Psyllid ID: psy15007


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------
MDTTLEPGLDNHFTIPDYIVLLTMLVVSCAIGFFVGMCGEKQTTSDDFLLGSSSMGTLPMALSLAASQ
cccccccccccccccHHHHHHHHHHHHHHHHHHHEEEcccccccHHHHHcccccccEEccEEEEEEcc
ccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHccccccccEEEEEEEccc
mdttlepgldnhftiPDYIVLLTMLVVSCAIGFFvgmcgekqttsddfllgsssmgtlPMALSLAASQ
mdttlepgldnhFTIPDYIVLLTMLVVSCAIGFFVGMCGEKQTTSDDFLLGSSSMGTLPMALSLAASQ
MDTTLEPGLDNHFTIPDYIVLLTMLVVSCAIGFFVGMCGEKQTTSDDFLLGSSSMGTLPMALSLAASQ
********LDNHFTIPDYIVLLTMLVVSCAIGFFVGMCGEKQT****F********************
************FTIPDYIVLLTMLVVSCAIGFFVGMCGEKQTTSDDFLLGSSSMGTLPMALSLAAS*
MDTTLEPGLDNHFTIPDYIVLLTMLVVSCAIGFFVGMCGEKQTTSDDFLLGSSSMGTLPMALSLAASQ
*********DNHFTIPDYIVLLTMLVVSCAIGFFVGMCGEKQTTSDDFLLGSSSMGTLPMALSLAAS*
ooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHo
ooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDTTLEPGLDNHFTIPDYIVLLTMLVVSCAIGFFVGMCGEKQTTSDDFLLGSSSMGTLPMALSLAASQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query68 2.2.26 [Sep-21-2011]
Q5BL81 620 Sodium-coupled monocarbox yes N/A 0.897 0.098 0.475 8e-09
Q7SYH5 622 Sodium-coupled monocarbox N/A N/A 0.897 0.098 0.475 1e-08
Q8BYF6 611 Sodium-coupled monocarbox yes N/A 0.941 0.104 0.447 3e-08
Q8N695 610 Sodium-coupled monocarbox yes N/A 0.808 0.090 0.490 7e-08
Q3ZMH1 610 Sodium-coupled monocarbox yes N/A 0.808 0.090 0.436 5e-07
Q63008 618 Sodium/iodide cotransport no N/A 0.911 0.100 0.435 1e-06
Q99PN0 618 Sodium/iodide cotransport no N/A 0.911 0.100 0.435 2e-06
A7MBD8 617 Sodium-coupled monocarbox no N/A 0.838 0.092 0.385 2e-05
Q49B93 619 Sodium-coupled monocarbox no N/A 0.838 0.092 0.421 2e-05
P83740 604 Putative sodium-dependent no N/A 0.75 0.084 0.431 3e-05
>sp|Q5BL81|SC5A8_XENTR Sodium-coupled monocarboxylate transporter 1 OS=Xenopus tropicalis GN=slc5a8 PE=2 SV=1 Back     alignment and function desciption
 Score = 58.9 bits (141), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 29/61 (47%), Positives = 37/61 (60%)

Query: 7  PGLDNHFTIPDYIVLLTMLVVSCAIGFFVGMCGEKQTTSDDFLLGSSSMGTLPMALSLAA 66
          PG    FT+ DY+V   ML++S  IG +    G  Q TS DFL+G  SM  +P+ALSL A
Sbjct: 4  PGNIGSFTVWDYVVFALMLLISAVIGIYYAFAGGGQKTSKDFLMGGRSMTAVPVALSLTA 63

Query: 67 S 67
          S
Sbjct: 64 S 64




Acts as an electrogenic sodium (Na(+)) and chloride (Cl-)-dependent sodium-coupled solute transporter, including transport of monocarboxylates (short-chain fatty acids including L-lactate, D-lactate, pyruvate, acetate, propionate, valerate and butyrate), lactate, mocarboxylate drugs (nicotinate, benzoate, salicylate and 5-aminosalicylate) and ketone bodies (beta-D-hydroxybutyrate, acetoacetate and alpha-ketoisocaproate), with a Na(+):substrate stoichiometry of between 4:1 and 2:1. Catalyzes passive carrier mediated diffusion of iodide. Mediates iodide transport from the thyrocyte into the colloid lumen through the apical membrane.
Xenopus tropicalis (taxid: 8364)
>sp|Q7SYH5|SC5A8_XENLA Sodium-coupled monocarboxylate transporter 1 OS=Xenopus laevis GN=slc5a8 PE=2 SV=1 Back     alignment and function description
>sp|Q8BYF6|SC5A8_MOUSE Sodium-coupled monocarboxylate transporter 1 OS=Mus musculus GN=Slc5a8 PE=1 SV=1 Back     alignment and function description
>sp|Q8N695|SC5A8_HUMAN Sodium-coupled monocarboxylate transporter 1 OS=Homo sapiens GN=SLC5A8 PE=1 SV=2 Back     alignment and function description
>sp|Q3ZMH1|SC5A8_DANRE Sodium-coupled monocarboxylate transporter 1 OS=Danio rerio GN=slc5a8 PE=1 SV=1 Back     alignment and function description
>sp|Q63008|SC5A5_RAT Sodium/iodide cotransporter OS=Rattus norvegicus GN=Slc5a5 PE=2 SV=1 Back     alignment and function description
>sp|Q99PN0|SC5A5_MOUSE Sodium/iodide cotransporter OS=Mus musculus GN=Slc5a5 PE=2 SV=1 Back     alignment and function description
>sp|A7MBD8|SC5AC_BOVIN Sodium-coupled monocarboxylate transporter 2 OS=Bos taurus GN=SLC5A12 PE=2 SV=1 Back     alignment and function description
>sp|Q49B93|SC5AC_MOUSE Sodium-coupled monocarboxylate transporter 2 OS=Mus musculus GN=Slc5a12 PE=1 SV=1 Back     alignment and function description
>sp|P83740|SC5A6_DROME Putative sodium-dependent multivitamin transporter OS=Drosophila melanogaster GN=CG32669 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query68
270007206 659 hypothetical protein TcasGA2_TC013748 [T 0.852 0.088 0.689 1e-14
91082285 632 PREDICTED: similar to AGAP005795-PA [Tri 0.852 0.091 0.689 1e-14
383851180 1205 PREDICTED: uncharacterized protein LOC10 0.911 0.051 0.596 1e-12
307177539 1217 Putative sodium-dependent multivitamin t 0.911 0.050 0.612 3e-12
332018423 617 Sodium-coupled monocarboxylate transport 0.911 0.100 0.612 1e-11
328778498 1207 PREDICTED: hypothetical protein LOC41355 0.823 0.046 0.625 3e-11
345493450 638 PREDICTED: LOW QUALITY PROTEIN: sodium-c 0.970 0.103 0.558 4e-11
357621003 630 hypothetical protein KGM_11153 [Danaus p 0.647 0.069 0.75 7e-10
432094402 183 Sodium-coupled monocarboxylate transport 0.808 0.300 0.490 3e-07
82524384 620 sodium-coupled monocarboxylate transport 0.897 0.098 0.475 3e-07
>gi|270007206|gb|EFA03654.1| hypothetical protein TcasGA2_TC013748 [Tribolium castaneum] Back     alignment and taxonomy information
 Score = 83.6 bits (205), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 40/58 (68%), Positives = 46/58 (79%)

Query: 10  DNHFTIPDYIVLLTMLVVSCAIGFFVGMCGEKQTTSDDFLLGSSSMGTLPMALSLAAS 67
            N F+ PDY+VL TML+VSC IG F G  GEK ++SDDFLLG SSMGT PMA+SLAAS
Sbjct: 46  KNTFSWPDYLVLGTMLLVSCGIGVFYGFIGEKHSSSDDFLLGGSSMGTFPMAMSLAAS 103




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|91082285|ref|XP_973784.1| PREDICTED: similar to AGAP005795-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|383851180|ref|XP_003701117.1| PREDICTED: uncharacterized protein LOC100879178 [Megachile rotundata] Back     alignment and taxonomy information
>gi|307177539|gb|EFN66650.1| Putative sodium-dependent multivitamin transporter [Camponotus floridanus] Back     alignment and taxonomy information
>gi|332018423|gb|EGI59017.1| Sodium-coupled monocarboxylate transporter 1 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|328778498|ref|XP_396997.4| PREDICTED: hypothetical protein LOC413556 [Apis mellifera] Back     alignment and taxonomy information
>gi|345493450|ref|XP_003427076.1| PREDICTED: LOW QUALITY PROTEIN: sodium-coupled monocarboxylate transporter 2-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|357621003|gb|EHJ72989.1| hypothetical protein KGM_11153 [Danaus plexippus] Back     alignment and taxonomy information
>gi|432094402|gb|ELK25979.1| Sodium-coupled monocarboxylate transporter 1 [Myotis davidii] Back     alignment and taxonomy information
>gi|82524384|ref|NP_988910.2| sodium-coupled monocarboxylate transporter 1 [Xenopus (Silurana) tropicalis] gi|82194177|sp|Q5BL81.1|SC5A8_XENTR RecName: Full=Sodium-coupled monocarboxylate transporter 1; AltName: Full=Electrogenic sodium monocarboxylate cotransporter; AltName: Full=Solute carrier family 5 member 8 gi|60688376|gb|AAH90570.1| solute carrier family 5 (iodide transporter), member 8 [Xenopus (Silurana) tropicalis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query68
MGI|MGI:2384916 611 Slc5a8 "solute carrier family 0.941 0.104 0.447 4.7e-08
RGD|1564146 611 Slc5a8 "solute carrier family 0.941 0.104 0.447 4.7e-08
UNIPROTKB|F1P5L0 613 SLC5A8 "Uncharacterized protei 0.808 0.089 0.490 9.9e-08
UNIPROTKB|Q8N695 610 SLC5A8 "Sodium-coupled monocar 0.808 0.090 0.490 1.6e-07
UNIPROTKB|E2RI16 612 SLC5A8 "Uncharacterized protei 0.808 0.089 0.472 2.1e-07
FB|FBgn0039872 622 salt "salty dog" [Drosophila m 0.911 0.099 0.430 2.1e-07
ZFIN|ZDB-GENE-050913-86 603 slc5a6 "solute carrier family 0.926 0.104 0.365 5.4e-07
ZFIN|ZDB-GENE-061110-98 610 slc5a8l "solute carrier family 0.808 0.090 0.436 5.5e-07
UNIPROTKB|C8KIL7 611 SMCT1 "Sodium-dependent monoca 0.808 0.090 0.454 9.1e-07
UNIPROTKB|F1SRH7 611 SLC5A8 "Uncharacterized protei 0.808 0.090 0.436 9.1e-07
MGI|MGI:2384916 Slc5a8 "solute carrier family 5 (iodide transporter), member 8" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
 Score = 135 (52.6 bits), Expect = 4.7e-08, P = 4.7e-08
 Identities = 30/67 (44%), Positives = 40/67 (59%)

Query:     1 MDTTLEPGLDNHFTIPDYIVLLTMLVVSCAIGFFVGMCGEKQTTSDDFLLGSSSMGTLPM 60
             MD + + G    F + DY+V   ML++S AIG +    G  Q TS DFL+G  SM  +P+
Sbjct:     1 MDASRDIG---SFVVWDYVVFAGMLLISAAIGIYYAFAGGGQQTSKDFLMGGRSMSAVPV 57

Query:    61 ALSLAAS 67
             ALSL AS
Sbjct:    58 ALSLTAS 64




GO:0005215 "transporter activity" evidence=IEA
GO:0005886 "plasma membrane" evidence=IEA
GO:0006810 "transport" evidence=IEA
GO:0006811 "ion transport" evidence=IEA
GO:0006814 "sodium ion transport" evidence=IEA
GO:0006915 "apoptotic process" evidence=IEA
GO:0015293 "symporter activity" evidence=IEA
GO:0016020 "membrane" evidence=IEA
GO:0016021 "integral to membrane" evidence=IEA
GO:0055085 "transmembrane transport" evidence=IEA
RGD|1564146 Slc5a8 "solute carrier family 5 (iodide transporter), member 8" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1P5L0 SLC5A8 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q8N695 SLC5A8 "Sodium-coupled monocarboxylate transporter 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2RI16 SLC5A8 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
FB|FBgn0039872 salt "salty dog" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050913-86 slc5a6 "solute carrier family 5 (sodium-dependent vitamin transporter), member 6" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-061110-98 slc5a8l "solute carrier family 5 (iodide transporter), member 8-like" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|C8KIL7 SMCT1 "Sodium-dependent monocarboxylate cotransporter" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1SRH7 SLC5A8 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query68
cd11492 522 cd11492, SLC5sbd_NIS-SMVT, Na(+)/iodide (NIS) and 8e-16
cd11519 541 cd11519, SLC5sbd_SMCT1, Na(+)/monocarboxylate cotr 2e-12
cd11505 536 cd11505, SLC5sbd_SMCT, Na(+)/monocarboxylate cotra 5e-12
cd11504 527 cd11504, SLC5sbd_SMVT, Na(+)/multivitamin cotransp 3e-10
cd11503 535 cd11503, SLC5sbd_NIS, Na(+)/iodide cotransporter N 5e-09
cd11520 529 cd11520, SLC5sbd_SMCT2, Na(+)/monocarboxylate cotr 1e-07
cd10326 477 cd10326, SLC5sbd_NIS-like, Na(+)/iodide (NIS) and 1e-06
cd11494 481 cd11494, SLC5sbd_NIS-like_u2, uncharacterized subg 3e-05
COG0591 493 COG0591, PutP, Na+/proline symporter [Amino acid t 5e-04
cd11475 464 cd11475, SLC5sbd_PutP, Na(+)/proline cotransporter 0.002
cd10322 455 cd10322, SLC5sbd, Solute carrier 5 family, sodium/ 0.002
>gnl|CDD|212061 cd11492, SLC5sbd_NIS-SMVT, Na(+)/iodide (NIS) and Na(+)/multivitamin (SMVT) cotransporters, and related proteins; solute binding domain Back     alignment and domain information
 Score = 69.0 bits (170), Expect = 8e-16
 Identities = 25/53 (47%), Positives = 34/53 (64%)

Query: 16 PDYIVLLTMLVVSCAIGFFVGMCGEKQTTSDDFLLGSSSMGTLPMALSLAASQ 68
           DY+V   ML++S  IG + G  G KQ T++++LLG  SM   P+ALSL AS 
Sbjct: 1  VDYVVFAAMLLISAGIGIYFGFFGGKQKTTEEYLLGGRSMSVFPVALSLLASF 53


NIS (encoded by the SLC5A5 gene) transports I-, and other anions including ClO4-, SCN-, and Br-. SMVT (encoded by the SLC5A6 gene) transports biotin, pantothenic acid and lipoate. This subfamily also includes SMCT1 and -2. SMCT1(encoded by the SLC5A8 gene) is a high-affinity transporter of various monocarboxylates including lactate and pyruvate, short-chain fatty acids, ketone bodies, nicotinate and its structural analogs, pyroglutamate, benzoate and its derivatives, and iodide. SMCT2 (encoded by the SLC5A12 gene) is a low-affinity transporter for short-chain fatty acids, lactate, pyruvate, and nicotinate. This subgroup belongs to the solute carrier 5 (SLC5) transporter family. Length = 522

>gnl|CDD|212088 cd11519, SLC5sbd_SMCT1, Na(+)/monocarboxylate cotransporter SMCT1 and related proteins; solute-binding domain Back     alignment and domain information
>gnl|CDD|212074 cd11505, SLC5sbd_SMCT, Na(+)/monocarboxylate cotransporters SMCT1 and 2 and related proteins; solute-binding domain Back     alignment and domain information
>gnl|CDD|212073 cd11504, SLC5sbd_SMVT, Na(+)/multivitamin cotransporter SMVT and related proteins; solute-binding domain Back     alignment and domain information
>gnl|CDD|212072 cd11503, SLC5sbd_NIS, Na(+)/iodide cotransporter NIS and related proteins; solute-binding domain Back     alignment and domain information
>gnl|CDD|212089 cd11520, SLC5sbd_SMCT2, Na(+)/monocarboxylate cotransporter SMCT2 and related proteins; solute-binding domain Back     alignment and domain information
>gnl|CDD|212036 cd10326, SLC5sbd_NIS-like, Na(+)/iodide (NIS) and Na(+)/multivitamin (SMVT) cotransporters, and related proteins; solute binding domain Back     alignment and domain information
>gnl|CDD|212063 cd11494, SLC5sbd_NIS-like_u2, uncharacterized subgroup of the Na(+)/iodide (NIS) cotransporter subfamily; putative solute-binding domain Back     alignment and domain information
>gnl|CDD|223664 COG0591, PutP, Na+/proline symporter [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|212045 cd11475, SLC5sbd_PutP, Na(+)/proline cotransporter PutP and related proteins; solute binding domain Back     alignment and domain information
>gnl|CDD|212032 cd10322, SLC5sbd, Solute carrier 5 family, sodium/glucose transporters and related proteins; solute-binding domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 68
KOG2349|consensus 585 99.39
PRK09395 551 actP acetate permease; Provisional 99.37
PRK12488 549 acetate permease; Provisional 99.33
PRK15419 502 proline:sodium symporter PutP; Provisional 99.33
PRK09442 483 panF sodium/panthothenate symporter; Provisional 99.3
TIGR02121 487 Na_Pro_sym sodium/proline symporter. This family c 99.24
TIGR02711 549 symport_actP cation/acetate symporter ActP. Member 99.2
PRK10484 523 putative transporter; Provisional 99.18
TIGR02119 471 panF sodium/pantothenate symporter. Pantothenate ( 99.14
TIGR03648 552 Na_symport_lg probable sodium:solute symporter, VC 99.06
COG0591 493 PutP Na+/proline symporter [Amino acid transport a 98.94
COG4145 473 PanF Na+/panthothenate symporter [Coenzyme metabol 98.31
COG4146 571 Predicted symporter [General function prediction o 97.22
COG4147 529 DhlC Predicted symporter [General function predict 96.31
KOG3761|consensus 591 93.53
PF12273130 RCR: Chitin synthesis regulation, resistance to Co 87.8
>KOG2349|consensus Back     alignment and domain information
Probab=99.39  E-value=4.8e-14  Score=106.87  Aligned_cols=53  Identities=36%  Similarity=0.593  Sum_probs=50.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHhheeccCCcCCccceeecCCCCCHHHHHhhhhhcC
Q psy15007         15 IPDYIVLLTMLVVSCAIGFFVGMCGEKQTTSDDFLLGSSSMGTLPMALSLAASQ   68 (68)
Q Consensus        15 ~~D~~v~~~yl~~~~~iG~~~~~~~~~~~s~~dyflggr~m~~~~vglSl~AT~   68 (68)
                      +.||.|+++|++++.+||+|+.++++++ +.+|||+|||+|+|||+|+|++|||
T Consensus         8 ~~d~~v~~l~~~~~~~ig~~~~~~~~~~-t~~~y~l~gr~m~~~Pv~~SL~aS~   60 (585)
T KOG2349|consen    8 AADYSVFVLYFLLVMAIGLWFGFRTKRG-TVEEYFLGGRSMVWLPVAASLFASN   60 (585)
T ss_pred             ccchhHHHHHHHHhhhheeeEEEEcCCc-cHhhhhhcCCcceEEEeehhhhhhh
Confidence            8999999999999999999999886555 9999999999999999999999996



>PRK09395 actP acetate permease; Provisional Back     alignment and domain information
>PRK12488 acetate permease; Provisional Back     alignment and domain information
>PRK15419 proline:sodium symporter PutP; Provisional Back     alignment and domain information
>PRK09442 panF sodium/panthothenate symporter; Provisional Back     alignment and domain information
>TIGR02121 Na_Pro_sym sodium/proline symporter Back     alignment and domain information
>TIGR02711 symport_actP cation/acetate symporter ActP Back     alignment and domain information
>PRK10484 putative transporter; Provisional Back     alignment and domain information
>TIGR02119 panF sodium/pantothenate symporter Back     alignment and domain information
>TIGR03648 Na_symport_lg probable sodium:solute symporter, VC_2705 subfamily Back     alignment and domain information
>COG0591 PutP Na+/proline symporter [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>COG4145 PanF Na+/panthothenate symporter [Coenzyme metabolism] Back     alignment and domain information
>COG4146 Predicted symporter [General function prediction only] Back     alignment and domain information
>COG4147 DhlC Predicted symporter [General function prediction only] Back     alignment and domain information
>KOG3761|consensus Back     alignment and domain information
>PF12273 RCR: Chitin synthesis regulation, resistance to Congo red; InterPro: IPR020999 RCR proteins are ER membrane proteins that regulate chitin deposition in fungal cell walls Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query68
2xq2_A 593 Sodium/glucose cotransporter; transport protein, i 1e-07
>2xq2_A Sodium/glucose cotransporter; transport protein, inverted repeats, LEUT-fold, galactose; 2.73A {Vibrio parahaemolyticus} PDB: 2xq2_B 2kpe_A Length = 593 Back     alignment and structure
 Score = 45.6 bits (108), Expect = 1e-07
 Identities = 11/61 (18%), Positives = 27/61 (44%), Gaps = 1/61 (1%)

Query: 8  GLDNHFTIPDYIVLLTMLVVSCAIGFFVG-MCGEKQTTSDDFLLGSSSMGTLPMALSLAA 66
           +++  +  D +V    + +   +G +V       Q +++D+ L   S+    +  SL A
Sbjct: 3  NIEHGLSFIDIMVFAIYVAIIIGVGLWVSRDKKGTQKSTEDYFLAGKSLPWWAVGASLIA 62

Query: 67 S 67
          +
Sbjct: 63 A 63


Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query68
2xq2_A 593 Sodium/glucose cotransporter; transport protein, i 99.5
3dh4_A 530 Sodium/glucose cotransporter; membrane protein, sy 98.4
2ks1_B44 Epidermal growth factor receptor; ERBB1, ERBB2, tr 86.54
2jwa_A44 Receptor tyrosine-protein kinase ERBB-2; transmemb 81.66
>2xq2_A Sodium/glucose cotransporter; transport protein, inverted repeats, LEUT-fold, galactose; 2.73A {Vibrio parahaemolyticus} PDB: 2xq2_B 2kpe_A Back     alignment and structure
Probab=99.50  E-value=1.1e-14  Score=107.54  Aligned_cols=57  Identities=19%  Similarity=0.361  Sum_probs=35.5

Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHhheeccCC-cCCccceeecCCCCCHHHHHhhhhhcC
Q psy15007         12 HFTIPDYIVLLTMLVVSCAIGFFVGMCGEK-QTTSDDFLLGSSSMGTLPMALSLAASQ   68 (68)
Q Consensus        12 ~~~~~D~~v~~~yl~~~~~iG~~~~~~~~~-~~s~~dyflggr~m~~~~vglSl~AT~   68 (68)
                      +++++|++++++|+++++++|+|.+|+.|+ ++++||||+|||++|||++++|++||+
T Consensus         7 ~~~~~d~~i~~~yl~~~~~ig~~~~r~~~~~~~~~~dy~laGR~l~~~~~~~Sl~at~   64 (593)
T 2xq2_A            7 GLSFIDIMVFAIYVAIIIGVGLWVSRDKKGTQKSTEDYFLAGKSLPWWAVGASLIAAN   64 (593)
T ss_dssp             --CHHHHHHHHHHHHHHHHHHHTCC-------------------CCHHHHHHHHHGGG
T ss_pred             cccHHHHHHHHHHHHHHHHHHHHHHhcccCCCCCHHHHhcCCCCCCHHHHHHHHHHHH
Confidence            489999999999999999999998865332 357999999999999999999999874



>3dh4_A Sodium/glucose cotransporter; membrane protein, symporter, sugar transport, SGLT, ION TRAN membrane, sodium transport, symport; HET: GAL; 2.70A {Vibrio parahaemolyticus} Back     alignment and structure
>2ks1_B Epidermal growth factor receptor; ERBB1, ERBB2, transmembrane, heterodimer, complex, tyrosine receptor, bicelles, transferase; NMR {Homo sapiens} Back     alignment and structure
>2jwa_A Receptor tyrosine-protein kinase ERBB-2; transmembrane helix dimer, protein kinase receptor membrane domain, ATP-binding, glycoprotein; NMR {Homo sapiens} PDB: 2ks1_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

No hit with probability above 80.00