEA
GO:0006184 "GTP catabolic process" evidence=IEA
GO:0016020 "membrane" evidence=IEA
FB|FBgn0085426 Rgk3 "Rad, Gem/Kir family member 3" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|A4IFA1 GEM "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|J9P6J7 GEM "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1RY45 GEM "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:99844 Gem "GTP binding protein (gene overexpressed in skeletal muscle)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1307386 Gem "GTP binding protein overexpressed in skeletal muscle" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1P5M4 GEM "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P55040 GEM "GTP-binding protein GEM" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-5607 rrad "Ras-related associated with diabetes" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query167
cd04148219 cd04148, RGK, Rem, Rem2, Rad, Gem/Kir (RGK) subfam 7e-44
cd00876160 cd00876, Ras, Rat sarcoma (Ras) family of small gu 2e-22
smart00010166 smart00010, small_GTPase, Small GTPase of the Ras 2e-19
smart00173164 smart00173, RAS, Ras subfamily of RAS small GTPase 4e-19
cd04137180 cd04137, RheB, Ras Homolog Enriched in Brain (RheB 4e-18
cd00154159 cd00154, Rab, Ras-related in brain (Rab) family of 2e-16
pfam00071162 pfam00071, Ras, Ras family 5e-16
cd04141172 cd04141, Rit_Rin_Ric, Ras-like protein in all tiss 3e-15
smart00175164 smart00175, RAB, Rab subfamily of small GTPases 2e-14
cd04146166 cd04146, RERG_RasL11_like, Ras-related and Estroge 8e-14
cd04145164 cd04145, M_R_Ras_like, R-Ras2/TC21, M-Ras/R-Ras3 9e-14
cd04138162 cd04138, H_N_K_Ras_like, Ras GTPase family contain 2e-12
cd01861161 cd01861, Rab6, Rab GTPase family 6 (Rab6) 2e-12
cd04175164 cd04175, Rap1, Rap1 family GTPase consists of Rap1 4e-12
cd04140165 cd04140, ARHI_like, A Ras homolog member I (ARHI) 4e-12
cd04136164 cd04136, Rap_like, Rap-like family consists of Rap 4e-12
PTZ00369189 PTZ00369, PTZ00369, Ras-like protein; Provisional 5e-12
cd01869166 cd01869, Rab1_Ypt1, Rab GTPase family 1 includes t 5e-12
cd04176163 cd04176, Rap2, Rap2 family GTPase consists of Rap2 2e-11
cd04123162 cd04123, Rab21, Rab GTPase family 21 (Rab21) 4e-11
cd01868165 cd01868, Rab11_like, Rab GTPase family 11 (Rab11)- 9e-11
cd04144190 cd04144, Ras2, Rat sarcoma (Ras) family 2 of small 1e-10
cd01860163 cd01860, Rab5_related, Rab-related GTPase family i 3e-10
cd01867167 cd01867, Rab8_Rab10_Rab13_like, Rab GTPase familie 4e-10
cd04177168 cd04177, RSR1, RSR1/Bud1p family GTPase 2e-08
cd01865165 cd01865, Rab3, Rab GTPase family 3 contains Rab3A, 4e-08
cd04101167 cd04101, RabL4, Rab GTPase-like family 4 (Rab-like 1e-07
cd01863161 cd01863, Rab18, Rab GTPase family 18 (Rab18) 2e-07
cd04110199 cd04110, Rab35, Rab GTPase family 35 (Rab35) 4e-07
cd04109213 cd04109, Rab28, Rab GTPase family 28 (Rab28) 7e-07
cd04139163 cd04139, RalA_RalB, Ral (Ras-like) family containi 1e-06
PTZ00099176 PTZ00099, PTZ00099, rab6; Provisional 1e-06
PLN03110216 PLN03110, PLN03110, Rab GTPase; Provisional 2e-06
cd01866168 cd01866, Rab2, Rab GTPase family 2 (Rab2) 3e-06
cd04119168 cd04119, RJL, Rab GTPase family J-like (RabJ-like) 3e-06
cd04147197 cd04147, Ras_dva, Ras - dorsal-ventral anterior lo 4e-06
cd00882161 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like s 4e-06
cd04112191 cd04112, Rab26, Rab GTPase family 26 (Rab26) 8e-06
cd01864165 cd01864, Rab19, Rab GTPase family 19 (Rab19) 9e-06
cd04127180 cd04127, Rab27A, Rab GTPase family 27a (Rab27a) 1e-05
PLN03108210 PLN03108, PLN03108, Rab family protein; Provisiona 3e-05
cd04111211 cd04111, Rab39, Rab GTPase family 39 (Rab39) 3e-05
cd04114169 cd04114, Rab30, Rab GTPase family 30 (Rab30) 5e-05
cd04106162 cd04106, Rab23_like, Rab GTPase family 23 (Rab23)- 1e-04
cd04107201 cd04107, Rab32_Rab38, Rab GTPase families 18 (Rab1 5e-04
PLN03118211 PLN03118, PLN03118, Rab family protein; Provisiona 7e-04
cd04117164 cd04117, Rab15, Rab GTPase family 15 (Rab15) 8e-04
cd04143247 cd04143, Rhes_like, Ras homolog enriched in striat 0.003
>gnl|CDD|206715 cd04148, RGK, Rem, Rem2, Rad, Gem/Kir (RGK) subfamily of Ras GTPases Back     alignment and domain information
 Score =  144 bits (364), Expect = 7e-44
 Identities = 58/165 (35%), Positives = 83/165 (50%), Gaps = 24/165 (14%)

Query: 10  TPHGFIIVYSTIDLASFHVAEQCLQALWKKDSIRSKAVILVANKTDLVRCRVVTDEDGKD 69
               ++IVYS  D +SF  A +    L +        +ILV NK+DLVR R V+ ++G+ 
Sbjct: 72  VGDAYVIVYSVTDRSSFEKASELRIQLRRARQAEDIPIILVGNKSDLVRSREVSVQEGRA 131

Query: 70  MATAYDCKFIETSVGINHNVDELLVGILTQIRLKLDNPPEPVLTREQFSCRRRRSKSPGG 129
            A  +DCKFIETS  + HNVDEL  GI+ Q+RL+ D+         + + R+RR      
Sbjct: 132 CAVVFDCKFIETSAALQHNVDELFEGIVRQVRLRRDSKE---KNTRRMASRKRRESITK- 187

Query: 130 FRKLRGHRTSASLKVKGLLSKVWQRDS-------KSKSCQNLHVL 167
                        K K  LSK+  +++       KSKSC +L VL
Sbjct: 188 -------------KAKRFLSKIVAKNNKGMAFKQKSKSCHDLSVL 219


RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Kir) subfamily of Ras GTPases are expressed in a tissue-specific manner and are dynamically regulated by transcriptional and posttranscriptional mechanisms in response to environmental cues. RGK proteins bind to the beta subunit of L-type calcium channels, causing functional down-regulation of these voltage-dependent calcium channels, and either termination of calcium-dependent secretion or modulation of electrical conduction and contractile function. Inhibition of L-type calcium channels by Rem2 may provide a mechanism for modulating calcium-triggered exocytosis in hormone-secreting cells, and has been proposed to influence the secretion of insulin in pancreatic beta cells. RGK proteins also interact with and inhibit the Rho/Rho kinase pathway to modulate remodeling of the cytoskeleton. Two characteristics of RGK proteins cited in the literature are N-terminal and C-terminal extensions beyond the GTPase domain typical of Ras superfamily members. The N-terminal extension is not conserved among family members; the C-terminal extension is reported to be conserved among the family and lack the CaaX prenylation motif typical of membrane-associated Ras proteins. However, a putative CaaX motif has been identified in the alignment of the C-terminal residues of this CD. Length = 219

>gnl|CDD|206642 cd00876, Ras, Rat sarcoma (Ras) family of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|197466 smart00010, small_GTPase, Small GTPase of the Ras superfamily; ill-defined subfamily Back     alignment and domain information
>gnl|CDD|214541 smart00173, RAS, Ras subfamily of RAS small GTPases Back     alignment and domain information
>gnl|CDD|206709 cd04137, RheB, Ras Homolog Enriched in Brain (RheB) is a small GTPase Back     alignment and domain information
>gnl|CDD|206640 cd00154, Rab, Ras-related in brain (Rab) family of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|215692 pfam00071, Ras, Ras family Back     alignment and domain information
>gnl|CDD|206712 cd04141, Rit_Rin_Ric, Ras-like protein in all tissues (Rit), Ras-like protein in neurons (Rin) and Ras-related protein which interacts with calmodulin (Ric) Back     alignment and domain information
>gnl|CDD|197555 smart00175, RAB, Rab subfamily of small GTPases Back     alignment and domain information
>gnl|CDD|206713 cd04146, RERG_RasL11_like, Ras-related and Estrogen-Regulated Growth inhibitor (RERG) and Ras-like 11 (RasL11)-like families Back     alignment and domain information
>gnl|CDD|133345 cd04145, M_R_Ras_like, R-Ras2/TC21, M-Ras/R-Ras3 Back     alignment and domain information
>gnl|CDD|133338 cd04138, H_N_K_Ras_like, Ras GTPase family containing H-Ras,N-Ras and K-Ras4A/4B Back     alignment and domain information
>gnl|CDD|206654 cd01861, Rab6, Rab GTPase family 6 (Rab6) Back     alignment and domain information
>gnl|CDD|133375 cd04175, Rap1, Rap1 family GTPase consists of Rap1a and Rap1b isoforms Back     alignment and domain information
>gnl|CDD|206711 cd04140, ARHI_like, A Ras homolog member I (ARHI) Back     alignment and domain information
>gnl|CDD|206708 cd04136, Rap_like, Rap-like family consists of Rap1, Rap2 and RSR1 Back     alignment and domain information
>gnl|CDD|240385 PTZ00369, PTZ00369, Ras-like protein; Provisional Back     alignment and domain information
>gnl|CDD|206661 cd01869, Rab1_Ypt1, Rab GTPase family 1 includes the yeast homolog Ypt1 Back     alignment and domain information
>gnl|CDD|133376 cd04176, Rap2, Rap2 family GTPase consists of Rap2a, Rap2b, and Rap2c Back     alignment and domain information
>gnl|CDD|133323 cd04123, Rab21, Rab GTPase family 21 (Rab21) Back     alignment and domain information
>gnl|CDD|206660 cd01868, Rab11_like, Rab GTPase family 11 (Rab11)-like includes Rab11a, Rab11b, and Rab25 Back     alignment and domain information
>gnl|CDD|133344 cd04144, Ras2, Rat sarcoma (Ras) family 2 of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|206653 cd01860, Rab5_related, Rab-related GTPase family includes Rab5 and Rab22; regulates early endosome fusion Back     alignment and domain information
>gnl|CDD|206659 cd01867, Rab8_Rab10_Rab13_like, Rab GTPase families 8, 10, 13 (Rab8, Rab10, Rab13) Back     alignment and domain information
>gnl|CDD|133377 cd04177, RSR1, RSR1/Bud1p family GTPase Back     alignment and domain information
>gnl|CDD|206657 cd01865, Rab3, Rab GTPase family 3 contains Rab3A, Rab3B, Rab3C and Rab3D Back     alignment and domain information
>gnl|CDD|206688 cd04101, RabL4, Rab GTPase-like family 4 (Rab-like4) Back     alignment and domain information
>gnl|CDD|206656 cd01863, Rab18, Rab GTPase family 18 (Rab18) Back     alignment and domain information
>gnl|CDD|133310 cd04110, Rab35, Rab GTPase family 35 (Rab35) Back     alignment and domain information
>gnl|CDD|206694 cd04109, Rab28, Rab GTPase family 28 (Rab28) Back     alignment and domain information
>gnl|CDD|206710 cd04139, RalA_RalB, Ral (Ras-like) family containing highly homologous RalA and RalB Back     alignment and domain information
>gnl|CDD|185444 PTZ00099, PTZ00099, rab6; Provisional Back     alignment and domain information
>gnl|CDD|178657 PLN03110, PLN03110, Rab GTPase; Provisional Back     alignment and domain information
>gnl|CDD|206658 cd01866, Rab2, Rab GTPase family 2 (Rab2) Back     alignment and domain information
>gnl|CDD|133319 cd04119, RJL, Rab GTPase family J-like (RabJ-like) Back     alignment and domain information
>gnl|CDD|206714 cd04147, Ras_dva, Ras - dorsal-ventral anterior localization (Ras-dva) family Back     alignment and domain information
>gnl|CDD|206648 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like superfamily of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|206695 cd04112, Rab26, Rab GTPase family 26 (Rab26) Back     alignment and domain information
>gnl|CDD|133267 cd01864, Rab19, Rab GTPase family 19 (Rab19) Back     alignment and domain information
>gnl|CDD|206700 cd04127, Rab27A, Rab GTPase family 27a (Rab27a) Back     alignment and domain information
>gnl|CDD|178655 PLN03108, PLN03108, Rab family protein; Provisional Back     alignment and domain information
>gnl|CDD|133311 cd04111, Rab39, Rab GTPase family 39 (Rab39) Back     alignment and domain information
>gnl|CDD|133314 cd04114, Rab30, Rab GTPase family 30 (Rab30) Back     alignment and domain information
>gnl|CDD|133306 cd04106, Rab23_like, Rab GTPase family 23 (Rab23)-like Back     alignment and domain information
>gnl|CDD|206692 cd04107, Rab32_Rab38, Rab GTPase families 18 (Rab18) and 32 (Rab32) Back     alignment and domain information
>gnl|CDD|215587 PLN03118, PLN03118, Rab family protein; Provisional Back     alignment and domain information
>gnl|CDD|206698 cd04117, Rab15, Rab GTPase family 15 (Rab15) Back     alignment and domain information
>gnl|CDD|133343 cd04143, Rhes_like, Ras homolog enriched in striatum (Rhes) and activator of G-protein signaling 1 (Dexras1/AGS1) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 167
cd04148221 RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki 99.97
KOG0078|consensus207 99.94
KOG0084|consensus205 99.94
KOG0092|consensus200 99.94
KOG0098|consensus216 99.93
KOG0093|consensus193 99.92
KOG0088|consensus218 99.91
cd04121189 Rab40 Rab40 subfamily. This subfamily contains Rab 99.91
KOG0091|consensus213 99.91
KOG0080|consensus209 99.91
cd04174232 Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a memb 99.91
KOG0087|consensus222 99.9
KOG0094|consensus221 99.9
cd04120202 Rab12 Rab12 subfamily. Rab12 was first identified 99.9
KOG0083|consensus192 99.9
cd04141172 Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p 99.89
KOG0081|consensus219 99.89
KOG0395|consensus196 99.89
cd04133176 Rop_like Rop subfamily. The Rop (Rho-related prote 99.88
cd04172182 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE 99.88
cd01873195 RhoBTB RhoBTB subfamily. Members of the RhoBTB sub 99.88
KOG0086|consensus214 99.88
PTZ00099176 rab6; Provisional 99.88
KOG0079|consensus198 99.88
cd04131178 Rnd Rnd subfamily. The Rnd subfamily contains Rnd1 99.87
cd04127180 Rab27A Rab27a subfamily. The Rab27a subfamily cons 99.87
cd04103158 Centaurin_gamma Centaurin gamma. The centaurins (a 99.87
cd01875191 RhoG RhoG subfamily. RhoG is a GTPase with high se 99.86
cd04122166 Rab14 Rab14 subfamily. Rab14 GTPases are localized 99.86
cd04126220 Rab20 Rab20 subfamily. Rab20 is one of several Rab 99.86
cd04173222 Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a memb 99.86
cd04144190 Ras2 Ras2 subfamily. The Ras2 subfamily, found exc 99.86
cd04117161 Rab15 Rab15 subfamily. Rab15 colocalizes with the 99.86
KOG0394|consensus210 99.85
cd04111211 Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 99.85
cd04107201 Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 99.85
cd04175164 Rap1 Rap1 subgroup. The Rap1 subgroup is part of t 99.85
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily con 99.84
cd04109215 Rab28 Rab28 subfamily. First identified in maize, 99.84
smart00176200 RAN Ran (Ras-related nuclear proteins) /TC4 subfam 99.84
PTZ00369189 Ras-like protein; Provisional 99.84
PF00071162 Ras: Ras family; InterPro: IPR001806 Small GTPases 99.84
cd01874175 Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas 99.84
KOG0097|consensus215 99.84
cd01865165 Rab3 Rab3 subfamily. The Rab3 subfamily contains R 99.83
cd04176163 Rap2 Rap2 subgroup. The Rap2 subgroup is part of t 99.83
PLN03110216 Rab GTPase; Provisional 99.83
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp 99.83
cd04125188 RabA_like RabA-like subfamily. RabA was first iden 99.83
cd01871174 Rac1_like Rac1-like subfamily. The Rac1-like subfa 99.83
cd04134189 Rho3 Rho3 subfamily. Rho3 is a member of the Rho f 99.83
cd04146165 RERG_RasL11_like RERG/RasL11-like subfamily. RERG 99.83
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev 99.82
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 99.82
cd04128182 Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi 99.82
cd04142198 RRP22 RRP22 subfamily. RRP22 (Ras-related protein 99.82
cd04140165 ARHI_like ARHI subfamily. ARHI (A Ras homolog memb 99.82
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in 99.82
cd04112191 Rab26 Rab26 subfamily. First identified in rat pan 99.82
cd04115170 Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u 99.82
PLN03108210 Rab family protein; Provisional 99.82
cd04110199 Rab35 Rab35 subfamily. Rab35 is one of several Rab 99.81
smart00174174 RHO Rho (Ras homology) subfamily of Ras-like small 99.81
cd04108170 Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr 99.81
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf 99.81
PLN03071219 GTP-binding nuclear protein Ran; Provisional 99.81
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a 99.81
KOG0095|consensus213 99.81
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg 99.81
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 99.8
cd04106162 Rab23_lke Rab23-like subfamily. Rab23 is a member 99.8
cd00877166 Ran Ran (Ras-related nuclear proteins) /TC4 subfam 99.8
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associat 99.79
cd04143247 Rhes_like Rhes_like subfamily. This subfamily incl 99.79
cd04132187 Rho4_like Rho4-like subfamily. Rho4 is a GTPase th 99.79
cd04116170 Rab9 Rab9 subfamily. Rab9 is found in late endosom 99.79
cd04101164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove 99.79
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 99.79
cd04177168 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the 99.78
PLN03118211 Rab family protein; Provisional 99.78
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 99.77
cd04130173 Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive 99.77
cd01892169 Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr 99.77
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily 99.76
cd04118193 Rab24 Rab24 subfamily. Rab24 is distinct from othe 99.76
KOG4252|consensus246 99.76
cd04158169 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor 99.76
cd04123162 Rab21 Rab21 subfamily. The localization and functi 99.76
cd04129187 Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that 99.76
cd04135174 Tc10 TC10 subfamily. TC10 is a Rho family protein 99.76
cd04147198 Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v 99.75
PLN00223181 ADP-ribosylation factor; Provisional 99.75
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 99.75
smart00177175 ARF ARF-like small GTPases; ARF, ADP-ribosylation 99.75
cd01860163 Rab5_related Rab5-related subfamily. This subfamil 99.75
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicat 99.75
cd04149168 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 99.75
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubu 99.75
cd04150159 Arf1_5_like Arf1-Arf5-like subfamily. This subfami 99.74
cd04162164 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 99.74
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th 99.73
PTZ00133182 ADP-ribosylation factor; Provisional 99.73
cd04114169 Rab30 Rab30 subfamily. Rab30 appears to be associa 99.73
KOG0393|consensus198 99.73
cd00876160 Ras Ras family. The Ras family of the Ras superfam 99.71
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamil 99.71
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are 99.7
cd01870175 RhoA_like RhoA-like subfamily. The RhoA subfamily 99.7
cd04161167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( 99.68
cd01893166 Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr 99.67
cd04152183 Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i 99.67
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential componen 99.67
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a 99.66
cd00154159 Rab Rab family. Rab GTPases form the largest famil 99.65
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub 99.65
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su 99.64
TIGR00157245 ribosome small subunit-dependent GTPase A. The Aqu 99.64
cd00157171 Rho Rho (Ras homology) family. Members of the Rho 99.64
cd04151158 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t 99.63
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik 99.62
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 99.61
cd04102202 RabL3 RabL3 (Rab-like3) subfamily. RabL3s are nove 99.61
PTZ00132215 GTP-binding nuclear protein Ran; Provisional 99.6
smart00178184 SAR Sar1p-like members of the Ras-family of small 99.57
TIGR02528142 EutP ethanolamine utilization protein, EutP. This 99.57
PRK12299335 obgE GTPase CgtA; Reviewed 99.57
KOG3883|consensus198 99.56
PF00025175 Arf: ADP-ribosylation factor family The prints ent 99.55
cd01898170 Obg Obg subfamily. The Obg nucleotide binding prot 99.55
cd01890179 LepA LepA subfamily. LepA belongs to the GTPase fa 99.52
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein presen 99.51
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 99.5
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 99.5
KOG0073|consensus185 99.45
PLN00023334 GTP-binding protein; Provisional 99.44
KOG4423|consensus229 99.43
cd01878204 HflX HflX subfamily. A distinct conserved domain w 99.43
cd01881176 Obg_like The Obg-like subfamily consists of five w 99.42
TIGR02729329 Obg_CgtA Obg family GTPase CgtA. This model descri 99.42
PRK15467158 ethanolamine utilization protein EutP; Provisional 99.4
cd01879158 FeoB Ferrous iron transport protein B (FeoB) subfa 99.37
KOG0075|consensus186 99.35
cd00882157 Ras_like_GTPase Ras-like GTPase superfamily. The R 99.34
KOG0070|consensus181 99.33
cd04171164 SelB SelB subfamily. SelB is an elongation factor 99.33
PRK03003472 GTP-binding protein Der; Reviewed 99.31
TIGR03156351 GTP_HflX GTP-binding protein HflX. This protein fa 99.3
TIGR00450442 mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE 99.3
PRK12297424 obgE GTPase CgtA; Reviewed 99.28
KOG0076|consensus197 99.27
TIGR00436270 era GTP-binding protein Era. Era is an essential G 99.26
COG1100219 GTPase SAR1 and related small G proteins [General 99.26
cd01894157 EngA1 EngA1 subfamily. This CD represents the firs 99.24
cd01855190 YqeH YqeH. YqeH is an essential GTP-binding protei 99.24
PRK05291449 trmE tRNA modification GTPase TrmE; Reviewed 99.23
PRK12289 352 GTPase RsgA; Reviewed 99.22
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA 99.22
PRK03003 472 GTP-binding protein Der; Reviewed 99.22
PRK04213201 GTP-binding protein; Provisional 99.22
PRK12296500 obgE GTPase CgtA; Reviewed 99.21
PRK11058426 GTPase HflX; Provisional 99.21
cd01891194 TypA_BipA TypA (tyrosine phosphorylated protein A) 99.2
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein 99.19
KOG0096|consensus216 99.19
cd01854287 YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil 99.18
PRK15494339 era GTPase Era; Provisional 99.17
TIGR00231161 small_GTP small GTP-binding protein domain. This m 99.16
TIGR01393 595 lepA GTP-binding protein LepA. LepA (GUF1 in Sacca 99.16
cd01859156 MJ1464 MJ1464. This family represents archaeal GTP 99.16
cd01895174 EngA2 EngA2 subfamily. This CD represents the seco 99.15
PRK00098298 GTPase RsgA; Reviewed 99.14
KOG0072|consensus182 99.14
cd01887168 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo 99.13
PRK12288347 GTPase RsgA; Reviewed 99.11
cd00880163 Era_like Era (E. coli Ras-like protein)-like. This 99.11
cd00881189 GTP_translation_factor GTP translation factor fami 99.11
cd01888203 eIF2_gamma eIF2-gamma (gamma subunit of initiation 99.11
TIGR00437 591 feoB ferrous iron transporter FeoB. FeoB (773 amin 99.1
PRK12298390 obgE GTPase CgtA; Reviewed 99.09
KOG1673|consensus205 99.08
PRK00089292 era GTPase Era; Reviewed 99.05
KOG0071|consensus180 99.04
TIGR03597 360 GTPase_YqeH ribosome biogenesis GTPase YqeH. This 99.02
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 99.0
PRK05433 600 GTP-binding protein LepA; Provisional 99.0
TIGR00475 581 selB selenocysteine-specific elongation factor Sel 98.99
PRK00093435 GTP-binding protein Der; Reviewed 98.98
KOG1707|consensus 625 98.97
cd01889192 SelB_euk SelB subfamily. SelB is an elongation fac 98.97
PRK09518712 bifunctional cytidylate kinase/GTPase Der; Reviewe 98.97
PF02421156 FeoB_N: Ferrous iron transport protein B; InterPro 98.96
PRK00093 435 GTP-binding protein Der; Reviewed 98.96
TIGR03594 429 GTPase_EngA ribosome-associated GTPase EngA. EngA 98.9
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 98.9
PRK09518 712 bifunctional cytidylate kinase/GTPase Der; Reviewe 98.89
cd01896233 DRG The developmentally regulated GTP-binding prot 98.84
PRK00454196 engB GTP-binding protein YsxC; Reviewed 98.84
PF00009188 GTP_EFTU: Elongation factor Tu GTP binding domain; 98.83
TIGR00487 587 IF-2 translation initiation factor IF-2. This mode 98.81
TIGR00483 426 EF-1_alpha translation elongation factor EF-1 alph 98.79
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei 98.78
cd01849155 YlqF_related_GTPase YlqF-related GTPases. These pr 98.78
CHL00189 742 infB translation initiation factor 2; Provisional 98.77
PRK05306 787 infB translation initiation factor IF-2; Validated 98.76
TIGR00491 590 aIF-2 translation initiation factor aIF-2/yIF-2. T 98.74
KOG0074|consensus185 98.74
cd01856171 YlqF YlqF. Proteins of the YlqF family contain all 98.73
PRK09554 772 feoB ferrous iron transport protein B; Reviewed 98.73
cd01857141 HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t 98.73
TIGR03680 406 eif2g_arch translation initiation factor 2 subunit 98.72
COG2262411 HflX GTPases [General function prediction only] 98.72
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protei 98.71
PRK04000 411 translation initiation factor IF-2 subunit gamma; 98.71
PRK10512 614 selenocysteinyl-tRNA-specific translation factor; 98.67
TIGR01394 594 TypA_BipA GTP-binding protein TypA/BipA. This bact 98.67
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamil 98.65
smart00010124 small_GTPase Small GTPase of the Ras superfamily; 98.61
COG2229187 Predicted GTPase [General function prediction only 98.57
KOG1489|consensus366 98.55
PRK13796 365 GTPase YqeH; Provisional 98.55
PRK12317 425 elongation factor 1-alpha; Reviewed 98.54
COG1159298 Era GTPase [General function prediction only] 98.52
TIGR03596 276 GTPase_YlqF ribosome biogenesis GTP-binding protei 98.51
COG1160 444 Predicted GTPases [General function prediction onl 98.51
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 98.49
PRK14845 1049 translation initiation factor IF-2; Provisional 98.49
PRK04004 586 translation initiation factor IF-2; Validated 98.49
TIGR00101199 ureG urease accessory protein UreG. This model rep 98.48
PRK09866 741 hypothetical protein; Provisional 98.48
cd04166208 CysN_ATPS CysN_ATPS subfamily. CysN, together with 98.47
PRK01889356 GTPase RsgA; Reviewed 98.46
PRK09563 287 rbgA GTPase YlqF; Reviewed 98.42
cd01883219 EF1_alpha Eukaryotic elongation factor 1 (EF1) alp 98.4
cd04165224 GTPBP1_like GTPBP1-like. Mammalian GTP binding pro 98.39
COG0536369 Obg Predicted GTPase [General function prediction 98.37
cd04105203 SR_beta Signal recognition particle receptor, beta 98.37
PRK10218 607 GTP-binding protein; Provisional 98.36
TIGR00073207 hypB hydrogenase accessory protein HypB. HypB is i 98.35
cd04167213 Snu114p Snu114p subfamily. Snu114p is one of sever 98.33
COG1160444 Predicted GTPases [General function prediction onl 98.33
KOG0462|consensus 650 98.33
COG0481 603 LepA Membrane GTPase LepA [Cell envelope biogenesi 98.31
COG0486454 ThdF Predicted GTPase [General function prediction 98.31
COG0532 509 InfB Translation initiation factor 2 (IF-2; GTPase 98.27
cd00066317 G-alpha G protein alpha subunit. The alpha subunit 98.26
PLN00043 447 elongation factor 1-alpha; Provisional 98.24
KOG0077|consensus193 98.23
COG1162301 Predicted GTPases [General function prediction onl 98.23
cd04168237 TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T 98.18
smart00275342 G_alpha G protein alpha subunit. Subunit of G prot 98.17
cd01884195 EF_Tu EF-Tu subfamily. This subfamily includes ort 98.16
PTZ00327 460 eukaryotic translation initiation factor 2 gamma s 98.16
PRK12736 394 elongation factor Tu; Reviewed 98.13
PRK13768253 GTPase; Provisional 98.13
KOG0705|consensus 749 98.02
KOG1423|consensus379 97.96
cd01885222 EF2 EF2 (for archaea and eukarya). Translocation r 97.93
PRK12735 396 elongation factor Tu; Reviewed 97.92
TIGR00485 394 EF-Tu translation elongation factor TU. This align 97.91
COG0370 653 FeoB Fe2+ transport system protein B [Inorganic io 97.9
PRK13351 687 elongation factor G; Reviewed 97.89
PRK00741 526 prfC peptide chain release factor 3; Provisional 97.82
KOG1145|consensus 683 97.81
COG4917148 EutP Ethanolamine utilization protein [Amino acid 97.8
PF0685858 NOG1: Nucleolar GTP-binding protein 1 (NOG1); Inte 97.79
KOG1707|consensus625 97.75
COG1084346 Predicted GTPase [General function prediction only 97.73
TIGR02034 406 CysN sulfate adenylyltransferase, large subunit. H 97.72
PRK05124 474 cysN sulfate adenylyltransferase subunit 1; Provis 97.7
KOG3905|consensus 473 97.69
PRK12740 668 elongation factor G; Reviewed 97.67
CHL00071 409 tufA elongation factor Tu 97.61
TIGR00750300 lao LAO/AO transport system ATPase. Mutations have 97.59
PRK09435332 membrane ATPase/protein kinase; Provisional 97.59
PRK00049 396 elongation factor Tu; Reviewed 97.57
KOG1490|consensus 620 97.56
cd01899318 Ygr210 Ygr210 subfamily. Ygr210 is a member of Obg 97.55
cd04169267 RF3 RF3 subfamily. Peptide chain release factor 3 97.54
cd04104197 p47_IIGP_like p47 (47-kDa) family. The p47 GTPase 97.54
COG1163365 DRG Predicted GTPase [General function prediction 97.54
PRK05506 632 bifunctional sulfate adenylyltransferase subunit 1 97.52
COG5257 415 GCD11 Translation initiation factor 2, gamma subun 97.51
KOG0090|consensus238 97.49
PLN03127 447 Elongation factor Tu; Provisional 97.42
COG0218200 Predicted GTPase [General function prediction only 97.36
COG0378202 HypB Ni2+-binding GTPase involved in regulation of 97.29
PTZ00141 446 elongation factor 1- alpha; Provisional 97.23
cd04170268 EF-G_bact Elongation factor G (EF-G) subfamily. Tr 97.23
PF09439181 SRPRB: Signal recognition particle receptor beta s 97.21
cd01886270 EF-G Elongation factor G (EF-G) subfamily. Translo 97.2
KOG1191|consensus531 97.2
PLN03126 478 Elongation factor Tu; Provisional 97.18
KOG1532|consensus366 97.16
PRK10463290 hydrogenase nickel incorporation protein HypB; Pro 97.12
TIGR00484 689 EF-G translation elongation factor EF-G. After pep 97.06
cd04178172 Nucleostemin_like Nucleostemin-like. Nucleostemin 97.03
PRK12739 691 elongation factor G; Reviewed 97.03
PF05783 472 DLIC: Dynein light intermediate chain (DLIC); Inte 96.98
PF04670232 Gtr1_RagA: Gtr1/RagA G protein conserved region; I 96.98
COG2895 431 CysN GTPases - Sulfate adenylate transferase subun 96.87
TIGR00503 527 prfC peptide chain release factor 3. This translat 96.79
KOG0082|consensus354 96.76
PF00503389 G-alpha: G-protein alpha subunit; InterPro: IPR001 96.73
COG3276 447 SelB Selenocysteine-specific translation elongatio 96.52
TIGR02836 492 spore_IV_A stage IV sporulation protein A. A compa 96.43
cd01882225 BMS1 Bms1. Bms1 is an essential, evolutionarily co 96.42
cd01850276 CDC_Septin CDC/Septin. Septins are a conserved fam 96.34
COG1161 322 Predicted GTPases [General function prediction onl 96.29
KOG1424|consensus 562 96.28
KOG4273|consensus 418 96.23
COG5256 428 TEF1 Translation elongation factor EF-1alpha (GTPa 96.17
KOG2423|consensus 572 96.14
KOG1144|consensus 1064 96.06
PF11111176 CENP-M: Centromere protein M (CENP-M); InterPro: I 96.06
smart00053240 DYNc Dynamin, GTPase. Large GTPases that mediate v 95.98
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 95.97
KOG0458|consensus 603 95.95
PF03029238 ATP_bind_1: Conserved hypothetical ATP binding pro 95.88
PF03308266 ArgK: ArgK protein; InterPro: IPR005129 Bacterial 95.88
COG1217 603 TypA Predicted membrane GTPase involved in stress 95.84
COG1703323 ArgK Putative periplasmic protein kinase ArgK and 95.78
PRK00007 693 elongation factor G; Reviewed 95.62
cd03110179 Fer4_NifH_child This protein family's function is 95.5
cd01852196 AIG1 AIG1 (avrRpt2-induced gene 1). This represent 95.42
KOG0461|consensus 522 95.42
KOG0410|consensus410 95.32
KOG2484|consensus 435 95.06
PRK09602396 translation-associated GTPase; Reviewed 95.06
PF14331266 ImcF-related_N: ImcF-related N-terminal domain 95.01
COG0050 394 TufB GTPases - translation elongation factors [Tra 94.84
TIGR00490 720 aEF-2 translation elongation factor aEF-2. This mo 94.71
COG1149284 MinD superfamily P-loop ATPase containing an inser 93.85
KOG0466|consensus 466 93.76
PTZ00416 836 elongation factor 2; Provisional 92.45
KOG3886|consensus295 91.91
KOG0099|consensus379 91.81
PLN00116 843 translation elongation factor EF-2 subunit; Provis 91.59
KOG0468|consensus 971 91.5
PRK07560 731 elongation factor EF-2; Reviewed 91.27
COG5258 527 GTPBP1 GTPase [General function prediction only] 91.22
PF09419168 PGP_phosphatase: Mitochondrial PGP phosphatase; In 91.1
PRK13505557 formate--tetrahydrofolate ligase; Provisional 91.09
COG3596296 Predicted GTPase [General function prediction only 90.64
COG3640255 CooC CO dehydrogenase maturation factor [Cell divi 90.64
KOG0460|consensus 449 89.85
KOG1954|consensus 532 88.57
COG4963366 CpaE Flp pilus assembly protein, ATPase CpaE [Intr 84.97
KOG0447|consensus 980 84.71
PTZ00258390 GTP-binding protein; Provisional 84.32
TIGR03348 1169 VI_IcmF type VI secretion protein IcmF. Members of 83.46
KOG2485|consensus 335 83.27
COG0012372 Predicted GTPase, probable translation factor [Tra 82.59
COG0480 697 FusA Translation elongation factors (GTPases) [Tra 82.12
TIGR00064272 ftsY signal recognition particle-docking protein F 81.81
cd02038139 FleN-like FleN is a member of the Fer4_NifH superf 81.05
KOG1143|consensus 591 81.0
COG0523323 Putative GTPases (G3E family) [General function pr 80.75
>cd04148 RGK RGK subfamily Back     alignment and domain information
Probab=99.97  E-value=7.4e-30  Score=194.44  Aligned_cols=148  Identities=42%  Similarity=0.651  Sum_probs=122.5

Q ss_pred             hcccC-CCcEEEEEEeCCCHHHHHHHHHHHHHHHhhCCCCCceEEEEEecCCCCCccccChhHHHHHHHhcCCeEEEEec
Q psy15004          5 IANYE-TPHGFIIVYSTIDLASFHVAEQCLQALWKKDSIRSKAVILVANKTDLVRCRVVTDEDGKDMATAYDCKFIETSV   83 (167)
Q Consensus         5 ~~y~~-~ad~~i~v~d~t~~~s~~~~~~~~~~l~~~~~~~~~piilvgNK~Dl~~~~~v~~~~~~~~~~~~~~~~~e~SA   83 (167)
                      ..|+. ++|++|+|||++++.||+.+..|+.++.......++|+|+||||+|+.+.+.++.+++..++..++++|++|||
T Consensus        66 ~~~~~~~ad~iilV~d~td~~S~~~~~~~~~~l~~~~~~~~~piilV~NK~Dl~~~~~v~~~~~~~~a~~~~~~~~e~SA  145 (221)
T cd04148          66 DSCMQYQGDAFVVVYSVTDRSSFERASELRIQLRRNRQLEDRPIILVGNKSDLARSREVSVQEGRACAVVFDCKFIETSA  145 (221)
T ss_pred             hHHhhcCCCEEEEEEECCCHHHHHHHHHHHHHHHHhcCCCCCCEEEEEEChhccccceecHHHHHHHHHHcCCeEEEecC
Confidence            34566 99999999999999999999999999877544468999999999999887888888888899988999999999


Q ss_pred             CCCCCHHHHHHHHHHHHHhhhCCCCCCcchhhhhhhcccccCCCCCCCcCCCcccccchHHHHHHHHHhhc-------CC
Q psy15004         84 GINHNVDELLVGILTQIRLKLDNPPEPVLTREQFSCRRRRSKSPGGFRKLRGHRTSASLKVKGLLSKVWQR-------DS  156 (167)
Q Consensus        84 ~~~~~v~~lf~~l~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~k~~~~~~~~~~~-------~~  156 (167)
                      ++|.||+++|+++++++......++..               .+......++++.+...+++.||.+++.+       ++
T Consensus       146 ~~~~gv~~l~~~l~~~~~~~~~~~~~~---------------~~~~~~~~~~r~~~~~~~a~~~l~~~~~~~~~~~~~~~  210 (221)
T cd04148         146 GLQHNVDELLEGIVRQIRLRRDSKEKN---------------ERRSRRAYRGRRESLTSKAKRFLGKLVAKNNKGMAFKS  210 (221)
T ss_pred             CCCCCHHHHHHHHHHHHHhhhcccccc---------------CccccccccCccchHHHHHHHHHHHHhccccchhhhhh
Confidence            999999999999999998654433220               00012334567788999999999998874       45


Q ss_pred             CCCCCccCcCC
Q psy15004        157 KSKSCQNLHVL  167 (167)
Q Consensus       157 k~~~c~~~~~~  167 (167)
                      ||+||||||||
T Consensus       211 ~~~~~~~~~~~  221 (221)
T cd04148         211 KSKSCHDLSVL  221 (221)
T ss_pred             ccCCccccccC
Confidence            89999999998



The RGK (Rem, Rem2, Rad, Gem/Kir) subfamily of Ras GTPases are expressed in a tissue-specific manner and are dynamically regulated by transcriptional and posttranscriptional mechanisms in response to environmental cues. RGK proteins bind to the beta subunit of L-type calcium channels, causing functional down-regulation of these voltage-dependent calcium channels, and either termination of calcium-dependent secretion or modulation of electrical conduction and contractile function. Inhibition of L-type calcium channels by Rem2 may provide a mechanism for modulating calcium-triggered exocytosis in hormone-secreting cells, and has been proposed to influence the secretion of insulin in pancreatic beta cells. RGK proteins also interact with and inhibit the Rho/Rho kinase pathway to modulate remodeling of the cytoskeleton. Two characteristics of RGK proteins cited in the literature are N-terminal and C-terminal extensions beyond the GTPase domain typical of Ra

>KOG0078|consensus Back     alignment and domain information
>KOG0084|consensus Back     alignment and domain information
>KOG0092|consensus Back     alignment and domain information
>KOG0098|consensus Back     alignment and domain information
>KOG0093|consensus Back     alignment and domain information
>KOG0088|consensus Back     alignment and domain information
>cd04121 Rab40 Rab40 subfamily Back     alignment and domain information
>KOG0091|consensus Back     alignment and domain information
>KOG0080|consensus Back     alignment and domain information
>cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily Back     alignment and domain information
>KOG0087|consensus Back     alignment and domain information
>KOG0094|consensus Back     alignment and domain information
>cd04120 Rab12 Rab12 subfamily Back     alignment and domain information
>KOG0083|consensus Back     alignment and domain information
>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily Back     alignment and domain information
>KOG0081|consensus Back     alignment and domain information
>KOG0395|consensus Back     alignment and domain information
>cd04133 Rop_like Rop subfamily Back     alignment and domain information
>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily Back     alignment and domain information
>cd01873 RhoBTB RhoBTB subfamily Back     alignment and domain information
>KOG0086|consensus Back     alignment and domain information
>PTZ00099 rab6; Provisional Back     alignment and domain information
>KOG0079|consensus Back     alignment and domain information
>cd04131 Rnd Rnd subfamily Back     alignment and domain information
>cd04127 Rab27A Rab27a subfamily Back     alignment and domain information
>cd04103 Centaurin_gamma Centaurin gamma Back     alignment and domain information
>cd01875 RhoG RhoG subfamily Back     alignment and domain information
>cd04122 Rab14 Rab14 subfamily Back     alignment and domain information
>cd04126 Rab20 Rab20 subfamily Back     alignment and domain information
>cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily Back     alignment and domain information
>cd04144 Ras2 Ras2 subfamily Back     alignment and domain information
>cd04117 Rab15 Rab15 subfamily Back     alignment and domain information
>KOG0394|consensus Back     alignment and domain information
>cd04111 Rab39 Rab39 subfamily Back     alignment and domain information
>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily Back     alignment and domain information
>cd04175 Rap1 Rap1 subgroup Back     alignment and domain information
>cd04136 Rap_like Rap-like subfamily Back     alignment and domain information
>cd04109 Rab28 Rab28 subfamily Back     alignment and domain information
>smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>PTZ00369 Ras-like protein; Provisional Back     alignment and domain information
>PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>cd01874 Cdc42 Cdc42 subfamily Back     alignment and domain information
>KOG0097|consensus Back     alignment and domain information
>cd01865 Rab3 Rab3 subfamily Back     alignment and domain information
>cd04176 Rap2 Rap2 subgroup Back     alignment and domain information
>PLN03110 Rab GTPase; Provisional Back     alignment and domain information
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 Back     alignment and domain information
>cd04125 RabA_like RabA-like subfamily Back     alignment and domain information
>cd01871 Rac1_like Rac1-like subfamily Back     alignment and domain information
>cd04134 Rho3 Rho3 subfamily Back     alignment and domain information
>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily Back     alignment and domain information
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>cd04128 Spg1 Spg1p Back     alignment and domain information
>cd04142 RRP22 RRP22 subfamily Back     alignment and domain information
>cd04140 ARHI_like ARHI subfamily Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>cd04112 Rab26 Rab26 subfamily Back     alignment and domain information
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily Back     alignment and domain information
>PLN03108 Rab family protein; Provisional Back     alignment and domain information
>cd04110 Rab35 Rab35 subfamily Back     alignment and domain information
>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases Back     alignment and domain information
>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily Back     alignment and domain information
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily Back     alignment and domain information
>PLN03071 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd01868 Rab11_like Rab11-like Back     alignment and domain information
>KOG0095|consensus Back     alignment and domain information
>cd01866 Rab2 Rab2 subfamily Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>cd04106 Rab23_lke Rab23-like subfamily Back     alignment and domain information
>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>cd01864 Rab19 Rab19 subfamily Back     alignment and domain information
>cd04143 Rhes_like Rhes_like subfamily Back     alignment and domain information
>cd04132 Rho4_like Rho4-like subfamily Back     alignment and domain information
>cd04116 Rab9 Rab9 subfamily Back     alignment and domain information
>cd04101 RabL4 RabL4 (Rab-like4) subfamily Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>cd04177 RSR1 RSR1 subgroup Back     alignment and domain information
>PLN03118 Rab family protein; Provisional Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>cd04130 Wrch_1 Wrch-1 subfamily Back     alignment and domain information
>cd01892 Miro2 Miro2 subfamily Back     alignment and domain information
>cd04124 RabL2 RabL2 subfamily Back     alignment and domain information
>cd04118 Rab24 Rab24 subfamily Back     alignment and domain information
>KOG4252|consensus Back     alignment and domain information
>cd04158 ARD1 ARD1 subfamily Back     alignment and domain information
>cd04123 Rab21 Rab21 subfamily Back     alignment and domain information
>cd04129 Rho2 Rho2 subfamily Back     alignment and domain information
>cd04135 Tc10 TC10 subfamily Back     alignment and domain information
>cd04147 Ras_dva Ras-dva subfamily Back     alignment and domain information
>PLN00223 ADP-ribosylation factor; Provisional Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor Back     alignment and domain information
>cd01860 Rab5_related Rab5-related subfamily Back     alignment and domain information
>cd01863 Rab18 Rab18 subfamily Back     alignment and domain information
>cd04149 Arf6 Arf6 subfamily Back     alignment and domain information
>cd01861 Rab6 Rab6 subfamily Back     alignment and domain information
>cd04150 Arf1_5_like Arf1-Arf5-like subfamily Back     alignment and domain information
>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily Back     alignment and domain information
>cd01862 Rab7 Rab7 subfamily Back     alignment and domain information
>PTZ00133 ADP-ribosylation factor; Provisional Back     alignment and domain information
>cd04114 Rab30 Rab30 subfamily Back     alignment and domain information
>KOG0393|consensus Back     alignment and domain information
>cd00876 Ras Ras family Back     alignment and domain information
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily Back     alignment and domain information
>cd04154 Arl2 Arl2 subfamily Back     alignment and domain information
>cd01870 RhoA_like RhoA-like subfamily Back     alignment and domain information
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily Back     alignment and domain information
>cd01893 Miro1 Miro1 subfamily Back     alignment and domain information
>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>cd04157 Arl6 Arl6 subfamily Back     alignment and domain information
>cd04156 ARLTS1 ARLTS1 subfamily Back     alignment and domain information
>TIGR00157 ribosome small subunit-dependent GTPase A Back     alignment and domain information
>cd00157 Rho Rho (Ras homology) family Back     alignment and domain information
>cd04151 Arl1 Arl1 subfamily Back     alignment and domain information
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>cd04102 RabL3 RabL3 (Rab-like3) subfamily Back     alignment and domain information
>PTZ00132 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases Back     alignment and domain information
>TIGR02528 EutP ethanolamine utilization protein, EutP Back     alignment and domain information
>PRK12299 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>KOG3883|consensus Back     alignment and domain information
>PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>cd01898 Obg Obg subfamily Back     alignment and domain information
>cd01890 LepA LepA subfamily Back     alignment and domain information
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>KOG0073|consensus Back     alignment and domain information
>PLN00023 GTP-binding protein; Provisional Back     alignment and domain information
>KOG4423|consensus Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>TIGR02729 Obg_CgtA Obg family GTPase CgtA Back     alignment and domain information
>PRK15467 ethanolamine utilization protein EutP; Provisional Back     alignment and domain information
>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily Back     alignment and domain information
>KOG0075|consensus Back     alignment and domain information
>cd00882 Ras_like_GTPase Ras-like GTPase superfamily Back     alignment and domain information
>KOG0070|consensus Back     alignment and domain information
>cd04171 SelB SelB subfamily Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>TIGR03156 GTP_HflX GTP-binding protein HflX Back     alignment and domain information
>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE Back     alignment and domain information
>PRK12297 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>KOG0076|consensus Back     alignment and domain information
>TIGR00436 era GTP-binding protein Era Back     alignment and domain information
>COG1100 GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>cd01894 EngA1 EngA1 subfamily Back     alignment and domain information
>cd01855 YqeH YqeH Back     alignment and domain information
>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed Back     alignment and domain information
>PRK12289 GTPase RsgA; Reviewed Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>PRK04213 GTP-binding protein; Provisional Back     alignment and domain information
>PRK12296 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>PRK11058 GTPase HflX; Provisional Back     alignment and domain information
>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily Back     alignment and domain information
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes Back     alignment and domain information
>KOG0096|consensus Back     alignment and domain information
>cd01854 YjeQ_engC YjeQ/EngC Back     alignment and domain information
>PRK15494 era GTPase Era; Provisional Back     alignment and domain information
>TIGR00231 small_GTP small GTP-binding protein domain Back     alignment and domain information
>TIGR01393 lepA GTP-binding protein LepA Back     alignment and domain information
>cd01859 MJ1464 MJ1464 Back     alignment and domain information
>cd01895 EngA2 EngA2 subfamily Back     alignment and domain information
>PRK00098 GTPase RsgA; Reviewed Back     alignment and domain information
>KOG0072|consensus Back     alignment and domain information
>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily Back     alignment and domain information
>PRK12288 GTPase RsgA; Reviewed Back     alignment and domain information
>cd00880 Era_like Era (E Back     alignment and domain information
>cd00881 GTP_translation_factor GTP translation factor family Back     alignment and domain information
>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2) Back     alignment and domain information
>TIGR00437 feoB ferrous iron transporter FeoB Back     alignment and domain information
>PRK12298 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>KOG1673|consensus Back     alignment and domain information
>PRK00089 era GTPase Era; Reviewed Back     alignment and domain information
>KOG0071|consensus Back     alignment and domain information
>TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>PRK05433 GTP-binding protein LepA; Provisional Back     alignment and domain information
>TIGR00475 selB selenocysteine-specific elongation factor SelB Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>KOG1707|consensus Back     alignment and domain information
>cd01889 SelB_euk SelB subfamily Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins Back     alignment and domain information
>PRK00454 engB GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site Back     alignment and domain information
>TIGR00487 IF-2 translation initiation factor IF-2 Back     alignment and domain information
>TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha Back     alignment and domain information
>cd01858 NGP_1 NGP-1 Back     alignment and domain information
>cd01849 YlqF_related_GTPase YlqF-related GTPases Back     alignment and domain information
>CHL00189 infB translation initiation factor 2; Provisional Back     alignment and domain information
>PRK05306 infB translation initiation factor IF-2; Validated Back     alignment and domain information
>TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2 Back     alignment and domain information
>KOG0074|consensus Back     alignment and domain information
>cd01856 YlqF YlqF Back     alignment and domain information
>PRK09554 feoB ferrous iron transport protein B; Reviewed Back     alignment and domain information
>cd01857 HSR1_MMR1 HSR1/MMR1 Back     alignment and domain information
>TIGR03680 eif2g_arch translation initiation factor 2 subunit gamma Back     alignment and domain information
>COG2262 HflX GTPases [General function prediction only] Back     alignment and domain information
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>PRK04000 translation initiation factor IF-2 subunit gamma; Validated Back     alignment and domain information
>PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional Back     alignment and domain information
>TIGR01394 TypA_BipA GTP-binding protein TypA/BipA Back     alignment and domain information
>cd01876 YihA_EngB The YihA (EngB) subfamily Back     alignment and domain information
>smart00010 small_GTPase Small GTPase of the Ras superfamily; ill-defined subfamily Back     alignment and domain information
>COG2229 Predicted GTPase [General function prediction only] Back     alignment and domain information
>KOG1489|consensus Back     alignment and domain information
>PRK13796 GTPase YqeH; Provisional Back     alignment and domain information
>PRK12317 elongation factor 1-alpha; Reviewed Back     alignment and domain information
>COG1159 Era GTPase [General function prediction only] Back     alignment and domain information
>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>PRK14845 translation initiation factor IF-2; Provisional Back     alignment and domain information
>PRK04004 translation initiation factor IF-2; Validated Back     alignment and domain information
>TIGR00101 ureG urease accessory protein UreG Back     alignment and domain information
>PRK09866 hypothetical protein; Provisional Back     alignment and domain information
>cd04166 CysN_ATPS CysN_ATPS subfamily Back     alignment and domain information
>PRK01889 GTPase RsgA; Reviewed Back     alignment and domain information
>PRK09563 rbgA GTPase YlqF; Reviewed Back     alignment and domain information
>cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily Back     alignment and domain information
>cd04165 GTPBP1_like GTPBP1-like Back     alignment and domain information
>COG0536 Obg Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta) Back     alignment and domain information
>PRK10218 GTP-binding protein; Provisional Back     alignment and domain information
>TIGR00073 hypB hydrogenase accessory protein HypB Back     alignment and domain information
>cd04167 Snu114p Snu114p subfamily Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>KOG0462|consensus Back     alignment and domain information
>COG0481 LepA Membrane GTPase LepA [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG0486 ThdF Predicted GTPase [General function prediction only] Back     alignment and domain information
>COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd00066 G-alpha G protein alpha subunit Back     alignment and domain information
>PLN00043 elongation factor 1-alpha; Provisional Back     alignment and domain information
>KOG0077|consensus Back     alignment and domain information
>COG1162 Predicted GTPases [General function prediction only] Back     alignment and domain information
>cd04168 TetM_like Tet(M)-like subfamily Back     alignment and domain information
>smart00275 G_alpha G protein alpha subunit Back     alignment and domain information
>cd01884 EF_Tu EF-Tu subfamily Back     alignment and domain information
>PTZ00327 eukaryotic translation initiation factor 2 gamma subunit; Provisional Back     alignment and domain information
>PRK12736 elongation factor Tu; Reviewed Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>KOG1423|consensus Back     alignment and domain information
>cd01885 EF2 EF2 (for archaea and eukarya) Back     alignment and domain information
>PRK12735 elongation factor Tu; Reviewed Back     alignment and domain information
>TIGR00485 EF-Tu translation elongation factor TU Back     alignment and domain information
>COG0370 FeoB Fe2+ transport system protein B [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13351 elongation factor G; Reviewed Back     alignment and domain information
>PRK00741 prfC peptide chain release factor 3; Provisional Back     alignment and domain information
>KOG1145|consensus Back     alignment and domain information
>COG4917 EutP Ethanolamine utilization protein [Amino acid transport and metabolism] Back     alignment and domain information
>PF06858 NOG1: Nucleolar GTP-binding protein 1 (NOG1); InterPro: IPR010674 This domain represents a conserved region of approximately 60 residues in length within nucleolar GTP-binding protein 1 (NOG1) Back     alignment and domain information
>KOG1707|consensus Back     alignment and domain information
>COG1084 Predicted GTPase [General function prediction only] Back     alignment and domain information
>TIGR02034 CysN sulfate adenylyltransferase, large subunit Back     alignment and domain information
>PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional Back     alignment and domain information
>KOG3905|consensus Back     alignment and domain information
>PRK12740 elongation factor G; Reviewed Back     alignment and domain information
>CHL00071 tufA elongation factor Tu Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>PRK00049 elongation factor Tu; Reviewed Back     alignment and domain information
>KOG1490|consensus Back     alignment and domain information
>cd01899 Ygr210 Ygr210 subfamily Back     alignment and domain information
>cd04169 RF3 RF3 subfamily Back     alignment and domain information
>cd04104 p47_IIGP_like p47 (47-kDa) family Back     alignment and domain information
>COG1163 DRG Predicted GTPase [General function prediction only] Back     alignment and domain information
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>COG5257 GCD11 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0090|consensus Back     alignment and domain information
>PLN03127 Elongation factor Tu; Provisional Back     alignment and domain information
>COG0218 Predicted GTPase [General function prediction only] Back     alignment and domain information
>COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] Back     alignment and domain information
>PTZ00141 elongation factor 1- alpha; Provisional Back     alignment and domain information
>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily Back     alignment and domain information
>PF09439 SRPRB: Signal recognition particle receptor beta subunit; InterPro: IPR019009 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>cd01886 EF-G Elongation factor G (EF-G) subfamily Back     alignment and domain information
>KOG1191|consensus Back     alignment and domain information
>PLN03126 Elongation factor Tu; Provisional Back     alignment and domain information
>KOG1532|consensus Back     alignment and domain information
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional Back     alignment and domain information
>TIGR00484 EF-G translation elongation factor EF-G Back     alignment and domain information
>cd04178 Nucleostemin_like Nucleostemin-like Back     alignment and domain information
>PRK12739 elongation factor G; Reviewed Back     alignment and domain information
>PF05783 DLIC: Dynein light intermediate chain (DLIC); InterPro: IPR022780 This entry consists of several eukaryotic dynein light intermediate chain proteins Back     alignment and domain information
>PF04670 Gtr1_RagA: Gtr1/RagA G protein conserved region; InterPro: IPR006762 GTR1 was first identified in Saccharomyces cerevisiae (Baker's yeast) as a suppressor of a mutation in RCC1 Back     alignment and domain information
>COG2895 CysN GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00503 prfC peptide chain release factor 3 Back     alignment and domain information
>KOG0082|consensus Back     alignment and domain information
>PF00503 G-alpha: G-protein alpha subunit; InterPro: IPR001019 Guanine nucleotide binding proteins (G proteins) are membrane-associated, heterotrimeric proteins composed of three subunits: alpha (IPR001019 from INTERPRO), beta (IPR001632 from INTERPRO) and gamma (IPR001770 from INTERPRO) [] Back     alignment and domain information
>COG3276 SelB Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02836 spore_IV_A stage IV sporulation protein A Back     alignment and domain information
>cd01882 BMS1 Bms1 Back     alignment and domain information
>cd01850 CDC_Septin CDC/Septin Back     alignment and domain information
>COG1161 Predicted GTPases [General function prediction only] Back     alignment and domain information
>KOG1424|consensus Back     alignment and domain information
>KOG4273|consensus Back     alignment and domain information
>COG5256 TEF1 Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2423|consensus Back     alignment and domain information
>KOG1144|consensus Back     alignment and domain information
>PF11111 CENP-M: Centromere protein M (CENP-M); InterPro: IPR020987 The prime candidate for specifying centromere identity is the array of nucleosomes assembles associated with CENP-A [] Back     alignment and domain information
>smart00053 DYNc Dynamin, GTPase Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>KOG0458|consensus Back     alignment and domain information
>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity Back     alignment and domain information
>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>COG1217 TypA Predicted membrane GTPase involved in stress response [Signal transduction mechanisms] Back     alignment and domain information
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] Back     alignment and domain information
>PRK00007 elongation factor G; Reviewed Back     alignment and domain information
>cd03110 Fer4_NifH_child This protein family's function is unkown Back     alignment and domain information
>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1) Back     alignment and domain information
>KOG0461|consensus Back     alignment and domain information
>KOG0410|consensus Back     alignment and domain information
>KOG2484|consensus Back     alignment and domain information
>PRK09602 translation-associated GTPase; Reviewed Back     alignment and domain information
>PF14331 ImcF-related_N: ImcF-related N-terminal domain Back     alignment and domain information
>COG0050 TufB GTPases - translation elongation factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00490 aEF-2 translation elongation factor aEF-2 Back     alignment and domain information
>COG1149 MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion] Back     alignment and domain information
>KOG0466|consensus Back     alignment and domain information
>PTZ00416 elongation factor 2; Provisional Back     alignment and domain information
>KOG3886|consensus Back     alignment and domain information
>KOG0099|consensus Back     alignment and domain information
>PLN00116 translation elongation factor EF-2 subunit; Provisional Back     alignment and domain information
>KOG0468|consensus Back     alignment and domain information
>PRK07560 elongation factor EF-2; Reviewed Back     alignment and domain information
>COG5258 GTPBP1 GTPase [General function prediction only] Back     alignment and domain information
>PF09419 PGP_phosphatase: Mitochondrial PGP phosphatase; InterPro: IPR010021 This group of hypothetical proteins is a part of the IIIA subfamily of the haloacid dehalogenase (HAD) superfamily of hydrolases Back     alignment and domain information
>PRK13505 formate--tetrahydrofolate ligase; Provisional Back     alignment and domain information
>COG3596 Predicted GTPase [General function prediction only] Back     alignment and domain information
>COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0460|consensus Back     alignment and domain information
>KOG1954|consensus Back     alignment and domain information
>COG4963 CpaE Flp pilus assembly protein, ATPase CpaE [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0447|consensus Back     alignment and domain information
>PTZ00258 GTP-binding protein; Provisional Back     alignment and domain information
>TIGR03348 VI_IcmF type VI secretion protein IcmF Back     alignment and domain information
>KOG2485|consensus Back     alignment and domain information
>COG0012 Predicted GTPase, probable translation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0480 FusA Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>cd02038 FleN-like FleN is a member of the Fer4_NifH superfamily Back     alignment and domain information
>KOG1143|consensus Back     alignment and domain information
>COG0523 Putative GTPases (G3E family) [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query167
2g3y_A211 Crystal Structure Of The Human Small Gtpase Gem Len 1e-17
2ht6_A174 Crystal Structure Of Human Gem G-Domain Bound To Gd 4e-17
2cjw_B192 Crystal Structure Of The Small Gtpase Gem (Gemdndca 5e-17
2dpx_A174 Crystal Structure Of Human Rad Gtpase Length = 174 2e-16
2gjs_A176 The Crystal Structure Of Human Rrad In Complex With 2e-16
3q72_A166 Crystal Structure Of Rad G-Domain-Gtp Analog Comple 6e-16
2cjw_A192 Crystal Structure Of The Small Gtpase Gem (Gemdndca 8e-16
2nzj_A175 The Crystal Structure Of Rem1 In Complex With Gdp L 1e-13
3cbq_A195 Crystal Structure Of The Human Rem2 Gtpase With Bou 3e-13
3q85_A169 Crystal Structure Of Rem2 G-Domain -Gtp Analog Comp 6e-13
4aii_A180 Crystal Structure Of The Rat Rem2 Gtpase - G Domain 7e-13
3pir_A183 Crystal Structure Of M-Rasd41e In Complex With Gppn 6e-11
3kko_A183 Crystal Structure Of M-Ras P40dD41EL51R IN COMPLEX 6e-11
3kkp_A183 Crystal Structure Of M-Ras P40d In Complex With Gpp 7e-11
1x1r_A178 Crystal Structure Of M-Ras In Complex With Gdp Leng 7e-11
2rhd_A175 Crystal Structure Of Cryptosporidium Parvum Small G 5e-10
3oes_A201 Crystal Structure Of The Small Gtpase Rhebl1 Length 3e-08
2erx_A172 Crystal Structure Of Diras2 In Complex With Gdp And 2e-07
2bov_A206 Molecular Recognition Of An Adp-Ribosylating Clostr 5e-07
3rap_R167 The Small G Protein Rap2 In A Non Catalytic Complex 8e-07
2a78_A187 Crystal Structure Of The C3bot-Rala Complex Reveals 9e-07
1uad_A175 Crystal Structure Of The Rala-gppnhp-sec5 Ral-bindi 9e-07
1zc3_A175 Crystal Structure Of The Ral-Binding Domain Of Exo8 1e-06
3jza_A175 Crystal Structure Of Human Rab1b In Complex With Th 1e-06
1u8y_A168 Crystal Structures Of Ral-Gppnhp And Ral-Gdp Reveal 1e-06
4i1o_A181 Crystal Structure Of The Legionella Pneumophila Gap 1e-06
2kwi_A178 Ralb-Rlip76 (Ralbp1) Complex Length = 178 1e-06
2ery_A172 The Crystal Structure Of The Ras Related Protein Rr 2e-06
3tkl_A196 Crystal Structure Of The Gtp-Bound Rab1a In Complex 2e-06
2ke5_A174 Solution Structure And Dynamics Of The Small Gtpase 2e-06
2f9l_A199 3d Structure Of Inactive Human Rab11b Gtpase Length 2e-06
2fol_A191 Crystal Structure Of Human Rab1a In Complex With Gd 2e-06
3sfv_A181 Crystal Structure Of The Gdp-Bound Rab1a S25n Mutan 3e-06
4fmd_F164 Espg-Rab1 Complex Structure At 3.05 A Length = 164 3e-06
2g6b_A180 Crystal Structure Of Human Rab26 In Complex With A 3e-06
4fmb_B171 Vira-Rab1 Complex Structure Length = 171 3e-06
1c1y_A167 Crystal Structure Of Rap.Gmppnp In Complex With The 3e-06
4fmc_B171 Espg-Rab1 Complex Length = 171 3e-06
1gua_A167 Human Rap1a, Residues 1-167, Double Mutant (E30d,K3 4e-06
1ukv_Y206 Structure Of Rabgdp-Dissociation Inhibitor In Compl 4e-06
2bcg_Y206 Structure Of Doubly Prenylated Ypt1:gdi Complex Len 4e-06
1yzn_A185 Gppnhp-Bound Ypt1p Gtpase Length = 185 5e-06
3brw_D167 Structure Of The Rap-Rapgap Complex Length = 167 5e-06
4dxa_A169 Co-Crystal Structure Of Rap1 In Complex With Krit1 5e-06
3l0i_B199 Complex Structure Of Sidm/drra With The Wild Type R 9e-06
2gf0_A199 The Crystal Structure Of The Human Diras1 Gtpase In 9e-06
1d5c_A162 Crystal Structure Of Plasmodium Falciparum Rab6 Com 1e-05
4q21_A189 Molecular Switch For Signal Transduction: Structura 2e-05
3cph_A213 Crystal Structure Of Sec4 In Complex With Rab-Gdi L 2e-05
2eqb_A174 Crystal Structure Of The Rab Gtpase Sec4p, The Sec2 2e-05
1xtq_A177 Structure Of Small Gtpase Human Rheb In Complex Wit 2e-05
3t5g_A181 Structure Of Fully Modified Farnesylated Rheb In Co 2e-05
2atv_A196 The Crystal Structure Of Human Rerg In The Gdp Boun 2e-05
2gf9_A189 Crystal Structure Of Human Rab3d In Complex With Gd 2e-05
3sea_A167 Structure Of Rheb-Y35a Mutant In Gdp- And Gmppnp-Bo 2e-05
2l0x_A169 Solution Structure Of The 21 Kda Gtpase Rheb Bound 3e-05
2y8e_A179 Crystal Structure Of D. Melanogaster Rab6 Gtpase Bo 3e-05
2fe4_A171 The Crystal Structure Of Human Neuronal Rab6b In It 3e-05
1g17_A170 Crystal Structure Of Sec4-Guanosine-5'-(Beta,Gamma) 3e-05
2wwx_A175 Crystal Structure Of The SidmDRRA(GEFGDF DOMAIN)-Ra 4e-05
3bfk_A181 Crystal Structure Of Plasmodium Falciparum Rab11a I 4e-05
2efc_B181 Ara7-GdpATVPS9A Length = 181 4e-05
3c5c_A187 Crystal Structure Of Human Ras-Like, Family 12 Prot 5e-05
3qbt_A174 Crystal Structure Of Ocrl1 540-678 In Complex With 6e-05
2ocy_C170 Complex Of The Guanine Exchange Factor Sec2p And Th 7e-05
2fu5_C183 Structure Of Rab8 In Complex With Mss4 Length = 183 7e-05
1g16_A170 Crystal Structure Of Sec4-Gdp Length = 170 9e-05
4epx_A170 Discovery Of Small Molecules That Bind To K-Ras And 9e-05
4ept_A170 Discovery Of Small Molecules That Bind To K-Ras And 9e-05
2fn4_A181 The Crystal Structure Of Human Ras-Related Protein, 1e-04
4epr_A170 Discovery Of Small Molecules That Bind To K-Ras And 1e-04
3bbp_A211 Rab6-Gtp:gcc185 Rab Binding Domain Complex Length = 1e-04
2cl0_X166 Crystal Structure Analysis Of A Fluorescent Form Of 1e-04
1yzq_A170 Gppnhp-Bound Rab6 Gtpase Length = 170 1e-04
2cld_X166 Crystal Structure Analysis Of A Fluorescent Form Of 2e-04
3rab_A169 Gppnhp-bound Rab3a At 2.0 A Resolution Length = 169 2e-04
4dkx_A216 Crystal Structure Of The Rab 6a'(Q72l) Length = 216 2e-04
3cwz_A188 Strucure Of Rab6(Gtp)-R6ip1 Complex Length = 188 2e-04
3gft_A187 Human K-Ras In Complex With A Gtp Analogue Length = 2e-04
2gil_A162 Structure Of The Extremely Slow Gtpase Rab6a In The 2e-04
1xcm_A167 Crystal Structure Of The Gppnhp-Bound H-Ras G60a Mu 3e-04
4efm_A171 Crystal Structure Of H-Ras G12v In Complex With Gpp 3e-04
4efl_A171 Crystal Structure Of H-Ras Wt In Complex With Gppnh 3e-04
1oiv_A191 X-Ray Structure Of The Small G Protein Rab11a In Co 3e-04
3kkm_A172 Crystal Structure Of H-Ras T35s In Complex With Gpp 3e-04
1xj0_A166 Crystal Structure Of The Gdp-Bound Form Of The Rasg 3e-04
2c5l_A173 Structure Of Plc Epsilon Ras Association Domain Wit 3e-04
1oiw_A191 X-ray Structure Of The Small G Protein Rab11a In Co 3e-04
4efn_A171 Crystal Structure Of H-Ras Q61l In Complex With Gpp 3e-04
6q21_A171 Molecular Switch For Signal Transduction: Structura 3e-04
2q21_A171 Crystal Structures At 2.2 Angstroms Resolution Of T 3e-04
3ddc_A166 Crystal Structure Of Nore1a In Complex With Ras Len 3e-04
1lfd_B167 Crystal Structure Of The Active Ras Protein Complex 3e-04
1iaq_A166 C-H-Ras P21 Protein Mutant With Thr 35 Replaced By 3e-04
1yzk_A184 Gppnhp Bound Rab11 Gtpase Length = 184 3e-04
4dso_A189 Small-Molecule Ligands Bind To A Distinct Pocket In 3e-04
1zbd_A203 Structural Basis Of Rab Effector Specificity: Cryst 3e-04
3cpj_B223 Crystal Structure Of Ypt31 In Complex With Yeast Ra 4e-04
221p_A166 Three-Dimensional Structures Of H-Ras P21 Mutants: 4e-04
1lf0_A166 Crystal Structure Of Rasa59g In The Gtp-Bound Form 4e-04
2f7s_A217 The Crystal Structure Of Human Rab27b Bound To Gdp 4e-04
1zvq_A166 Structure Of The Q61g Mutant Of Ras In The Gdp-Boun 4e-04
1nvv_Q166 Structural Evidence For Feedback Activation By Rasg 4e-04
1wq1_R166 Ras-Rasgap Complex Length = 166 4e-04
1rvd_A166 H-Ras Complexed With Diaminobenzophenone-Beta,Gamma 4e-04
3v4f_A166 H-Ras Peg 400CACL2, ORDERED OFF Length = 166 4e-04
3k9n_A166 Allosteric Modulation Of H-Ras Gtpase Length = 166 4e-04
2rgb_A166 Crystal Structure Of H-Rasq61k-Gppnhp Length = 166 4e-04
521p_A166 Three-Dimensional Structures Of H-Ras P21 Mutants: 4e-04
3lo5_A166 Crystal Structure Of The Dominant Negative S17n Mut 4e-04
1clu_A166 H-Ras Complexed With Diaminobenzophenone-Beta,Gamma 4e-04
3i3s_R166 Crystal Structure Of H-Ras With Thr50 Replaced By I 4e-04
1zw6_A166 Crystal Structure Of The Gtp-Bound Form Of Rasq61g 4e-04
621p_A166 Three-Dimensional Structures Of H-Ras P21 Mutants: 4e-04
421p_A166 Three-Dimensional Structures Of H-Ras P21 Mutants: 4e-04
721p_A166 Three-Dimensional Structures Of H-Ras P21 Mutants: 4e-04
2rga_A166 Crystal Structure Of H-Rasq61i-Gppnhp Length = 166 4e-04
2rgc_A166 Crystal Structure Of H-Rasq61v-Gppnhp Length = 166 5e-04
2hv8_A172 Crystal Structure Of Gtp-Bound Rab11 In Complex Wit 5e-04
2d7c_A167 Crystal Structure Of Human Rab11 In Complex With Fi 5e-04
2gzd_A173 Crystal Structure Of Rab11 In Complex With Rab11-Fi 5e-04
1agp_A166 Three-Dimensional Structures And Properties Of A Tr 5e-04
2iez_A220 Crystal Structure Of Mouse Rab27b Bound To Gdp In M 6e-04
3bc1_A195 Crystal Structure Of The Complex Rab27a-slp2a Lengt 6e-04
1jah_A166 H-Ras P21 Protein Mutant G12p, Complexed With Guano 6e-04
1yvd_A169 Gppnhp-Bound Rab22 Gtpase Length = 169 6e-04
1z0j_A170 Structure Of Gtp-Bound Rab22q64l Gtpase In Complex 7e-04
3rwm_B185 Crystal Structure Of Ypt32 In Complex With Gppnhp L 7e-04
2quz_A166 Crystal Structure Of The Activating H-Rask117r Muta 8e-04
3dz8_A191 Crystal Structure Of Human Rab3b Gtpase Bound With 9e-04
>pdb|2G3Y|A Chain A, Crystal Structure Of The Human Small Gtpase Gem Length = 211 Back     alignment and structure

Iteration: 1

Score = 85.5 bits (210), Expect = 1e-17, Method: Compositional matrix adjust. Identities = 43/100 (43%), Positives = 59/100 (59%) Query: 9 ETPHGFIIVYSTIDLASFHVAEQCLQALWKKDSIRSKAVILVANKTDLVRCRVVTDEDGK 68 + ++IVYS D ASF A + L + +ILV NK+DLVRCR V+ +G+ Sbjct: 110 QVGDAYLIVYSITDRASFEKASELRIQLRRARQTEDIPIILVGNKSDLVRCREVSVSEGR 169 Query: 69 DMATAYDCKFIETSVGINHNVDELLVGILTQIRLKLDNPP 108 A +DCKFIETS + HNV EL GI+ Q+RL+ D+ Sbjct: 170 ACAVVFDCKFIETSAAVQHNVKELFEGIVRQVRLRRDSKE 209
>pdb|2HT6|A Chain A, Crystal Structure Of Human Gem G-Domain Bound To Gdp Length = 174 Back     alignment and structure
>pdb|2CJW|B Chain B, Crystal Structure Of The Small Gtpase Gem (Gemdndcam) In Complex To Mg.Gdp Length = 192 Back     alignment and structure
>pdb|2DPX|A Chain A, Crystal Structure Of Human Rad Gtpase Length = 174 Back     alignment and structure
>pdb|2GJS|A Chain A, The Crystal Structure Of Human Rrad In Complex With Gdp Length = 176 Back     alignment and structure
>pdb|3Q72|A Chain A, Crystal Structure Of Rad G-Domain-Gtp Analog Complex Length = 166 Back     alignment and structure
>pdb|2CJW|A Chain A, Crystal Structure Of The Small Gtpase Gem (Gemdndcam) In Complex To Mg.Gdp Length = 192 Back     alignment and structure
>pdb|2NZJ|A Chain A, The Crystal Structure Of Rem1 In Complex With Gdp Length = 175 Back     alignment and structure
>pdb|3CBQ|A Chain A, Crystal Structure Of The Human Rem2 Gtpase With Bound Gdp Length = 195 Back     alignment and structure
>pdb|3Q85|A Chain A, Crystal Structure Of Rem2 G-Domain -Gtp Analog Complex Length = 169 Back     alignment and structure
>pdb|4AII|A Chain A, Crystal Structure Of The Rat Rem2 Gtpase - G Domain Bound To Gdp Length = 180 Back     alignment and structure
>pdb|3PIR|A Chain A, Crystal Structure Of M-Rasd41e In Complex With Gppnhp (Type 1) Length = 183 Back     alignment and structure
>pdb|3KKO|A Chain A, Crystal Structure Of M-Ras P40dD41EL51R IN COMPLEX WITH GP Length = 183 Back     alignment and structure
>pdb|3KKP|A Chain A, Crystal Structure Of M-Ras P40d In Complex With Gppnhp Length = 183 Back     alignment and structure
>pdb|1X1R|A Chain A, Crystal Structure Of M-Ras In Complex With Gdp Length = 178 Back     alignment and structure
>pdb|2RHD|A Chain A, Crystal Structure Of Cryptosporidium Parvum Small Gtpase Rab1a Length = 175 Back     alignment and structure
>pdb|3OES|A Chain A, Crystal Structure Of The Small Gtpase Rhebl1 Length = 201 Back     alignment and structure
>pdb|2ERX|A Chain A, Crystal Structure Of Diras2 In Complex With Gdp And Inorganic Phosphate Length = 172 Back     alignment and structure
>pdb|2BOV|A Chain A, Molecular Recognition Of An Adp-Ribosylating Clostridium Botulinum C3 Exoenzyme By Rala Gtpase Length = 206 Back     alignment and structure
>pdb|3RAP|R Chain R, The Small G Protein Rap2 In A Non Catalytic Complex With Gtp Length = 167 Back     alignment and structure
>pdb|2A78|A Chain A, Crystal Structure Of The C3bot-Rala Complex Reveals A Novel Type Of Action Of A Bacterial Exoenzyme Length = 187 Back     alignment and structure
>pdb|1UAD|A Chain A, Crystal Structure Of The Rala-gppnhp-sec5 Ral-binding Domain Complex Length = 175 Back     alignment and structure
>pdb|1ZC3|A Chain A, Crystal Structure Of The Ral-Binding Domain Of Exo84 In Complex With The Active Rala Length = 175 Back     alignment and structure
>pdb|3JZA|A Chain A, Crystal Structure Of Human Rab1b In Complex With The Gef Domain Of DrraSIDM FROM LEGIONELLA PNEUMOPHILA Length = 175 Back     alignment and structure
>pdb|1U8Y|A Chain A, Crystal Structures Of Ral-Gppnhp And Ral-Gdp Reveal Two Novel Binding Sites That Are Also Present In Ras And Rap Length = 168 Back     alignment and structure
>pdb|4I1O|A Chain A, Crystal Structure Of The Legionella Pneumophila Gap Domain Of Lepb In Complex With Rab1b Bound To Gdp And Bef3 Length = 181 Back     alignment and structure
>pdb|2KWI|A Chain A, Ralb-Rlip76 (Ralbp1) Complex Length = 178 Back     alignment and structure
>pdb|2ERY|A Chain A, The Crystal Structure Of The Ras Related Protein Rras2 (Rras2) In The Gdp Bound State Length = 172 Back     alignment and structure
>pdb|3TKL|A Chain A, Crystal Structure Of The Gtp-Bound Rab1a In Complex With The Coiled- Coil Domain Of Lida From Legionella Pneumophila Length = 196 Back     alignment and structure
>pdb|2KE5|A Chain A, Solution Structure And Dynamics Of The Small Gtpase Ralb In Its Active Conformation: Significance For Effector Protein Binding Length = 174 Back     alignment and structure
>pdb|2F9L|A Chain A, 3d Structure Of Inactive Human Rab11b Gtpase Length = 199 Back     alignment and structure
>pdb|2FOL|A Chain A, Crystal Structure Of Human Rab1a In Complex With Gdp Length = 191 Back     alignment and structure
>pdb|3SFV|A Chain A, Crystal Structure Of The Gdp-Bound Rab1a S25n Mutant In Complex With The Coiled-Coil Domain Of Lida From Legionella Pneumophila Length = 181 Back     alignment and structure
>pdb|4FMD|F Chain F, Espg-Rab1 Complex Structure At 3.05 A Length = 164 Back     alignment and structure
>pdb|2G6B|A Chain A, Crystal Structure Of Human Rab26 In Complex With A Gtp Analogue Length = 180 Back     alignment and structure
>pdb|4FMB|B Chain B, Vira-Rab1 Complex Structure Length = 171 Back     alignment and structure
>pdb|1C1Y|A Chain A, Crystal Structure Of Rap.Gmppnp In Complex With The Ras- Binding-Domain Of C-Raf1 Kinase (Rafrbd) Length = 167 Back     alignment and structure
>pdb|4FMC|B Chain B, Espg-Rab1 Complex Length = 171 Back     alignment and structure
>pdb|1GUA|A Chain A, Human Rap1a, Residues 1-167, Double Mutant (E30d,K31e) Complexed With Gppnhp And The Ras-Binding-Domain Of Human C-Raf1, Residues 51-131 Length = 167 Back     alignment and structure
>pdb|1UKV|Y Chain Y, Structure Of Rabgdp-Dissociation Inhibitor In Complex With Prenylated Ypt1 Gtpase Length = 206 Back     alignment and structure
>pdb|2BCG|Y Chain Y, Structure Of Doubly Prenylated Ypt1:gdi Complex Length = 206 Back     alignment and structure
>pdb|1YZN|A Chain A, Gppnhp-Bound Ypt1p Gtpase Length = 185 Back     alignment and structure
>pdb|3BRW|D Chain D, Structure Of The Rap-Rapgap Complex Length = 167 Back     alignment and structure
>pdb|4DXA|A Chain A, Co-Crystal Structure Of Rap1 In Complex With Krit1 Length = 169 Back     alignment and structure
>pdb|3L0I|B Chain B, Complex Structure Of Sidm/drra With The Wild Type Rab1 Length = 199 Back     alignment and structure
>pdb|2GF0|A Chain A, The Crystal Structure Of The Human Diras1 Gtpase In The Inactive Gdp Bound State Length = 199 Back     alignment and structure
>pdb|1D5C|A Chain A, Crystal Structure Of Plasmodium Falciparum Rab6 Complexed With Gdp Length = 162 Back     alignment and structure
>pdb|4Q21|A Chain A, Molecular Switch For Signal Transduction: Structural Differences Between Active And Inactive Forms Of Protooncogenic Ras Proteins Length = 189 Back     alignment and structure
>pdb|3CPH|A Chain A, Crystal Structure Of Sec4 In Complex With Rab-Gdi Length = 213 Back     alignment and structure
>pdb|2EQB|A Chain A, Crystal Structure Of The Rab Gtpase Sec4p, The Sec2p Gef Domain, And Phosphate Complex Length = 174 Back     alignment and structure
>pdb|1XTQ|A Chain A, Structure Of Small Gtpase Human Rheb In Complex With Gdp Length = 177 Back     alignment and structure
>pdb|3T5G|A Chain A, Structure Of Fully Modified Farnesylated Rheb In Complex With Pde6d Length = 181 Back     alignment and structure
>pdb|2ATV|A Chain A, The Crystal Structure Of Human Rerg In The Gdp Bound State Length = 196 Back     alignment and structure
>pdb|2GF9|A Chain A, Crystal Structure Of Human Rab3d In Complex With Gdp Length = 189 Back     alignment and structure
>pdb|3SEA|A Chain A, Structure Of Rheb-Y35a Mutant In Gdp- And Gmppnp-Bound Forms Length = 167 Back     alignment and structure
>pdb|2L0X|A Chain A, Solution Structure Of The 21 Kda Gtpase Rheb Bound To Gdp Length = 169 Back     alignment and structure
>pdb|2Y8E|A Chain A, Crystal Structure Of D. Melanogaster Rab6 Gtpase Bound To Gmppnp Length = 179 Back     alignment and structure
>pdb|2FE4|A Chain A, The Crystal Structure Of Human Neuronal Rab6b In Its Inactive Gdp-Bound Form Length = 171 Back     alignment and structure
>pdb|1G17|A Chain A, Crystal Structure Of Sec4-Guanosine-5'-(Beta,Gamma)- Imidotriphosphate Length = 170 Back     alignment and structure
>pdb|2WWX|A Chain A, Crystal Structure Of The SidmDRRA(GEFGDF DOMAIN)-Rab1 (Gtpase Domain) Complex Length = 175 Back     alignment and structure
>pdb|3BFK|A Chain A, Crystal Structure Of Plasmodium Falciparum Rab11a In Complex With Gdp Length = 181 Back     alignment and structure
>pdb|2EFC|B Chain B, Ara7-GdpATVPS9A Length = 181 Back     alignment and structure
>pdb|3C5C|A Chain A, Crystal Structure Of Human Ras-Like, Family 12 Protein In Complex With Gdp Length = 187 Back     alignment and structure
>pdb|3QBT|A Chain A, Crystal Structure Of Ocrl1 540-678 In Complex With Rab8a:gppnhp Length = 174 Back     alignment and structure
>pdb|2OCY|C Chain C, Complex Of The Guanine Exchange Factor Sec2p And The Rab Gtpase Sec4p Length = 170 Back     alignment and structure
>pdb|2FU5|C Chain C, Structure Of Rab8 In Complex With Mss4 Length = 183 Back     alignment and structure
>pdb|1G16|A Chain A, Crystal Structure Of Sec4-Gdp Length = 170 Back     alignment and structure
>pdb|4EPX|A Chain A, Discovery Of Small Molecules That Bind To K-Ras And Inhibit Sos- Mediated Activation Length = 170 Back     alignment and structure
>pdb|4EPT|A Chain A, Discovery Of Small Molecules That Bind To K-Ras And Inhibit Sos- Mediated Activation Length = 170 Back     alignment and structure
>pdb|2FN4|A Chain A, The Crystal Structure Of Human Ras-Related Protein, Rras, In The Gdp- Bound State Length = 181 Back     alignment and structure
>pdb|4EPR|A Chain A, Discovery Of Small Molecules That Bind To K-Ras And Inhibit Sos- Mediated Activation Length = 170 Back     alignment and structure
>pdb|3BBP|A Chain A, Rab6-Gtp:gcc185 Rab Binding Domain Complex Length = 211 Back     alignment and structure
>pdb|2CL0|X Chain X, Crystal Structure Analysis Of A Fluorescent Form Of H-Ras P21 In Complex With Gppnhp Length = 166 Back     alignment and structure
>pdb|1YZQ|A Chain A, Gppnhp-Bound Rab6 Gtpase Length = 170 Back     alignment and structure
>pdb|3RAB|A Chain A, Gppnhp-bound Rab3a At 2.0 A Resolution Length = 169 Back     alignment and structure
>pdb|4DKX|A Chain A, Crystal Structure Of The Rab 6a'(Q72l) Length = 216 Back     alignment and structure
>pdb|3CWZ|A Chain A, Strucure Of Rab6(Gtp)-R6ip1 Complex Length = 188 Back     alignment and structure
>pdb|3GFT|A Chain A, Human K-Ras In Complex With A Gtp Analogue Length = 187 Back     alignment and structure
>pdb|2GIL|A Chain A, Structure Of The Extremely Slow Gtpase Rab6a In The Gtp Bound Form At 1.8 Resolution Length = 162 Back     alignment and structure
>pdb|1XCM|A Chain A, Crystal Structure Of The Gppnhp-Bound H-Ras G60a Mutant Length = 167 Back     alignment and structure
>pdb|4EFM|A Chain A, Crystal Structure Of H-Ras G12v In Complex With Gppnhp (State 1) Length = 171 Back     alignment and structure
>pdb|4EFL|A Chain A, Crystal Structure Of H-Ras Wt In Complex With Gppnhp (State 1) Length = 171 Back     alignment and structure
>pdb|1OIV|A Chain A, X-Ray Structure Of The Small G Protein Rab11a In Complex With Gdp Length = 191 Back     alignment and structure
>pdb|3KKM|A Chain A, Crystal Structure Of H-Ras T35s In Complex With Gppnhp Length = 172 Back     alignment and structure
>pdb|1XJ0|A Chain A, Crystal Structure Of The Gdp-Bound Form Of The Rasg60a Mutant Length = 166 Back     alignment and structure
>pdb|2C5L|A Chain A, Structure Of Plc Epsilon Ras Association Domain With Hras Length = 173 Back     alignment and structure
>pdb|1OIW|A Chain A, X-ray Structure Of The Small G Protein Rab11a In Complex With Gtpgammas Length = 191 Back     alignment and structure
>pdb|4EFN|A Chain A, Crystal Structure Of H-Ras Q61l In Complex With Gppnhp (State 1) Length = 171 Back     alignment and structure
>pdb|6Q21|A Chain A, Molecular Switch For Signal Transduction: Structural Differences Between Active And Inactive Forms Of Protooncogenic Ras Proteins Length = 171 Back     alignment and structure
>pdb|2Q21|A Chain A, Crystal Structures At 2.2 Angstroms Resolution Of The Catalytic Domains Of Normal Ras Protein And An Oncogenic Mutant Complexed With Gsp Length = 171 Back     alignment and structure
>pdb|3DDC|A Chain A, Crystal Structure Of Nore1a In Complex With Ras Length = 166 Back     alignment and structure
>pdb|1LFD|B Chain B, Crystal Structure Of The Active Ras Protein Complexed With The Ras-interacting Domain Of Ralgds Length = 167 Back     alignment and structure
>pdb|1IAQ|A Chain A, C-H-Ras P21 Protein Mutant With Thr 35 Replaced By Ser (T35s) Complexed With Guanosine-5'-[b,G-Imido] Triphosphate Length = 166 Back     alignment and structure
>pdb|1YZK|A Chain A, Gppnhp Bound Rab11 Gtpase Length = 184 Back     alignment and structure
>pdb|4DSO|A Chain A, Small-Molecule Ligands Bind To A Distinct Pocket In Ras And Inhibit Sos-Mediated Nucleotide Exchange Activity Length = 189 Back     alignment and structure
>pdb|1ZBD|A Chain A, Structural Basis Of Rab Effector Specificity: Crystal Structure Of The Small G Protein Rab3a Complexed With The Effector Domain Of Rabphilin-3a Length = 203 Back     alignment and structure
>pdb|3CPJ|B Chain B, Crystal Structure Of Ypt31 In Complex With Yeast Rab-Gdi Length = 223 Back     alignment and structure
>pdb|221P|A Chain A, Three-Dimensional Structures Of H-Ras P21 Mutants: Molecular Basis For Their Inability To Function As Signal Switch Molecules Length = 166 Back     alignment and structure
>pdb|1LF0|A Chain A, Crystal Structure Of Rasa59g In The Gtp-Bound Form Length = 166 Back     alignment and structure
>pdb|2F7S|A Chain A, The Crystal Structure Of Human Rab27b Bound To Gdp Length = 217 Back     alignment and structure
>pdb|1ZVQ|A Chain A, Structure Of The Q61g Mutant Of Ras In The Gdp-Bound Form Length = 166 Back     alignment and structure
>pdb|1NVV|Q Chain Q, Structural Evidence For Feedback Activation By Rasgtp Of The Ras-specific Nucleotide Exchange Factor Sos Length = 166 Back     alignment and structure
>pdb|1WQ1|R Chain R, Ras-Rasgap Complex Length = 166 Back     alignment and structure
>pdb|1RVD|A Chain A, H-Ras Complexed With Diaminobenzophenone-Beta,Gamma-Imido- Gtp Length = 166 Back     alignment and structure
>pdb|3V4F|A Chain A, H-Ras Peg 400CACL2, ORDERED OFF Length = 166 Back     alignment and structure
>pdb|3K9N|A Chain A, Allosteric Modulation Of H-Ras Gtpase Length = 166 Back     alignment and structure
>pdb|2RGB|A Chain A, Crystal Structure Of H-Rasq61k-Gppnhp Length = 166 Back     alignment and structure
>pdb|521P|A Chain A, Three-Dimensional Structures Of H-Ras P21 Mutants: Molecular Basis For Their Inability To Function As Signal Switch Molecules Length = 166 Back     alignment and structure
>pdb|3LO5|A Chain A, Crystal Structure Of The Dominant Negative S17n Mutant Of Ras Length = 166 Back     alignment and structure
>pdb|1CLU|A Chain A, H-Ras Complexed With Diaminobenzophenone-Beta,Gamma-Imido- Gtp Length = 166 Back     alignment and structure
>pdb|3I3S|R Chain R, Crystal Structure Of H-Ras With Thr50 Replaced By Isoleucine Length = 166 Back     alignment and structure
>pdb|1ZW6|A Chain A, Crystal Structure Of The Gtp-Bound Form Of Rasq61g Length = 166 Back     alignment and structure
>pdb|621P|A Chain A, Three-Dimensional Structures Of H-Ras P21 Mutants: Molecular Basis For Their Inability To Function As Signal Switch Molecules Length = 166 Back     alignment and structure
>pdb|421P|A Chain A, Three-Dimensional Structures Of H-Ras P21 Mutants: Molecular Basis For Their Inability To Function As Signal Switch Molecules Length = 166 Back     alignment and structure
>pdb|721P|A Chain A, Three-Dimensional Structures Of H-Ras P21 Mutants: Molecular Basis For Their Inability To Function As Signal Switch Molecules Length = 166 Back     alignment and structure
>pdb|2RGA|A Chain A, Crystal Structure Of H-Rasq61i-Gppnhp Length = 166 Back     alignment and structure
>pdb|2RGC|A Chain A, Crystal Structure Of H-Rasq61v-Gppnhp Length = 166 Back     alignment and structure
>pdb|2HV8|A Chain A, Crystal Structure Of Gtp-Bound Rab11 In Complex With Fip3 Length = 172 Back     alignment and structure
>pdb|2D7C|A Chain A, Crystal Structure Of Human Rab11 In Complex With Fip3 Rab- Binding Domain Length = 167 Back     alignment and structure
>pdb|2GZD|A Chain A, Crystal Structure Of Rab11 In Complex With Rab11-Fip2 Length = 173 Back     alignment and structure
>pdb|1AGP|A Chain A, Three-Dimensional Structures And Properties Of A Transforming And A Nontransforming Gly-12 Mutant Of P21-H-Ras Length = 166 Back     alignment and structure
>pdb|2IEZ|A Chain A, Crystal Structure Of Mouse Rab27b Bound To Gdp In Monoclinic Space Group Length = 220 Back     alignment and structure
>pdb|3BC1|A Chain A, Crystal Structure Of The Complex Rab27a-slp2a Length = 195 Back     alignment and structure
>pdb|1JAH|A Chain A, H-Ras P21 Protein Mutant G12p, Complexed With Guanosine-5'- [beta,Gamma-Methylene] Triphosphate And Magnesium Length = 166 Back     alignment and structure
>pdb|1YVD|A Chain A, Gppnhp-Bound Rab22 Gtpase Length = 169 Back     alignment and structure
>pdb|1Z0J|A Chain A, Structure Of Gtp-Bound Rab22q64l Gtpase In Complex With The Minimal Rab Binding Domain Of Rabenosyn-5 Length = 170 Back     alignment and structure
>pdb|3RWM|B Chain B, Crystal Structure Of Ypt32 In Complex With Gppnhp Length = 185 Back     alignment and structure
>pdb|2QUZ|A Chain A, Crystal Structure Of The Activating H-Rask117r Mutant In Costello Syndrome, Bound To Mg-Gdp Length = 166 Back     alignment and structure
>pdb|3DZ8|A Chain A, Crystal Structure Of Human Rab3b Gtpase Bound With Gdp Length = 191 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query167
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 1e-29
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 6e-29
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 2e-27
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 3e-27
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 6e-27
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 1e-26
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 2e-25
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 2e-24
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 4e-24
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 7e-24
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 1e-23
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 1e-23
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 4e-23
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 4e-23
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 5e-23
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 9e-23
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 1e-22
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 8e-21
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 4e-20
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 5e-20
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 6e-20
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 4e-19
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 3e-17
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 4e-17
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 8e-17
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 2e-16
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 2e-16
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 3e-16
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 3e-16
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 3e-16
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 4e-16
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 4e-16
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 4e-16
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 6e-16
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 8e-16
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 9e-16
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 9e-16
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 1e-15
3bbp_A211 RAB-6, RAS-related protein RAB-6A; golgi complex, 1e-15
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 1e-15
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 2e-15
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 2e-15
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 2e-15
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 2e-15
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 2e-15
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 3e-15
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 3e-15
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 4e-15
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 4e-15
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 5e-15
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 5e-15
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 7e-15
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 7e-15
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 8e-15
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 9e-15
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 1e-14
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 3e-14
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 3e-14
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 6e-14
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 1e-13
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 2e-13
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 6e-13
3c5h_A255 Glucocorticoid receptor DNA-binding factor 1; RAS, 5e-12
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 8e-12
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 2e-11
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 4e-11
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 3e-10
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 6e-10
3dpu_A 535 RAB family protein; roccor, G-domain, COR, GTP-bin 1e-09
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 4e-09
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 2e-08
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 3e-07
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 5e-07
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 1e-05
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 2e-05
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 3e-05
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 5e-05
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 1e-04
3th5_A204 RAS-related C3 botulinum toxin substrate 1; rossma 1e-04
1xzp_A482 Probable tRNA modification GTPase TRME; GTP-bindin 2e-04
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 3e-04
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 6e-04
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Length = 211 Back     alignment and structure
 Score =  106 bits (267), Expect = 1e-29
 Identities = 43/107 (40%), Positives = 62/107 (57%), Gaps = 10/107 (9%)

Query: 8   YETPHGFIIVYSTIDLASFHVAEQCLQALWKKDSIRSKA-----VILVANKTDLVRCRVV 62
            +    ++IVYS  D ASF  A +      +    R++      +ILV NK+DLVRCR V
Sbjct: 109 MQVGDAYLIVYSITDRASFEKASE-----LRIQLRRARQTEDIPIILVGNKSDLVRCREV 163

Query: 63  TDEDGKDMATAYDCKFIETSVGINHNVDELLVGILTQIRLKLDNPPE 109
           +  +G+  A  +DCKFIETS  + HNV EL  GI+ Q+RL+ D+  +
Sbjct: 164 SVSEGRACAVVFDCKFIETSAAVQHNVKELFEGIVRQVRLRRDSKEK 210


>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Length = 175 Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} Length = 169 Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Length = 166 Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Length = 195 Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Length = 192 Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Length = 206 Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Length = 187 Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Length = 172 Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Length = 168 Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Length = 187 Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Length = 199 Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Length = 181 Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Length = 196 Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Length = 167 Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* Length = 181 Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Length = 201 Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Length = 183 Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Length = 189 Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Length = 167 Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Length = 166 Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Length = 190 Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} Length = 184 Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Length = 183 Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Length = 180 Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Length = 195 Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Length = 168 Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Length = 223 Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Length = 217 Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} Length = 191 Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Length = 189 Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Length = 170 Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Length = 179 Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Length = 196 Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Length = 186 Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Length = 199 Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Length = 181 Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Length = 203 Back     alignment and structure
>3bbp_A RAB-6, RAS-related protein RAB-6A; golgi complex, GRIP domain, RAB GTPase, ARL GTPase, golgin, RAB effector, clAsp protein; HET: GTP; 3.00A {Homo sapiens} Length = 211 Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Length = 191 Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Length = 170 Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Length = 201 Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Length = 200 Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Length = 206 Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Length = 192 Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Length = 170 Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Length = 199 Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Length = 193 Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Length = 170 Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Length = 181 Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Length = 191 Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Length = 201 Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Length = 208 Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Length = 178 Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Length = 213 Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Length = 179 Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Length = 199 Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Length = 189 Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Length = 195 Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Length = 192 Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Length = 178 Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Length = 208 Back     alignment and structure
>3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} Length = 255 Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Length = 218 Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Length = 207 Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Length = 182 Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Length = 170 Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Length = 177 Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Length = 535 Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 1qg4_A* 3ea5_A* 1qg2_A* 1byu_A* 3ran_A* 3gjx_C* ... Length = 221 Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* Length = 194 Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Length = 184 Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Length = 212 Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Length = 182 Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Length = 207 Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Length = 201 Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Length = 194 Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Length = 201 Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Length = 204 Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Length = 482 Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Length = 214 Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Length = 184 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query167
4dkx_A216 RAS-related protein RAB-6A; GTP binding fold, memb 99.92
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 99.88
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 99.86
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 99.85
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 99.85
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 99.85
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 99.84
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 99.84
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 99.84
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 99.84
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 99.84
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 99.84
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 99.84
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 99.83
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 99.83
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 99.83
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 99.83
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 99.83
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 99.83
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 99.82
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 99.82
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 99.82
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 99.82
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 99.82
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 99.82
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 99.82
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 99.81
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 99.81
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 99.81
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 99.81
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 99.81
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 99.81
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 99.81
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 99.81
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 99.81
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 99.81
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 99.81
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 99.81
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 99.81
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 99.81
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 99.8
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 99.8
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 99.8
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 99.8
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 99.8
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 99.8
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 99.8
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 99.8
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 99.8
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 99.8
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 99.8
3t1o_A198 Gliding protein MGLA; G domain containing protein, 99.8
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 99.8
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 99.79
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 99.79
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 99.79
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 99.79
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 99.79
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 99.79
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 99.79
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 99.78
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 99.78
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 99.78
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 99.78
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 99.78
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 99.78
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 99.77
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 99.77
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 99.77
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 99.77
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 99.77
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 99.77
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 99.77
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 99.77
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 99.77
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 99.77
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 99.77
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 99.76
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 99.76
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 99.76
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 99.76
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 99.75
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 99.75
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 99.75
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 99.75
3c5h_A255 Glucocorticoid receptor DNA-binding factor 1; RAS, 99.75
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 99.74
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 99.74
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 99.73
3llu_A196 RAS-related GTP-binding protein C; structural geno 99.73
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 99.73
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 99.73
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 99.73
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 99.73
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 99.72
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 99.72
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 99.71
2wkq_A332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 99.71
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 99.68
1cip_A353 Protein (guanine nucleotide-binding protein alpha- 99.68
3th5_A204 RAS-related C3 botulinum toxin substrate 1; rossma 99.5
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.67
3o47_A329 ADP-ribosylation factor GTPase-activating protein 99.66
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 99.66
3r7w_B331 Gtpase2, GTP-binding protein GTR2; RAG gtpases, GT 99.66
2xtz_A354 Guanine nucleotide-binding protein alpha-1 subuni; 99.64
1azs_C402 GS-alpha; complex (lyase/hydrolase), hydrolase, si 99.63
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 99.62
2wji_A165 Ferrous iron transport protein B homolog; membrane 99.62
1zcb_A362 G alpha I/13; GTP-binding, lipoprotein, membrane, 99.62
2fh5_B214 SR-beta, signal recognition particle receptor beta 99.61
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 99.61
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 99.6
3r7w_A307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 99.6
3ohm_A327 Guanine nucleotide-binding protein G(Q) subunit A; 99.59
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 99.56
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 99.54
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 99.52
3iev_A308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 99.5
4fid_A340 G protein alpha subunit; RAS-like domain, all-heli 99.5
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 99.5
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 99.49
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 99.49
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 99.46
3a1s_A258 Iron(II) transport protein B; FEOB, iron transport 99.44
3dpu_A 535 RAB family protein; roccor, G-domain, COR, GTP-bin 99.43
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 99.42
3b1v_A272 Ferrous iron uptake transporter protein B; G prote 99.4
1lnz_A342 SPO0B-associated GTP-binding protein; GTPase, OBG, 99.39
4dcu_A456 GTP-binding protein ENGA; GTPase, GDP, protein bin 99.38
3iby_A256 Ferrous iron transport protein B; G protein, G dom 99.38
2hjg_A436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 99.36
3gee_A476 MNME, tRNA modification GTPase MNME; G protein, cy 99.36
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 99.33
3i8s_A274 Ferrous iron transport protein B; GTPase, GPCR, ir 99.32
3qq5_A 423 Small GTP-binding protein; hydrogenase, H-cluster, 99.32
1nrj_B218 SR-beta, signal recognition particle receptor beta 99.31
1xzp_A482 Probable tRNA modification GTPase TRME; GTP-bindin 99.3
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 99.26
3l82_B227 F-box only protein 4; TRFH domain, helix, GTPase d 99.25
3geh_A462 MNME, tRNA modification GTPase MNME; G protein, U3 99.22
1mky_A 439 Probable GTP-binding protein ENGA; GTPase, DER, KH 99.22
1wf3_A301 GTP-binding protein; GTPase, riken structural geno 99.21
3h2y_A 368 GTPase family protein; GTP-binding protein YQEH, p 99.18
3sjy_A 403 Translation initiation factor 2 subunit gamma; zin 99.17
3cb4_D 599 GTP-binding protein LEPA; GTPase, OB-fold, membran 99.14
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 99.13
2ywe_A 600 GTP-binding protein LEPA; G domain, beta-barrel, f 99.11
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 99.11
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 99.1
1wb1_A 482 Translation elongation factor SELB; selenocysteine 99.1
2hjg_A 436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 99.09
3l2o_B312 F-box only protein 4; small G protein fold, UBL co 99.08
1s0u_A 408 EIF-2-gamma, translation initiation factor 2 gamma 99.04
3ec1_A 369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 98.99
1jny_A 435 EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- 98.95
1g7s_A 594 Translation initiation factor IF2/EIF5B; translati 98.95
2elf_A 370 Protein translation elongation factor 1A; tRNA, py 98.94
1d2e_A 397 Elongation factor TU (EF-TU); G-protein, beta-barr 98.93
1kk1_A 410 EIF2gamma; initiation of translation; HET: GNP; 1. 98.93
3p26_A 483 Elongation factor 1 alpha-like protein; GTP/GDP bi 98.93
2aka_B299 Dynamin-1; fusion protein, GTPase domain, myosin, 98.93
3tr5_A 528 RF-3, peptide chain release factor 3; protein synt 98.92
3izy_P 537 Translation initiation factor IF-2, mitochondrial; 98.91
2qag_A361 Septin-2, protein NEDD5; cell cycle, cell division 98.91
2c78_A 405 Elongation factor TU-A; hydrolase, GTPase, transla 98.91
1puj_A 282 YLQF, conserved hypothetical protein YLQF; structu 98.87
2xtp_A260 GTPase IMAP family member 2; immune system, G prot 98.87
1zun_B 434 Sulfate adenylate transferase, subunit 1/adenylyls 98.86
1udx_A416 The GTP-binding protein OBG; TGS domain, riken str 98.85
3j2k_7 439 ERF3, eukaryotic polypeptide chain release factor 98.83
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 98.81
1r5b_A 467 Eukaryotic peptide chain release factor GTP-bindi 98.8
4dcu_A 456 GTP-binding protein ENGA; GTPase, GDP, protein bin 98.8
1zo1_I 501 IF2, translation initiation factor 2; E. coli, rib 98.79
3avx_A 1289 Elongation factor TS, elongation factor TU, linke 98.78
2j69_A 695 Bacterial dynamin-like protein; FZO, FZL, GTPase, 98.77
3izq_1 611 HBS1P, elongation factor 1 alpha-like protein; NO- 98.73
2ged_A193 SR-beta, signal recognition particle receptor beta 98.73
3lxx_A239 GTPase IMAP family member 4; structural genomics c 98.72
1f60_A 458 Elongation factor EEF1A; protein-protein complex, 98.71
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 98.68
2dy1_A 665 Elongation factor G; translocation, GTP complex, s 98.67
2qag_C 418 Septin-7; cell cycle, cell division, GTP-binding, 98.67
2hf9_A226 Probable hydrogenase nickel incorporation protein 98.64
3t34_A360 Dynamin-related protein 1A, linker, dynamin-relat 98.61
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 98.57
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 98.51
3lxw_A247 GTPase IMAP family member 1; immunity, structural 98.51
1jwy_B315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 98.49
3t5d_A274 Septin-7; GTP-binding protein, cytoskeleton, signa 98.49
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 98.47
3cnl_A262 YLQF, putative uncharacterized protein; circular p 98.46
3mca_A 592 HBS1, elongation factor 1 alpha-like protein; prot 98.42
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 98.41
1dar_A 691 EF-G, elongation factor G; ribosomal translocase, 98.38
2h5e_A 529 Peptide chain release factor RF-3; beta barrel, tr 98.34
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 98.31
1wxq_A397 GTP-binding protein; structural genomics, riken st 98.23
2x2e_A353 Dynamin-1; nitration, hydrolase, membrane fission, 98.2
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 98.2
2rdo_7 704 EF-G, elongation factor G; elongation factor G, EF 98.2
2xex_A 693 Elongation factor G; GTPase, translation, biosynth 98.2
2www_A349 Methylmalonic aciduria type A protein, mitochondri 98.15
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 97.92
3zvr_A 772 Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito 97.86
2dby_A368 GTP-binding protein; GDP, structural genomics, NPP 97.74
1jal_A363 YCHF protein; nucleotide-binding fold, structural 97.66
2qpt_A 550 EH domain-containing protein-2; protein-nucleotide 97.63
1h65_A270 Chloroplast outer envelope protein OEP34; GTPase, 97.57
3vqt_A 548 RF-3, peptide chain release factor 3; translation, 97.44
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 97.41
1n0u_A 842 EF-2, elongation factor 2; G-protein, CIS-proline, 97.3
3j25_A 638 Tetracycline resistance protein TETM; antibiotic r 96.82
4fn5_A 709 EF-G 1, elongation factor G 1; translation, transl 96.33
4a9a_A376 Ribosome-interacting GTPase 1; DRG-DFRP complex, r 93.07
2j37_W 504 Signal recognition particle 54 kDa protein (SRP54) 91.89
3end_A307 Light-independent protochlorophyllide reductase ir 90.74
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 84.57
3cwq_A209 Para family chromosome partitioning protein; alpha 83.33
4dzz_A206 Plasmid partitioning protein PARF; deviant walker 83.18
>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* Back     alignment and structure
Probab=99.92  E-value=3.8e-25  Score=166.89  Aligned_cols=101  Identities=24%  Similarity=0.313  Sum_probs=91.9

Q ss_pred             hhhhcccCCCcEEEEEEeCCCHHHHHHHHHHHHHHHhhCCCCCceEEEEEecCCCCCccccChhHHHHHHHhcCCeEEEE
Q psy15004          2 EECIANYETPHGFIIVYSTIDLASFHVAEQCLQALWKKDSIRSKAVILVANKTDLVRCRVVTDEDGKDMATAYDCKFIET   81 (167)
Q Consensus         2 ~~~~~y~~~ad~~i~v~d~t~~~s~~~~~~~~~~l~~~~~~~~~piilvgNK~Dl~~~~~v~~~~~~~~~~~~~~~~~e~   81 (167)
                      .+++.||+++|++|+|||+++++||+++..|+..+.... .+++|+||||||+||.+.++|+.+++..+++.+++.|+||
T Consensus        77 ~l~~~~~~~a~~~ilv~di~~~~Sf~~i~~~~~~i~~~~-~~~~piilVgNK~Dl~~~r~V~~~e~~~~a~~~~~~~~e~  155 (216)
T 4dkx_A           77 SLIPSYIRDSAAAVVVYDITNVNSFQQTTKWIDDVRTER-GSDVIIMLVGNKTDLADKRQVSIEEGERKAKELNVMFIET  155 (216)
T ss_dssp             GGHHHHHTTCSEEEEEEETTCHHHHHTHHHHHHHHHHHH-TTSSEEEEEEECTTCGGGCCSCHHHHHHHHHHHTCEEEEE
T ss_pred             hHHHHHhccccEEEEEeecchhHHHHHHHHHHHHHHHhc-CCCCeEEEEeeccchHhcCcccHHHHhhHHHHhCCeeEEE
Confidence            467899999999999999999999999999999987653 4689999999999999889999999999999999999999


Q ss_pred             ecCCCCCHHHHHHHHHHHHHhh
Q psy15004         82 SVGINHNVDELLVGILTQIRLK  103 (167)
Q Consensus        82 SA~~~~~v~~lf~~l~~~i~~~  103 (167)
                      ||++|.||+++|+.|++.+...
T Consensus       156 SAktg~nV~e~F~~i~~~i~~~  177 (216)
T 4dkx_A          156 SAKAGYNVKQLFRRVAAALPGM  177 (216)
T ss_dssp             BTTTTBSHHHHHHHHHHHC---
T ss_pred             eCCCCcCHHHHHHHHHHHHHhh
Confidence            9999999999999999988653



>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>1cip_A Protein (guanine nucleotide-binding protein alpha-1 subunit); GTPase, hydrolase; HET: GNP; 1.50A {Rattus norvegicus} SCOP: a.66.1.1 c.37.1.8 PDB: 1agr_A* 1bof_A* 1gdd_A* 1gfi_A* 1gia_A* 1gp2_A* 3ffa_A* 3ffb_A* 1gg2_A* 1git_A* 1svs_A* 1svk_A* 2zjz_A* 2zjy_A* 3ums_A* 2pz2_A* 2pz3_A* 1as0_A* 1as2_A* 1as3_A* ... Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>3r7w_B Gtpase2, GTP-binding protein GTR2; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_B* Back     alignment and structure
>2xtz_A Guanine nucleotide-binding protein alpha-1 subuni; hydrolase, G-protein signaling, SELF-activation, RAS-like DO; HET: GSP; 2.34A {Arabidopsis thaliana} Back     alignment and structure
>1azs_C GS-alpha; complex (lyase/hydrolase), hydrolase, signal transducing protein, cyclase, effector enzyme; HET: GSP FKP; 2.30A {Bos taurus} SCOP: a.66.1.1 c.37.1.8 PDB: 1azt_A* 3c14_C* 3c15_C* 3c16_C* 1cjt_C* 1cjk_C* 1cju_C* 1cjv_C* 1tl7_C* 1cs4_C* 1u0h_C* 2gvd_C* 2gvz_C* 3e8a_C* 3g82_C* 3maa_C* 1cul_C* 3sn6_A* Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* Back     alignment and structure
>3ohm_A Guanine nucleotide-binding protein G(Q) subunit A; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Mus musculus} PDB: 2bcj_Q* 2rgn_A* 3ah8_A* Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>4fid_A G protein alpha subunit; RAS-like domain, all-helical domain, GTP binding, nucleotide signaling protein, transducer, lipoprotein; HET: MLY MSE GDP; 2.62A {Entamoeba histolytica} Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>3l82_B F-box only protein 4; TRFH domain, helix, GTPase domain, acetylation, ADP- ribosylation, alternative splicing, cell cycle, cell division; 2.40A {Homo sapiens} Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Back     alignment and structure
>3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* Back     alignment and structure
>3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Back     alignment and structure
>1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Back     alignment and structure
>1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* Back     alignment and structure
>1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* Back     alignment and structure
>2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} Back     alignment and structure
>1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* Back     alignment and structure
>1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* Back     alignment and structure
>3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Back     alignment and structure
>3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} Back     alignment and structure
>3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus} Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} Back     alignment and structure
>3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B Back     alignment and structure
>2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* Back     alignment and structure
>3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Back     alignment and structure
>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Back     alignment and structure
>3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... Back     alignment and structure
>2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H Back     alignment and structure
>2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A Back     alignment and structure
>2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A Back     alignment and structure
>1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>3vqt_A RF-3, peptide chain release factor 3; translation, GTPase; HET: GDP; 1.80A {Desulfovibrio vulgaris} PDB: 3vr1_A* Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* Back     alignment and structure
>3j25_A Tetracycline resistance protein TETM; antibiotic resistance, translation; HET: GCP; 7.20A {Enterococcus faecalis} Back     alignment and structure
>4fn5_A EF-G 1, elongation factor G 1; translation, translation-antibiotic compl; HET: 0UO; 2.90A {Pseudomonas aeruginosa} Back     alignment and structure
>4a9a_A Ribosome-interacting GTPase 1; DRG-DFRP complex, ribosome binding GTPase; 2.67A {Saccharomyces cerevisiae} Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>3cwq_A Para family chromosome partitioning protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: ADP; 2.47A {Synechocystis SP} Back     alignment and structure
>4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 167
d1kaoa_167 c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 1e-12
d2fu5c1173 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [Ta 2e-12
d2f9la1175 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [T 5e-12
d1z0fa1166 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [Ta 3e-11
d2a5ja1173 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [Ta 6e-11
d2f7sa1186 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [T 1e-10
d1u8za_168 c.37.1.8 (A:) Ras-related protein RalA {Cotton-top 3e-10
d1z08a1167 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [T 2e-09
d2g6ba1170 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [T 3e-09
d1x3sa1177 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [Ta 5e-09
d2gjsa1168 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [Tax 6e-09
d1yzqa1164 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [Ta 1e-08
d1ctqa_166 c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapi 2e-08
d1g16a_166 c.37.1.8 (A:) Rab-related protein Sec4 {Baker's ye 2e-08
d2erya1171 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [ 2e-08
d2g3ya1172 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human 2e-08
d2erxa1171 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [ 2e-08
d2bmea1174 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [Ta 3e-08
d1z06a1165 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) 7e-08
d1x1ra1169 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRa 1e-07
d2atva1168 c.37.1.8 (A:5-172) Ras-like estrogen-regulated gro 1e-07
d1ek0a_170 c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces 1e-07
d1c1ya_167 c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 1e-07
d2fn4a1173 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [T 2e-07
d1e0sa_173 c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo 3e-07
d1fzqa_176 c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus 4e-07
d1zj6a1177 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human 1e-06
d3raba_169 c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxI 2e-06
d2ew1a1171 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [Ta 2e-06
d1z0ja1167 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [ 2e-06
d1r2qa_170 c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 3e-06
d1xtqa1167 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human 5e-06
d1moza_182 c.37.1.8 (A:) ADP-ribosylation factor {Baker's yea 6e-06
d1zd9a1164 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human 2e-05
d1wmsa_174 c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 2e-05
d1vg8a_184 c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId 2e-05
d2bcgy1194 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Sac 2e-05
d1upta_169 c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo 4e-05
d1r8sa_160 c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo 4e-05
d1mh1a_183 c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 96 5e-05
d1z2aa1164 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [Ta 2e-04
d1i2ma_170 c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 96 2e-04
d1ksha_165 c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus 4e-04
d2atxa1185 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [Tax 4e-04
d2bmja1175 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {H 0.001
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Length = 167 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rap2a
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 60.3 bits (145), Expect = 1e-12
 Identities = 31/93 (33%), Positives = 46/93 (49%)

Query: 8   YETPHGFIIVYSTIDLASFHVAEQCLQALWKKDSIRSKAVILVANKTDLVRCRVVTDEDG 67
            +   GFI+VYS ++  SF   +     + +        VILV NK DL   R V+  +G
Sbjct: 72  IKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYEKVPVILVGNKVDLESEREVSSSEG 131

Query: 68  KDMATAYDCKFIETSVGINHNVDELLVGILTQI 100
           + +A  + C F+ETS      VDEL   I+ Q+
Sbjct: 132 RALAEEWGCPFMETSAKSKTMVDELFAEIVRQM 164


>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Length = 173 Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Length = 175 Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Length = 166 Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Length = 186 Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Length = 168 Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Length = 167 Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Length = 177 Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Length = 166 Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 166 Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Length = 171 Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Length = 172 Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Length = 171 Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Length = 165 Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Length = 169 Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 170 Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Length = 167 Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Length = 176 Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Length = 177 Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 169 Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Length = 171 Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Length = 167 Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Length = 167 Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Length = 182 Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 184 Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 194 Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Length = 169 Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Length = 160 Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Length = 164 Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Length = 165 Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Length = 185 Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Length = 175 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query167
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 99.92
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 99.92
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 99.91
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 99.91
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 99.9
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 99.9
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 99.9
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 99.89
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 99.89
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 99.89
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 99.89
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 99.89
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 99.89
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 99.89
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 99.89
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 99.89
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 99.89
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 99.88
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 99.87
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 99.87
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 99.87
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 99.87
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 99.87
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 99.87
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 99.87
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 99.86
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 99.85
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 99.85
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 99.85
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 99.85
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 99.84
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 99.83
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 99.83
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 99.83
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 99.83
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 99.83
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 99.82
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 99.82
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 99.8
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 99.8
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 99.79
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 99.77
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 99.76
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 99.76
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.74
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 99.73
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 99.68
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.58
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.53
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.44
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 99.41
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 99.4
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 99.37
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 99.37
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 99.31
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 99.3
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 99.26
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 99.18
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 99.13
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 99.11
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 99.09
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 99.06
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 99.06
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 98.9
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 98.8
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 98.79
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 98.75
d2fh5b1207 Signal recognition particle receptor beta-subunit 98.73
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 98.68
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 98.63
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 98.56
d1puja_ 273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 98.32
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 98.29
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 98.17
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 98.0
d1zunb3222 Sulfate adenylate transferase subunit cysN/C, EF-T 97.69
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 97.68
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 97.61
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 97.49
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 97.43
d1nrjb_209 Signal recognition particle receptor beta-subunit 97.22
d1r5ba3245 Eukaryotic peptide chain release factor ERF2, G do 97.22
d1jnya3224 Elongation factor eEF-1alpha, N-terminal (G) domai 97.07
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 96.96
d1f60a3239 Elongation factor eEF-1alpha, N-terminal (G) domai 96.78
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 96.31
d1n0ua2341 Elongation factor 2 (eEF-2), N-terminal (G) domain 94.68
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 93.7
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 91.3
d1jwyb_306 Dynamin G domain {Dictyostelium discoideum [TaxId: 86.93
d1zpda1175 Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 85.48
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rad
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.92  E-value=3.2e-25  Score=158.87  Aligned_cols=103  Identities=38%  Similarity=0.563  Sum_probs=93.0

Q ss_pred             hhhhcccCCCcEEEEEEeCCCHHHHHHHHHHHHHHHhhCCCCCceEEEEEecCCCCCccccChhHHHHHHHhcCCeEEEE
Q psy15004          2 EECIANYETPHGFIIVYSTIDLASFHVAEQCLQALWKKDSIRSKAVILVANKTDLVRCRVVTDEDGKDMATAYDCKFIET   81 (167)
Q Consensus         2 ~~~~~y~~~ad~~i~v~d~t~~~s~~~~~~~~~~l~~~~~~~~~piilvgNK~Dl~~~~~v~~~~~~~~~~~~~~~~~e~   81 (167)
                      .++..||+++|++|+|||++++.||+.+..|+.++.......++|+++||||+|+.+.++++..++..+++.++++|+||
T Consensus        63 ~~~~~~~~~~d~~ilv~d~t~~~s~~~~~~~~~~i~~~~~~~~~piilvgnK~Dl~~~~~v~~~~~~~~~~~~~~~~~e~  142 (168)
T d2gjsa1          63 WLPGHCMAMGDAYVIVYSVTDKGSFEKASELRVQLRRARQTDDVPIILVGNKSDLVRSREVSVDEGRACAVVFDCKFIET  142 (168)
T ss_dssp             -CHHHHHTSCSEEEEEEETTCHHHHHHHHHHHHHHHHHCC--CCCEEEEEECTTCGGGCCSCHHHHHHHHHHHTSEEEEC
T ss_pred             eecccchhhhhhhceeccccccccccccccccchhhcccccccceEEEeecccchhhhcchhHHHHHHHHHhcCCEEEEE
Confidence            35678999999999999999999999999999999776556789999999999999888899999999999999999999


Q ss_pred             ecCCCCCHHHHHHHHHHHHHhhh
Q psy15004         82 SVGINHNVDELLVGILTQIRLKL  104 (167)
Q Consensus        82 SA~~~~~v~~lf~~l~~~i~~~~  104 (167)
                      ||++|.||+++|+.|+++|..+.
T Consensus       143 Sak~~~~v~~~f~~l~~~i~~~~  165 (168)
T d2gjsa1         143 SAALHHNVQALFEGVVRQIRLRR  165 (168)
T ss_dssp             BTTTTBSHHHHHHHHHHHHHHHH
T ss_pred             eCCCCcCHHHHHHHHHHHHHHHh
Confidence            99999999999999999887653



>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1zpda1 c.31.1.3 (A:188-362) Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure