Psyllid ID: psy15088

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------1270------1280------1290-
MLDGLRKVNKSYPLLTTKVEESGEHVVLGTGELYLDCVMHDLRKMYSEIDIKVADPVVAFCETVVETSSLKCFAETPNKRNKITMIAEPLEKGLAEDIENQIVHIAWNKKRLGEFFQSKYDWDLLAARSIWAFGPEVTGPNILVDDTLPSEVDKGLLGSVKDSIVQGFQWGTREGPLCEEPIRNVKFKIREGNLNSSPSIYCSNKSHSWEIVCTRNNNKCLPPGHVNFSDEVTAAMRLCDGVVLFVDAAEGVMLNTERLLKHAVQEKMAITLCVNKIDRLMLELKLPPQDAYYKIKHIIDEINGLLRYLLIDDDREDGDEEMGDSQAVVLHEDKRYYPTAVEVFGPDVETVVQEEDTQALSVPLIAPIKKKKFQLKEQDLPDTVYNMEFLADMMDTPHLIRNVALVGHLHHGKTTMIDCLIRQTHPGYRQPAEEKNLRYTDTLFTEQERGVSIKASPVTLLLPDVKGKNYLMNIFDTPASPVTLLLPDVKGKNYLMNIFDTPGMWDIHVRKFSKKAAHASAQRSFVEFVLEPVYKLVAQVVGDVDSSLPAVLDQLGIHMNKEESKINIRPLLRLVYKVEVNRVPAGNWVLIEGIDQPIVKTSTITDLITNEDITSNKFLIDGFPRNQNNLDGWNKEMADKVELLYVLFFDCPEDVCVRRCLKRGAEGSGRADDNEESLKKRISVYNTETMPIIKFFEAKNLVKRFNAEKSLVEMCVKHIPSPAENAETKVSYMYTGPGDSDVARDMKACNPEGRLMVHSSKKNAETKVSYMYTGPGDSDVARDMKACNPEGRLMVHSSKMYPTEECTFFQVLARVMSGTLHAGQEVRVLGENYSLMDEEDSRILTVGRLWIYEARYKVEVNRVPAGNWVLIEGIDQPIVKTSTITDLITNEDMYIFRPLKFNTQSVIKIAVEPVNPSELPKMLDGLRKVNKSYPLLTTKVEESGEHVVLGTGELYLDCVMHDLRKMYSEIDIKVADPVVAFCETVVETSSLKCFAETPNKRNKITMIAEPLEKGLAEDIENQIVHIAWNKKRLGEFFQSKYDWDLLAARSIWAFGPEVTGPNILVDDTLPSEVDKGLLGSVKDSIVQGFQWGTREGPLCEEPIRNVKFKILDAVIATEPLHRGGGQIIPTARRVAYSAFLMATPRLMEPYLFVEVQAPADCVSAVYTVLAKRRGHVTQDAPVPGSPLYTIKAFIPAIDSFGFETDLRTHTQGQAFCLSVFHHWQIVPGDPLDKSIVIRPLEPQPATHLAREFMIKTRRRKGLSEDVSINKFFDDPMLLELARQDVMLNYPL
cHHHHHHHHHHcccEEEEEcccccEEEEEccHHHHHHHHHHHHHHHccccEEEcccEEEEEEccccccccccccccccccccEEEEEEcccHHHHHHHHcccccccccHHHHHHHHHHHHcccHHHHcccEEcccccccccEEEEccccccccccHHHHHHHHHHHHHHHHcccccccccccEEEEEEEEEccccccccccccccccccHHHHccccccccccccccHHHHHHHHHcccccEEEEEEEcccccHHHHHHHHHHHHHcccEEEEEEcHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccEEcccccEEccccccccccccccEEEEccccccccccccccccccccccccccccccccHHHHHHHcccccEEEcEEEEcccccccHHHHHHHHHHHccccccccccccccccccHHHHHHHccccccccccccccccccccccEEcccccccccccccccccccccEEEEEEccccEEEEEEEEHHHHHHHHccccEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHccccHHHHHHHHccccccccEEEEEccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccHHHHHHHHccccccccccccccHHHHHHHHEEccccccHHHHHHHHHHHHHHccHHHHHHHHccccccccHHHcHHccccccccccccHHHHHHHHccccccccccccHHHHHcccccccccccccHHHHHHHHccccccccccccccccccccccEEEEEEEEEEEEEcccEEEEEccccccccccccEEEEEEEEEEEEccEEEEccccccccEEEEEcccccEEEEEEEEccccccccccccccccccccEEEEEEccccccccHHHHHHHHHHHHHccEEEEEEcccccEEEEEccHHHHHHHHHHHHHHHcccEEEEcccEEEEEEccccccccccccccccccccEEEEcccccHHHHHHHHHccccccccHHHHHHHHHHHHcccHHHHHccEEEccccccccEEEccccccccccccHHHccccHHHHHHHHccccccccccccEEEEEEEEEEEccccccccccccccHHHHHHHHHHHcccccccccEEEEEEcccHHHHHHHHHHHHccccEEEEEEEcccccEEEEEEEcccccccccHHHHHHccccccEEcccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccccccccHHHHHHHHHccccccccc
ccHHHHHHcccccEEEEEEEccccEEEEcccHHHHHHHHHHHHHHHccccEEEcccEEEEEEEEEccccEEEHccccccccEEEEEEccccccHHHHHHcccccccccHHHHHHHHHHHccccHHHHHHHHHcccccccccEEEEcccccEccHHHHHHHHHHHHHHHHHHHccccccccccccEEEEEEEEEEEcccccccccccccccEEEccccccccccccEcHHHHHcccccccccEEEEEEccccHHHHHHHHHHHHHHHccccEEEEEHHHHHHHHHcccHHHHHHHHHHHHHHHHEEEEEcccccccccccccccccEEEEEcccccEccccccEcccccEEEEcccccccccHHHHHHHHHHHccccHHHHHHHcccHHHHHHHHccccccEEEEEEEEEcccccHHHHHHHHHHccHEHHHHHccccccccccHHHHHccEEEEEccEEEEEEcccHHHHHcccccccccHHHHcccccccccEEEEEEccccccccEccccccHHEEEEEEcccEEEEEEcEccEEEcHHHHHHHHHHHccccEEEEcHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcEEEEEcccccccccccccccccEEEEcccccHHHHHHHHHHcccccEEEEEEEEEccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHcHHHHHHHcccccEEEEEccccHHHHccEcccccHHHHHHHccHHHHHHHHHHHccHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHccccccEEEEEEEEcccccccEEEEEEEEEEEEEccccEEEEEccccccccHHHHHHHHHHHEEHHHcccEEEccccccccEEEEEEcccHEEEccEEEcccccccccccEEEEEEcccEEEEEEccccHHHcHHHHHHHHHHHccccEEEEEEEccccEEEEcccHHHHHHHHHHHHHHHccccEEEcccEEEEEEEEEccccEEEHccccccccEEEEEEccccccHHHHHHcccccccccHHHHHHHHHHHccccHHHHHHHHHcccccccccEEEEcccccEccHHHHHHHHHHHHHHHHHHHccccccccccccEEEEEEEEEEcccHHHcccccHccHHHHHHHHHHHHccccccccEEEEEEEccHHHHHHHHHHHHHHcccEEcccccccccEEEEEEEEEHHHcccccHHHHHcccccccccEHEccHEEccccccccEEEEEcccccccccHHHHHHHHHHHHccccccccccHHccHHHHHHHHHcccEEcccc
mldglrkvnksypllttkveesgehvvlgTGELYLDCVMHDLRKMYSEIDIKVADPVVAFCETVVETsslkcfaetpnkrnkiTMIAEPLEKGLAEDIENQIVHIAWNKKrlgeffqskydwDLLAARSIwafgpevtgpnilvddtlpsevdkgllgsVKDSIVQGfqwgtregplceepirnvkfkiregnlnsspsiycsnkshsWEIVCtrnnnkclppghvnfsDEVTAAMRLCDGVVLFVDAAEGVMLNTERLLKHAVQEKMAITLCVNKIDRLMLelklppqdayYKIKHIIDEINGLLRYLLidddredgdeemgdsqavvlhedkryyptavevfgpdvetvvqeedtqalsvpliapikkkkfqlkeqdlpdtvYNMEFLAdmmdtphlIRNVALVghlhhgkttmidclirqthpgyrqpaeeknlrytdtlfteqergvsikaspvtlllpdvkgknylmnifdtpaspvtlllpdvkgknylmnifdtpgmwdiHVRKFSKKAAHASAQRSFVEFVLEPVYKLVAQVVGDVDSSLPAVLDQLGihmnkeeskinirpLLRLVYKVEVnrvpagnwvliegidqpivktstitdlitneditsnkflidgfprnqnnldgwnKEMADKVELLYVLFFDCPEDVCVRRCLkrgaegsgraddneESLKKRISVYNTETMPIIKFFEAKNLVKRFNAEKSLVEMCVKhipspaenaetkvsymytgpgdsdvardmkacnpegrlmvhsskknaeTKVSYmytgpgdsdvardmkacnpegrlmvhsskmypteecTFFQVLARVMSgtlhagqevrvlgenyslmdeedsriltVGRLWIYEARYKVEvnrvpagnwvliegidqpivktstitdlitnedmyifrplkfntQSVIKIavepvnpselpkmldglrkvnksypllttkveesgehvvlgTGELYLDCVMHDLRKMYSEIDIKVADPVVAFCETVVETsslkcfaetpnkrnkiTMIAEPLEKGLAEDIENQIVHIAWNKKrlgeffqskydwDLLAARSIwafgpevtgpnilvddtlpsevdkgllgsVKDSIVQGfqwgtregplceepirnvKFKILDAViateplhrgggqiiptARRVAYSAFLMatprlmepylfvevqapadCVSAVYTVLAKrrghvtqdapvpgsplytikafipaidsfgfetdlrthtqGQAFCLSVFhhwqivpgdpldksivirplepqpatHLAREFMIKTRRrkglsedvsinkffddpmlLELARQdvmlnypl
mldglrkvnksypllttkveesgehvvlGTGELYLDCVMHDLRKMYSEIDIKVADPVVAFCETVVEtsslkcfaetpnkrnkITMIAEPLEKGLAEDIENQIVHIAWNKKRLGEFFQSKYDWDLLAARSIWAFGPEVTGPNILVDDTLPSEVDKGLLGSVKDSIVQGfqwgtregplceepIRNVKFKIREGNLNSSPSIYCSNKSHSWEIVCTRNNNKCLPPGHVNFSDEVTAAMRLCDGVVLFVDAAEGVMLNTERLLKHAVQEKMAITLCVNKIDRLMLELKLPPQDAYYKIKHIIDEINGLLRYLLIDDDREDGDEEMGDSQAVVLHEDKRYYPTAVEVFGPDVETVVQEEDTqalsvpliapikkkkfqlkeqdlPDTVYNMEFLADMMDTPHLIRNVALVGHLHHGKTTMIDCLIRQTHPgyrqpaeeknlRYTDTLFTeqergvsikaspvtllLPDVKGKNYLMNIFDTPASPVTLLLPDVKGKNYLMNIFDTPGMWDIHVRKFSKKAAHASAQRSFVEFVLEPVYKLVAQVVGDVDSSLPAVLDQLGIhmnkeeskinirpLLRLVYKVEVNRVPAGnwvliegidqpivkTSTITDLITNEDITSNKFLIDGFPRNQNNLDGWNKEMADKVELLYVLFFDCPEDVCVRRCLKRgaegsgraddneeslkkrisvyntetmpiIKFFEAKNLVKRFNAEKSLVEMCVKHIpspaenaetkvSYMYTGPGDSDVARDMKACNPEGrlmvhsskknaetKVSYMYtgpgdsdvARDMKACNPEGRLmvhsskmyptEECTFFQVLARVMSGTLHAGQEVRVLgenyslmdeedsriltVGRLWIYEARYKVEVNRVPAGNwvliegidqpivktSTITDLITNEDMYIFRPLKFNTQSVIKIAVEPVNPSELPKMLDGLRKVNKSYPLLttkveesgehvvlGTGELYLDCVMHDLRKMYSEIDIKVADPVVAFCETVVEtsslkcfaetpnkrnkITMIAEPLEKGLAEDIENQIVHIAWNKKRLGEFFQSKYDWDLLAARSIWAFGPEVTGPNILVDDTLPSEVDKGLLGSVKDSIVQGFqwgtregplceepIRNVKFKILDAVIAteplhrgggqiiptARRVAYSAFLMATPRLMEPYLFVEVQAPADCVSAVYTVLAKRrghvtqdapvpgsplYTIKAFIPAIDSFGFETDLRTHTQGQAFCLSVFHHWQIVPGDPLDKSIVIRPlepqpathlarEFMIKtrrrkglsedvsinkffddpmllelarqdvmlnypl
MLDGLRKVNKSYPLLTTKVEESGEHVVLGTGELYLDCVMHDLRKMYSEIDIKVADPVVAFCETVVETSSLKCFAETPNKRNKITMIAEPLEKGLAEDIENQIVHIAWNKKRLGEFFQSKYDWDLLAARSIWAFGPEVTGPNILVDDTLPSEVDKGLLGSVKDSIVQGFQWGTREGPLCEEPIRNVKFKIREGNLNSSPSIYCSNKSHSWEIVCTRNNNKCLPPGHVNFSDEVTAAMRLCDGVVLFVDAAEGVMLNTERLLKHAVQEKMAITLCVNKIDRLMLELKLPPQDAYYKIKHIIDEINGLLRYLLIdddredgdeemgdSQAVVLHEDKRYYPTAVEVFGPDVETVVQEEDTQALSVPLIAPIKKKKFQLKEQDLPDTVYNMEFLADMMDTPHLIRNVALVGHLHHGKTTMIDCLIRQTHPGYRQPAEEKNLRYTDTLFTEQERGVSIKASPVTLLLPDVKGKNYLMNIFDTPASPVTLLLPDVKGKNYLMNIFDTPGMWDIHVRKFSKKAAHASAQRSFVEFVLEPVYKLVAQVVGDVDSSLPAVLDQLGIHMNKEESKINIRPLLRLVYKVEVNRVPAGNWVLIEGIDQPIVKTSTITDLITNEDITSNKFLIDGFPRNQNNLDGWNKEMADKVELLYVLFFDCPEDVCVRRCLKRGAEGSGRADDNEESLKKRISVYNTETMPIIKFFEAKNLVKRFNAEKSLVEMCVKHIPSPAENAETKVSYMYTGPGDSDVARDMKACNPEGRLMVHSSKKNAETKVSYMYTGPGDSDVARDMKACNPEGRLMVHSSKMYPTEECTFFQVLARVMSGTLHAGQEVRVLGENYSLMDEEDSRILTVGRLWIYEARYKVEVNRVPAGNWVLIEGIDQPIVKTSTITDLITNEDMYIFRPLKFNTQSVIKIAVEPVNPSELPKMLDGLRKVNKSYPLLTTKVEESGEHVVLGTGELYLDCVMHDLRKMYSEIDIKVADPVVAFCETVVETSSLKCFAETPNKRNKITMIAEPLEKGLAEDIENQIVHIAWNKKRLGEFFQSKYDWDLLAARSIWAFGPEVTGPNILVDDTLPSEVDKGLLGSVKDSIVQGFQWGTREGPLCEEPIRNVKFKILDAVIATEPLHRGGGQIIPTARRVAYSAFLMATPRLMEPYLFVEVQAPADCVSAVYTVLAKRRGHVTQDAPVPGSPLYTIKAFIPAIDSFGFETDLRTHTQGQAFCLSVFHHWQIVPGDPLDKSIVIRPLEPQPATHLAREFMIKTRRRKGLSEDVSINKFFDDPMLLELARQDVMLNYPL
************PLLTTKVEESGEHVVLGTGELYLDCVMHDLRKMYSEIDIKVADPVVAFCETVVETSSLKCFAETPNKRNKITMIAEPLEKGLAEDIENQIVHIAWNKKRLGEFFQSKYDWDLLAARSIWAFGPEVTGPNILVDDTLPSEVDKGLLGSVKDSIVQGFQWGTREGPLCEEPIRNVKFKIREGNLNSSPSIYCSNKSHSWEIVCTRNNNKCLPPGHVNFSDEVTAAMRLCDGVVLFVDAAEGVMLNTERLLKHAVQEKMAITLCVNKIDRLMLELKLPPQDAYYKIKHIIDEINGLLRYLLID**************AVVLHEDKRYYPTAVEVFGPDVETVVQEEDTQALSVPLIAPIKKKKFQLKEQDLPDTVYNMEFLADMMDTPHLIRNVALVGHLHHGKTTMIDCLIRQTHPGYRQ****KNLRYTDTLFTEQERGVSIKASPVTLLLPDVKGKNYLMNIFDTPASPVTLLLPDVKGKNYLMNIFDTPGMWDIHVRKFSKKAAHASAQRSFVEFVLEPVYKLVAQVVGDVDSSLPAVLDQLGIHMNKEESKINIRPLLRLVYKVEVNRVPAGNWVLIEGIDQPIVKTSTITDLITNEDITSNKFLIDGFPRNQNNLDGWNKEMADKVELLYVLFFDCPEDVCVRRCLKR*****************RISVYNTETMPIIKFFEAKNLVKRFNAEKSLVEMCVKHI**************************************************************************MVHSSKMYPTEECTFFQVLARVMSGTLHAGQEVRVLGENYSLMDEEDSRILTVGRLWIYEARYKVEVNRVPAGNWVLIEGIDQPIVKTSTITDLITNEDMYIFRPLKFNTQSVIKIAVEPVNPSELPKMLDGLRKVNKSYPLLTTKVEESGEHVVLGTGELYLDCVMHDLRKMYSEIDIKVADPVVAFCETVVETSSLKCFAETPNKRNKITMIAEPLEKGLAEDIENQIVHIAWNKKRLGEFFQSKYDWDLLAARSIWAFGPEVTGPNILVDDTLPSEVDKGLLGSVKDSIVQGFQWGTREGPLCEEPIRNVKFKILDAVIATEPLHRGGGQIIPTARRVAYSAFLMATPRLMEPYLFVEVQAPADCVSAVYTVLAKRRGHVTQDAPVPGSPLYTIKAFIPAIDSFGFETDLRTHTQGQAFCLSVFHHWQIVPGDPLDKSIVIRPLEPQPATHLAREFMIKTRRRKGLSEDVSINKFFDDPMLLELARQDV******
MLDGLRKVNKSYPLLTTKVEESGEHVVLGTGELYLDCVMHDLRKMYSEIDIKVADPVVAFCETVVETSSLKCFAETPNKRNKITMIAEPLEKGLAEDIEN**********RLGEFFQSKYDWDLLAARSIWAFGPEVTGPNILVDDTLPSEVDKGLLGSVKDSIVQGFQWGTREGPLCEEPIRNVKFKIREGNLNSSPS*************CTRNNNKCLPPGHVNFSDEVTAAMRLCDGVVLFVDAAEGVMLNTERLLKHAVQEKMAITLCVNKIDRLMLELKLPPQDAYYKIKHIIDEINGLLRYLLIDDDREDGDEEMGDSQAVVLHEDKRYYPTAVEVFGPDVETVVQEEDTQALSVPLIAPIKKKKFQLKEQDLPDTVYNMEFLADMMDTPHLIRNVALVGHLHHGKTTMIDCLIRQTHPGYRQPAEEKNLRYTDTLFTEQERGVSIKASPVTLLLPDVKGKNYLMNIFDTPASPVTLLLPDVKGKNYLMNIFDTPGMWDIHVRKFSKKAAHASAQRSFVEFVLEPVYKLVAQVVGDVDSSLPAVLDQLGIHMNKEESKINIRPLLRLVYKVEVNRVPAGNWVLIEGIDQPIVKTSTITDLITNEDITSNKFLIDGFPRNQNNLDGWNKEMADKVELLYVLFFDCPEDVCVRRCLKRGAEGSGRADDNEESLKKRISVYNTETMPIIKFFEAKNLVKRFNAEKSLVEMCVKHIPSPAENAETKVSYMYTGPGDSDVARDMKACNPEGRLM************************************LMVHSSKMYPTEECTFFQVLARVMSGTLHAGQEVRVLGENYSLMDEEDSRILTVGRLWIYEARYKVEVNRVPAGNWVLIEGIDQPIVKTSTITDLITNEDMYIFRPLKFNTQSVIKIAVEPVNPSELPKMLDGLRKVNKSYPLLTTKVEESGEHVVLGTGELYLDCVMHDLRKMYSEIDIKVADPVVAFCETVVETSSLKCFAETPNKRNKITMIAEPLEKGLAEDIE***********RLGEFFQSKYDWDLLAARSIWAFGPEVTGPNILVDDTLPSEVDKGLLGSVKDSIVQGFQWGTREGPLCEEPIRNVKFKILDAVI**************TARRVAYSAFLMATPRLMEPYLFVEVQAPADCVSAVYTVLAKRRGHVTQDAPVPGSPLYTIKAFIPAIDSFGFETDLRTHTQGQAFCLSVFHHWQIVPGDPLDKSIVIR*L***PATHLAREFMIKTRRRKGLSEDVSINKFFDDPMLLELARQDVMLNYP*
MLDGLRKVNKSYPLLTTKVEESGEHVVLGTGELYLDCVMHDLRKMYSEIDIKVADPVVAFCETVVETSSLKCFAETPNKRNKITMIAEPLEKGLAEDIENQIVHIAWNKKRLGEFFQSKYDWDLLAARSIWAFGPEVTGPNILVDDTLPSEVDKGLLGSVKDSIVQGFQWGTREGPLCEEPIRNVKFKIREGNLNSSPSIYCSNKSHSWEIVCTRNNNKCLPPGHVNFSDEVTAAMRLCDGVVLFVDAAEGVMLNTERLLKHAVQEKMAITLCVNKIDRLMLELKLPPQDAYYKIKHIIDEINGLLRYLLIDDDREDGDEEMGDSQAVVLHEDKRYYPTAVEVFGPDVETVVQEEDTQALSVPLIAPIKKKKFQLKEQDLPDTVYNMEFLADMMDTPHLIRNVALVGHLHHGKTTMIDCLIRQTHPGYRQPAEEKNLRYTDTLFTEQERGVSIKASPVTLLLPDVKGKNYLMNIFDTPASPVTLLLPDVKGKNYLMNIFDTPGMWDIHVRKF**********RSFVEFVLEPVYKLVAQVVGDVDSSLPAVLDQLGIHMNKEESKINIRPLLRLVYKVEVNRVPAGNWVLIEGIDQPIVKTSTITDLITNEDITSNKFLIDGFPRNQNNLDGWNKEMADKVELLYVLFFDCPEDVCVRRCLKR*************SLKKRISVYNTETMPIIKFFEAKNLVKRFNAEKSLVEMCVKHIPSPAENAETKVSYMYTGPGDSDVARDMKACNPEGRLMVHSSKKNAETKVSYMYTGPGDSDVARDMKACNPEGRLMVHSSKMYPTEECTFFQVLARVMSGTLHAGQEVRVLGENYSLMDEEDSRILTVGRLWIYEARYKVEVNRVPAGNWVLIEGIDQPIVKTSTITDLITNEDMYIFRPLKFNTQSVIKIAVEPVNPSELPKMLDGLRKVNKSYPLLTTKVEESGEHVVLGTGELYLDCVMHDLRKMYSEIDIKVADPVVAFCETVVETSSLKCFAETPNKRNKITMIAEPLEKGLAEDIENQIVHIAWNKKRLGEFFQSKYDWDLLAARSIWAFGPEVTGPNILVDDTLPSEVDKGLLGSVKDSIVQGFQWGTREGPLCEEPIRNVKFKILDAVIATEPLHRGGGQIIPTARRVAYSAFLMATPRLMEPYLFVEVQAPADCVSAVYTVLAKRRGHVTQDAPVPGSPLYTIKAFIPAIDSFGFETDLRTHTQGQAFCLSVFHHWQIVPGDPLDKSIVIRPLEPQPATHLAREFMIKTRRRKGLSEDVSINKFFDDPMLLELARQDVMLNYPL
MLDGLRKVNKSYPLLTTKVEESGEHVVLGTGELYLDCVMHDLRKMYSEIDIKVADPVVAFCETVVETSSLKCFAETPNKRNKITMIAEPLEKGLAEDIENQIVHIAWNKKRLGEFFQSKYDWDLLAARSIWAFGPEVTGPNILVDDTLPSEVDKGLLGSVKDSIVQGFQWGTREGPLCEEPIRNVKFKIREGNLNSSPSIYCSNKSHSWEIVCTRNNNKCLPPGHVNFSDEVTAAMRLCDGVVLFVDAAEGVMLNTERLLKHAVQEKMAITLCVNKIDRLMLELKLPPQDAYYKIKHIIDEINGLLRYLLIDDDREDGDEEMGDSQAVVLHEDKRYYPTAVEVFGPDVETVVQEEDTQALSVPLIAPIKKKKFQLKEQDLPDTVYNMEFLADMMDTPHLIRNVALVGHLHHGKTTMIDCLIRQTHPGYRQPAEEKNLRYTDTLFTEQERGVSIKASPVTLLLPDVKGKNYLMNIFDTPASPVTLLLPDVKGKNYLMNIFDTPGMWDIHVRKFSKKAAHASAQRSFVEFVLEPVYKLVAQVVGDVDSSLPAVLDQLGIHMNKEESKINIRPLLRLVYKVEVNRVPAGNWVLIEGIDQPIVKTSTITDLITNEDITSNKFLIDGFPRNQNNLDGWNKEMADKVELLYVLFFDCPEDVCVRRCLKRGAEGSGRADDNEESLKKRISVYNTETMPIIKFFEAKNLVKRFNAEKSLVEMCVKHIPSPAENAETKVSYMYTGPGDSDVARDMKACNPEGRLMVHSSKKNAETKVSYMYTGPGDSDVARDMKACNPEGRLMVHSSKMYPTEECTFFQVLARVMSGTLHAGQEVRVLGENYSLMDEEDSRILTVGRLWIYEARYKVEVNRVPAGNWVLIEGIDQPIVKTSTITDLITNEDMYIFRPLKFNTQSVIKIAVEPVNPSELPKMLDGLRKVNKSYPLLTTKVEESGEHVVLGTGELYLDCVMHDLRKMYSEIDIKVADPVVAFCETVVETSSLKCFAETPNKRNKITMIAEPLEKGLAEDIENQIVHIAWNKKRLGEFFQSKYDWDLLAARSIWAFGPEVTGPNILVDDTLPSEVDKGLLGSVKDSIVQGFQWGTREGPLCEEPIRNVKFKILDAVIATEPLHRGGGQIIPTARRVAYSAFLMATPRLMEPYLFVEVQAPADCVSAVYTVLAKRRGHVTQDAPVPGSPLYTIKAFIPAIDSFGFETDLRTHTQGQAFCLSVFHHWQIVPGDPLDKSIVIRPLEPQPATHLAREFMIKTRRRKGLSEDVSINKFFDDPMLLELARQDVMLNYP*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLDGLRKVNKSYPLLTTKVEESGEHVVLGTGELYLDCVMHDLRKMYSEIDIKVADPVVAFCETVVETSSLKCFAETPNKRNKITMIAEPLEKGLAEDIENQIVHIAWNKKRLGEFFQSKYDWDLLAARSIWAFGPEVTGPNILVDDTLPSEVDKGLLGSVKDSIVQGFQWGTREGPLCEEPIRNVKFKIREGNLNSSPSIYCSNKSHSWEIVCTRNNNKCLPPGHVNFSDEVTAAMRLCDGVVLFVDAAEGVMLNTERLLKHAVQEKMAITLCVNKIDRLMLELKLPPQDAYYKIKHIIDEINGLLRYLLIDDDREDGDEEMGDSQAVVLHEDKRYYPTAVEVFGPDVETVVQEEDTQALSVPLIAPIKKKKFQLKEQDLPDTVYNMEFLADMMDTPHLIRNVALVGHLHHGKTTMIDCLIRQTHPGYRQPAEEKNLRYTDTLFTEQERGVSIKASPVTLLLPDVKGKNYLMNIFDTPASPVTLLLPDVKGKNYLMNIFDTPGMWDIHVRKFSKKAAHASAQRSFVEFVLEPVYKLVAQVVGDVDSSLPAVLDQLGIHMNKEESKINIRPLLRLVYKVEVNRVPAGNWVLIEGIDQPIVKTSTITDLITNEDITSNKFLIDGFPRNQNNLDGWNKEMADKVELLYVLFFDCPEDVCVRRCLKRGAEGSGRADDNEESLKKRISVYNTETMPIIKFFEAKNLVKRFNAEKSLVEMCVKHIPSPAENAETKVSYMYTGPGDSDVARDMKACNPEGRLMVHSSKKNAETKVSYMYTGPGDSDVARDMKACNPEGRLMVHSSKMYPTEECTFFQVLARVMSGTLHAGQEVRVLGENYSLMDEEDSRILTVGRLWIYEARYKVEVNRVPAGNWVLIEGIDQPIVKTSTITDLITNEDMYIFRPLKFNTQSVIKIAVEPVNPSELPKMLDGLRKVNKSYPLLTTKVEESGEHVVLGTGELYLDCVMHDLRKMYSEIDIKVADPVVAFCETVVETSSLKCFAETPNKRNKITMIAEPLEKGLAEDIENQIVHIAWNKKRLGEFFQSKYDWDLLAARSIWAFGPEVTGPNILVDDTLPSEVDKGLLGSVKDSIVQGFQWGTREGPLCEEPIRNVKFKILDAVIATEPLHRGGGQIIPTARRVAYSAFLMATPRLMEPYLFVEVQAPADCVSAVYTVLAKRRGHVTQDAPVPGSPLYTIKAFIPAIDSFGFETDLRTHTQGQAFCLSVFHHWQIVPGDPLDKSIVIRPLEPQPATHLAREFMIKTRRRKGLSEDVSINKFFDDPMLLELARQDVMLNYPL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1291 2.2.26 [Sep-21-2011]
Q5F3X4972 116 kDa U5 small nuclear yes N/A 0.426 0.566 0.782 0.0
A4FUD3972 116 kDa U5 small nuclear yes N/A 0.426 0.566 0.780 0.0
Q15029972 116 kDa U5 small nuclear yes N/A 0.426 0.566 0.780 0.0
O08810971 116 kDa U5 small nuclear yes N/A 0.426 0.567 0.780 0.0
Q5R6E0972 116 kDa U5 small nuclear yes N/A 0.426 0.566 0.779 0.0
O94316984 Pre-mRNA-splicing factor yes N/A 0.447 0.587 0.529 0.0
Q5R8Z3858 Elongation factor 2 OS=Po no N/A 0.376 0.566 0.433 1e-123
P13639858 Elongation factor 2 OS=Ho no N/A 0.376 0.566 0.433 1e-123
P58252858 Elongation factor 2 OS=Mu no N/A 0.376 0.566 0.433 1e-123
P05197858 Elongation factor 2 OS=Ra no N/A 0.376 0.566 0.433 1e-123
>sp|Q5F3X4|U5S1_CHICK 116 kDa U5 small nuclear ribonucleoprotein component OS=Gallus gallus GN=EFTUD2 PE=2 SV=1 Back     alignment and function desciption
 Score =  954 bits (2465), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 461/589 (78%), Positives = 499/589 (84%), Gaps = 38/589 (6%)

Query: 703  KRFNAEKSLVEMCVKHIPSPAENAETKVSYMYTGPGDSDVARDMKACNPEGRLMVHSSKK 762
            K F      V+MCV+HIPSP                                      K 
Sbjct: 422  KFFGEFTGFVDMCVQHIPSP--------------------------------------KV 443

Query: 763  NAETKVSYMYTGPGDSDVARDMKACNPEGRLMVHSSKMYPTEECTFFQVLARVMSGTLHA 822
             A+TK+ + YTG  DSD+   M  C+P+G LM H++KMY T++   F    RV+SGT+HA
Sbjct: 444  GAKTKIEHTYTGGVDSDLGEAMSECDPDGPLMCHTTKMYSTDDGVQFHAFGRVLSGTIHA 503

Query: 823  GQEVRVLGENYSLMDEEDSRILTVGRLWIYEARYKVEVNRVPAGNWVLIEGIDQPIVKTS 882
            GQ V+VLGENY+L DEEDS+I TVGRLWI  ARY +EVNRVPAGNWVLIEG+DQPIVKT+
Sbjct: 504  GQPVKVLGENYTLEDEEDSQICTVGRLWISVARYHIEVNRVPAGNWVLIEGVDQPIVKTA 563

Query: 883  TITDLITNEDMYIFRPLKFNTQSVIKIAVEPVNPSELPKMLDGLRKVNKSYPLLTTKVEE 942
            T+T+   NE+  IFRPLKFNT SVIKIAVEPVNPSELPKMLDGLRKVNKSYP LTTKVEE
Sbjct: 564  TVTEPRGNEEAQIFRPLKFNTTSVIKIAVEPVNPSELPKMLDGLRKVNKSYPSLTTKVEE 623

Query: 943  SGEHVVLGTGELYLDCVMHDLRKMYSEIDIKVADPVVAFCETVVETSSLKCFAETPNKRN 1002
            SGEHV+LGTGELYLDCVMHDLRKMYSEIDIKVADPVV FCETVVETSSLKCFAETPNK+N
Sbjct: 624  SGEHVILGTGELYLDCVMHDLRKMYSEIDIKVADPVVTFCETVVETSSLKCFAETPNKKN 683

Query: 1003 KITMIAEPLEKGLAEDIENQIVHIAWNKKRLGEFFQSKYDWDLLAARSIWAFGPEVTGPN 1062
            KITMIAEPLEKGLAEDIEN++V I WN+K+LGEFFQ+KYDWDLLAARSIWAFGP+ TGPN
Sbjct: 684  KITMIAEPLEKGLAEDIENEVVQITWNRKKLGEFFQTKYDWDLLAARSIWAFGPDATGPN 743

Query: 1063 ILVDDTLPSEVDKGLLGSVKDSIVQGFQWGTREGPLCEEPIRNVKFKILDAVIATEPLHR 1122
            ILVDDTLPSEVDK LLGSVKDSIVQGFQWGTREGPLC+E IRNVKFKILDAVIA EPLHR
Sbjct: 744  ILVDDTLPSEVDKALLGSVKDSIVQGFQWGTREGPLCDELIRNVKFKILDAVIAQEPLHR 803

Query: 1123 GGGQIIPTARRVAYSAFLMATPRLMEPYLFVEVQAPADCVSAVYTVLAKRRGHVTQDAPV 1182
            GGGQIIPTARRV YSAFLMATPRLMEPY FVEVQAPADCVSAVYTVLA+RRGHVTQDAP+
Sbjct: 804  GGGQIIPTARRVVYSAFLMATPRLMEPYYFVEVQAPADCVSAVYTVLARRRGHVTQDAPI 863

Query: 1183 PGSPLYTIKAFIPAIDSFGFETDLRTHTQGQAFCLSVFHHWQIVPGDPLDKSIVIRPLEP 1242
            PGSPLYTIKAFIPAIDSFGFETDLRTHTQGQAF LSVFHHWQIVPGDPLDKSIVIRPLEP
Sbjct: 864  PGSPLYTIKAFIPAIDSFGFETDLRTHTQGQAFSLSVFHHWQIVPGDPLDKSIVIRPLEP 923

Query: 1243 QPATHLAREFMIKTRRRKGLSEDVSINKFFDDPMLLELARQDVMLNYPL 1291
            QPA HLAREFMIKTRRRKGLSEDVSI+KFFDDPMLLELA+QDV+LNYP+
Sbjct: 924  QPAPHLAREFMIKTRRRKGLSEDVSISKFFDDPMLLELAKQDVVLNYPM 972
Component of the U5 snRNP complex required for pre-mRNA splicing.
Gallus gallus (taxid: 9031)
>sp|A4FUD3|U5S1_BOVIN 116 kDa U5 small nuclear ribonucleoprotein component OS=Bos taurus GN=EFTUD2 PE=2 SV=1 Back     alignment and function description
>sp|Q15029|U5S1_HUMAN 116 kDa U5 small nuclear ribonucleoprotein component OS=Homo sapiens GN=EFTUD2 PE=1 SV=1 Back     alignment and function description
>sp|O08810|U5S1_MOUSE 116 kDa U5 small nuclear ribonucleoprotein component OS=Mus musculus GN=Eftud2 PE=2 SV=1 Back     alignment and function description
>sp|Q5R6E0|U5S1_PONAB 116 kDa U5 small nuclear ribonucleoprotein component OS=Pongo abelii GN=EFTUD2 PE=2 SV=1 Back     alignment and function description
>sp|O94316|SN114_SCHPO Pre-mRNA-splicing factor cwf10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf10 PE=1 SV=2 Back     alignment and function description
>sp|Q5R8Z3|EF2_PONAB Elongation factor 2 OS=Pongo abelii GN=EEF2 PE=2 SV=3 Back     alignment and function description
>sp|P13639|EF2_HUMAN Elongation factor 2 OS=Homo sapiens GN=EEF2 PE=1 SV=4 Back     alignment and function description
>sp|P58252|EF2_MOUSE Elongation factor 2 OS=Mus musculus GN=Eef2 PE=1 SV=2 Back     alignment and function description
>sp|P05197|EF2_RAT Elongation factor 2 OS=Rattus norvegicus GN=Eef2 PE=1 SV=4 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1291
156372518975 predicted protein [Nematostella vectensi 0.698 0.925 0.603 0.0
196002833968 hypothetical protein TRIADDRAFT_22861 [T 0.682 0.910 0.569 0.0
340369210978 PREDICTED: 116 kDa U5 small nuclear ribo 0.687 0.906 0.569 0.0
340369208966 PREDICTED: 116 kDa U5 small nuclear ribo 0.682 0.912 0.571 0.0
340369206985 PREDICTED: 116 kDa U5 small nuclear ribo 0.678 0.889 0.573 0.0
340369212970 PREDICTED: 116 kDa U5 small nuclear ribo 0.683 0.909 0.566 0.0
391348220977 PREDICTED: 116 kDa U5 small nuclear ribo 0.690 0.911 0.554 0.0
193618024975 PREDICTED: 116 kDa U5 small nuclear ribo 0.436 0.578 0.813 0.0
242021990974 116 kDa U5 small nuclear ribonucleoprote 0.421 0.558 0.847 0.0
189239832972 PREDICTED: similar to 116 kda U5 small n 0.410 0.545 0.891 0.0
>gi|156372518|ref|XP_001629084.1| predicted protein [Nematostella vectensis] gi|156216076|gb|EDO37021.1| predicted protein [Nematostella vectensis] Back     alignment and taxonomy information
 Score = 1154 bits (2985), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 624/1034 (60%), Positives = 727/1034 (70%), Gaps = 132/1034 (12%)

Query: 300  DEINGLLRYLLIDDDREDG-DEEMGDSQAVVLHEDKRYYPTAVEVFGPDVETVVQEEDTQ 358
            D++NG   Y   DDD E+  D++    Q +VLHEDK+YYPTA EV+GPDVET+VQEEDTQ
Sbjct: 32   DDLNG---YGDADDDEEEQMDQDDEPRQQIVLHEDKKYYPTAEEVYGPDVETLVQEEDTQ 88

Query: 359  ALSVPLIAPIKKKKFQLKEQDLPDTVYNMEFLADMMDTPHLIRNVALVGHLHHGKTTMID 418
             L+ P+I P+ KKKF   EQ+LP T YN+E+LAD+MD P LIRNVAL GHLH GKT  +D
Sbjct: 89   PLTDPIIKPVLKKKFSHAEQELPLTNYNIEYLADLMDNPELIRNVALAGHLHSGKTAFLD 148

Query: 419  CLIRQTHPGYRQPAEEKNLRYTDTLFTEQERGVSIKASPVTLLLPDVKGKNYLMNIFDTP 478
            CL  QTHP   +  E K LRYTD LFTEQERG+SIK++PV+L+L                
Sbjct: 149  CLFEQTHPEL-EAKEGKELRYTDLLFTEQERGLSIKSTPVSLVL---------------- 191

Query: 479  ASPVTLLLPDVKGKNYLMNIFDTPGMWDIHVRKFSKKAAHASAQRSFVEFVLEPVYKLVA 538
                    PD KGK+YL+NIFDTPG    HV  FS +   A              Y+L  
Sbjct: 192  --------PDTKGKSYLLNIFDTPG----HV-NFSDEVTAA--------------YRLCD 224

Query: 539  QVVGDVDSSLPAVL--DQLGIHMNKEESKINI------RPLLRL-------VYKVE--VN 581
             V+  +D+S   +L  ++L  H  +E   I I      R +L L        YK++  ++
Sbjct: 225  AVMIFIDASEGVMLNTERLLKHAVQENLAITICINKIDRLILELKLPPTDAYYKLKHVID 284

Query: 582  RVPAGNWVLIEGIDQPIVKTSTITDLITNEDITSNK----FLIDGFPRNQNNLDGWNKEM 637
             V     V  EG D  +     I+ L+ N    S+     F +  F +   +  G N + 
Sbjct: 285  EVNGLLSVFSEGADDLV-----ISPLLGNVCFASSSYHFCFTLLSFAKLYVDSFGGNIDP 339

Query: 638  ADKVELLYV-LFFDCPEDVCVRRCLKRGAEGS-----------------GRADDNEESLK 679
             D  + L+  ++F        R+     ++ S                 G  D       
Sbjct: 340  QDFAQRLWGDMYFSSKTRKFTRKAPLSTSQRSFVEFILEPMYKIFGQVVGDVDTTLPQAL 399

Query: 680  KRISVYNTETMPIIKFFEAKNLV-KRFNAE-KSLVEMCVKHIPSPAENAETKVSYMYTGP 737
              + ++ T+    +      +LV KRF  +    V++CV+HIPSP               
Sbjct: 400  DELGIHLTKKEMQMNIRPLLSLVCKRFFGDFAGFVDVCVQHIPSP--------------- 444

Query: 738  GDSDVARDMKACNPEGRLMVHSSKKNAETKVSYMYTGPGDSDVARDMKACNPEGRLMVHS 797
               DVA  M                     V + YTGP DSD+   M  C+P+G LMVH+
Sbjct: 445  --KDVAARM---------------------VEHNYTGPLDSDIVDAMNNCDPDGVLMVHT 481

Query: 798  SKMYPTEECTFFQVLARVMSGTLHAGQEVRVLGENYSLMDEEDSRILTVGRLWIYEARYK 857
            +K YP+++ T F V  RVMSGTL+AGQ+VR+LGENY++ DEEDSR+  VGRLWI EARY 
Sbjct: 482  TKQYPSQDATAFHVFGRVMSGTLYAGQQVRILGENYTMEDEEDSRVGIVGRLWIAEARYN 541

Query: 858  VEVNRVPAGNWVLIEGIDQPIVKTSTITDLITNEDMYIFRPLKFNTQSVIKIAVEPVNPS 917
            +EVNRVPAGNWVLIEG+DQPIVKT+TIT++  +E+ YIFRPLKFNT S IKIAVEP NPS
Sbjct: 542  IEVNRVPAGNWVLIEGVDQPIVKTATITEVQGSEEAYIFRPLKFNTCSTIKIAVEPHNPS 601

Query: 918  ELPKMLDGLRKVNKSYPLLTTKVEESGEHVVLGTGELYLDCVMHDLRKMYSEIDIKVADP 977
            ELPKMLDGLRKVNKSYPLLTTKVEESGEHV+LGTGELYLDC+MHDLR+MYSEIDIKVADP
Sbjct: 602  ELPKMLDGLRKVNKSYPLLTTKVEESGEHVILGTGELYLDCIMHDLRRMYSEIDIKVADP 661

Query: 978  VVAFCETVVETSSLKCFAETPNKRNKITMIAEPLEKGLAEDIENQIVHIAWNKKRLGEFF 1037
            V+AFCETVVETSSLKCFAETPNK+NK+TMIAEPLEKGLAEDIEN+ V I+WNKK+LGEFF
Sbjct: 662  VIAFCETVVETSSLKCFAETPNKKNKVTMIAEPLEKGLAEDIENEKVLISWNKKKLGEFF 721

Query: 1038 QSKYDWDLLAARSIWAFGPEVTGPNILVDDTLPSEVDKGLLGSVKDSIVQGFQWGTREGP 1097
            Q+KYDWDLLAARSIWAFGPE TGPNILVDDTLPSEVDK LL +VKDSI+QGFQW TREGP
Sbjct: 722  QTKYDWDLLAARSIWAFGPENTGPNILVDDTLPSEVDKSLLNTVKDSIIQGFQWATREGP 781

Query: 1098 LCEEPIRNVKFKILDAVIATEPLHRGGGQIIPTARRVAYSAFLMATPRLMEPYLFVEVQA 1157
            LC+EPIRNVKFKILDAVIA EP+HRGGGQIIPTARRVAYSAFLMATPRLMEPY FVEVQA
Sbjct: 782  LCDEPIRNVKFKILDAVIAGEPIHRGGGQIIPTARRVAYSAFLMATPRLMEPYFFVEVQA 841

Query: 1158 PADCVSAVYTVLAKRRGHVTQDAPVPGSPLYTIKAFIPAIDSFGFETDLRTHTQGQAFCL 1217
            PADCVS+VYTVLA+RRGHVTQDAPVPGSPLYTIKAFIPAIDSFGFETDLRTHTQGQAFCL
Sbjct: 842  PADCVSSVYTVLARRRGHVTQDAPVPGSPLYTIKAFIPAIDSFGFETDLRTHTQGQAFCL 901

Query: 1218 SVFHHWQIVPGDPLDKSIVIRPLEPQPATHLAREFMIKTRRRKGLSEDVSINKFFDDPML 1277
            SVFHHWQIVPGDPLDKSIVIRPLEPQPATHLAREFMIKTRRRKGLSEDVSINKFFDDPML
Sbjct: 902  SVFHHWQIVPGDPLDKSIVIRPLEPQPATHLAREFMIKTRRRKGLSEDVSINKFFDDPML 961

Query: 1278 LELARQDVMLNYPL 1291
            LELARQDVM NYP+
Sbjct: 962  LELARQDVMFNYPM 975

Source: Nematostella vectensis

Species: Nematostella vectensis

Genus: Nematostella

Family: Edwardsiidae

Order: Actiniaria

Class: Anthozoa

Phylum: Cnidaria

Superkingdom: Eukaryota
>gi|196002833|ref|XP_002111284.1| hypothetical protein TRIADDRAFT_22861 [Trichoplax adhaerens] gi|190587235|gb|EDV27288.1| hypothetical protein TRIADDRAFT_22861 [Trichoplax adhaerens] Back     alignment and taxonomy information
>gi|340369210|ref|XP_003383141.1| PREDICTED: 116 kDa U5 small nuclear ribonucleoprotein component-like isoform 3 [Amphimedon queenslandica] Back     alignment and taxonomy information
>gi|340369208|ref|XP_003383140.1| PREDICTED: 116 kDa U5 small nuclear ribonucleoprotein component-like isoform 2 [Amphimedon queenslandica] Back     alignment and taxonomy information
>gi|340369206|ref|XP_003383139.1| PREDICTED: 116 kDa U5 small nuclear ribonucleoprotein component-like isoform 1 [Amphimedon queenslandica] Back     alignment and taxonomy information
>gi|340369212|ref|XP_003383142.1| PREDICTED: 116 kDa U5 small nuclear ribonucleoprotein component-like isoform 4 [Amphimedon queenslandica] Back     alignment and taxonomy information
>gi|391348220|ref|XP_003748347.1| PREDICTED: 116 kDa U5 small nuclear ribonucleoprotein component-like [Metaseiulus occidentalis] Back     alignment and taxonomy information
>gi|193618024|ref|XP_001950544.1| PREDICTED: 116 kDa U5 small nuclear ribonucleoprotein component-like isoform 3 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|242021990|ref|XP_002431425.1| 116 kDa U5 small nuclear ribonucleoprotein component, putative [Pediculus humanus corporis] gi|212516706|gb|EEB18687.1| 116 kDa U5 small nuclear ribonucleoprotein component, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|189239832|ref|XP_972595.2| PREDICTED: similar to 116 kda U5 small nuclear ribonucleoprotein component [Tribolium castaneum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1291
FB|FBgn0039566975 CG4849 [Drosophila melanogaste 0.414 0.548 0.872 0.0
ZFIN|ZDB-GENE-040426-1569973 eftud2 "elongation factor Tu G 0.414 0.549 0.844 0.0
UNIPROTKB|Q5F3X4972 EFTUD2 "116 kDa U5 small nucle 0.414 0.550 0.842 0.0
MGI|MGI:1336880971 Eftud2 "elongation factor Tu G 0.414 0.550 0.841 0.0
UNIPROTKB|F1LM66972 Eftud2 "Protein Eftud2" [Rattu 0.414 0.550 0.841 0.0
UNIPROTKB|F1N6D5972 EFTUD2 "116 kDa U5 small nucle 0.414 0.550 0.841 0.0
UNIPROTKB|F1PUB9972 EFTUD2 "Uncharacterized protei 0.414 0.550 0.841 0.0
UNIPROTKB|Q15029972 EFTUD2 "116 kDa U5 small nucle 0.414 0.550 0.841 0.0
UNIPROTKB|F1RQZ9972 EFTUD2 "Uncharacterized protei 0.414 0.550 0.841 0.0
UNIPROTKB|G1K2Y5974 EFTUD2 "116 kDa U5 small nucle 0.414 0.549 0.839 0.0
FB|FBgn0039566 CG4849 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 2476 (876.7 bits), Expect = 0., Sum P(4) = 0.
 Identities = 467/535 (87%), Positives = 501/535 (93%)

Query:   757 VHSSKKNAETKVSYMYTGPGDSDVARDMKACNPEGRLMVHSSKMYPTEECTFFQVLARVM 816
             + S  +NA+ KV ++YTGP + D+ RDM +CN  G LMVHSSKMYP ++CTFFQVLAR++
Sbjct:   441 IKSPLENAKRKVDHIYTGPKEGDIYRDMISCNQYGTLMVHSSKMYPNDDCTFFQVLARIV 500

Query:   817 SGTLHAGQEVRVLGENYSLMDEEDSRILTVGRLWIYEARYKVEVNRVPAGNWVLIEGIDQ 876
             SGTLHAGQEVRVLGENY+L DEEDSRIL VGRLW++E+RYKVE+NRVPAGNWVLIEGIDQ
Sbjct:   501 SGTLHAGQEVRVLGENYTLQDEEDSRILQVGRLWVFESRYKVELNRVPAGNWVLIEGIDQ 560

Query:   877 PIVKTSTITDLITNEDMYIFRPLKFNTQSVIKIAVEPVNPSELPKMLDGLRKVNKSYPLL 936
              IVKTSTI D+   ED+YIFRPLKFNTQS+IKIAVEPVNPSELPKMLDGLRKVNKSYPLL
Sbjct:   561 CIVKTSTIVDINVPEDLYIFRPLKFNTQSIIKIAVEPVNPSELPKMLDGLRKVNKSYPLL 620

Query:   937 TTKVEESGEHVVLGTGELYLDCVMHDLRKMYSEIDIKVADPVVAFCETVVETSSLKCFAE 996
             +T+VEESGEHV+LGTGELYLDCVMHDLRKMYSEIDIKVADPVVAFCETVVETSSLKCFAE
Sbjct:   621 STRVEESGEHVILGTGELYLDCVMHDLRKMYSEIDIKVADPVVAFCETVVETSSLKCFAE 680

Query:   997 TPNKRNKITMIAEPLEKGLAEDIENQIVHIAWNKKRLGEFFQSKYDWDLLAARSIWAFGP 1056
             TPNK+NKITMI+EPLEKGLAEDIEN  V I WNKKR+GEFFQ  YDWDLLAARSIWAFGP
Sbjct:   681 TPNKKNKITMISEPLEKGLAEDIENGTVCINWNKKRIGEFFQVNYDWDLLAARSIWAFGP 740

Query:  1057 EVTGPNILVDDTLPSEVDKGLLGSVKDSIVQGFQWGTREGPLCEEPIRNVKFKILDAVIA 1116
             + TGPNILVDDTLPSEVDK LL +VKDSIVQGFQWGTREGPLCEEPIRNVKFKILD VIA
Sbjct:   741 DSTGPNILVDDTLPSEVDKNLLTAVKDSIVQGFQWGTREGPLCEEPIRNVKFKILDGVIA 800

Query:  1117 TEPLHRGGGQIIPTARRVAYSAFLMATPRLMEPYLFVEVQAPADCVSAVYTVLAKRRGHV 1176
              E LHRGGGQIIPTARRVAYSAFLMATPRLMEPYLFVEVQAPADCVSAVYTVLA+RRGHV
Sbjct:   801 NEALHRGGGQIIPTARRVAYSAFLMATPRLMEPYLFVEVQAPADCVSAVYTVLARRRGHV 860

Query:  1177 TQDAPVPGSPLYTIKAFIPAIDSFGFETDLRTHTQGQAFCLSVFHHWQIVPGDPLDKSIV 1236
             TQDAPV GSP+YTIKAFIPAIDSFGFETDLRTHTQGQAFCLSVFHHWQIVPGDPLDKSI+
Sbjct:   861 TQDAPVSGSPIYTIKAFIPAIDSFGFETDLRTHTQGQAFCLSVFHHWQIVPGDPLDKSII 920

Query:  1237 IRPLEPQPATHLAREFMIKTRRRKGLSEDVSINKFFDDPMLLELARQDVMLNYPL 1291
             IRPLEPQ A+HLAREFMIKTRRRKGLSEDVSINKFFDDPMLLELARQDV++NYPL
Sbjct:   921 IRPLEPQQASHLAREFMIKTRRRKGLSEDVSINKFFDDPMLLELARQDVLINYPL 975
GO:0005829 "cytosol" evidence=ISS
GO:0003746 "translation elongation factor activity" evidence=ISS
GO:0006414 "translational elongation" evidence=ISS
GO:0030532 "small nuclear ribonucleoprotein complex" evidence=ISS
GO:0000398 "mRNA splicing, via spliceosome" evidence=IC;ISS
GO:0005682 "U5 snRNP" evidence=ISS
GO:0005525 "GTP binding" evidence=IEA
GO:0003924 "GTPase activity" evidence=IEA
GO:0071013 "catalytic step 2 spliceosome" evidence=IDA
GO:0071011 "precatalytic spliceosome" evidence=IDA
ZFIN|ZDB-GENE-040426-1569 eftud2 "elongation factor Tu GTP binding domain containing 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q5F3X4 EFTUD2 "116 kDa U5 small nuclear ribonucleoprotein component" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:1336880 Eftud2 "elongation factor Tu GTP binding domain containing 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1LM66 Eftud2 "Protein Eftud2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1N6D5 EFTUD2 "116 kDa U5 small nuclear ribonucleoprotein component" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PUB9 EFTUD2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q15029 EFTUD2 "116 kDa U5 small nuclear ribonucleoprotein component" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RQZ9 EFTUD2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|G1K2Y5 EFTUD2 "116 kDa U5 small nuclear ribonucleoprotein component" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q5R6E0U5S1_PONABNo assigned EC number0.77920.42680.5668yesN/A
Q15029U5S1_HUMANNo assigned EC number0.78090.42680.5668yesN/A
A4FUD3U5S1_BOVINNo assigned EC number0.78090.42680.5668yesN/A
Q5F3X4U5S1_CHICKNo assigned EC number0.78260.42680.5668yesN/A
O94316SN114_SCHPONo assigned EC number0.52960.44770.5873yesN/A
O08810U5S1_MOUSENo assigned EC number0.78090.42680.5674yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.7.4LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1291
PTZ00416836 PTZ00416, PTZ00416, elongation factor 2; Provision 1e-174
PLN00116843 PLN00116, PLN00116, translation elongation factor 1e-158
cd01683178 cd01683, EF2_IV_snRNP, EF-2_domain IV_snRNP domain 1e-112
cd01681177 cd01681, aeEF2_snRNP_like_IV, This family represen 1e-93
COG0480697 COG0480, FusA, Translation elongation factors (GTP 4e-89
PRK07560731 PRK07560, PRK07560, elongation factor EF-2; Review 3e-88
cd01683178 cd01683, EF2_IV_snRNP, EF-2_domain IV_snRNP domain 4e-83
cd01681177 cd01681, aeEF2_snRNP_like_IV, This family represen 3e-68
TIGR00490720 TIGR00490, aEF-2, translation elongation factor aE 1e-63
PTZ00416836 PTZ00416, PTZ00416, elongation factor 2; Provision 2e-55
cd0409880 cd04098, eEF2_C_snRNP, eEF2_C_snRNP: This family i 1e-49
PLN00116843 PLN00116, PLN00116, translation elongation factor 4e-49
cd0409094 cd04090, eEF2_II_snRNP, Loc2 eEF2_C_snRNP, cd01514 3e-48
cd04167213 cd04167, Snu114p, Snu114p, a spliceosome protein, 4e-45
cd0409680 cd04096, eEF2_snRNP_like_C, eEF2_snRNP_like_C: thi 6e-44
TIGR01359183 TIGR01359, UMP_CMP_kin_fam, UMP-CMP kinase family 6e-42
cd0370093 cd03700, eEF2_snRNP_like_II, EF2_snRNP_like_II: th 7e-38
cd01885218 cd01885, EF2, Elongation Factor 2 (EF2) in archaea 6e-31
cd04167213 cd04167, Snu114p, Snu114p, a spliceosome protein, 2e-30
pfam03764120 pfam03764, EFG_IV, Elongation factor G, domain IV 6e-28
smart00889120 smart00889, EFG_IV, Elongation factor G, domain IV 1e-27
cd0151479 cd01514, Elongation_Factor_C, Elongation factor G 2e-27
cd01428194 cd01428, ADK, Adenylate kinase (ADK) catalyzes the 1e-26
PRK07560731 PRK07560, PRK07560, elongation factor EF-2; Review 2e-26
pfam0067989 pfam00679, EFG_C, Elongation factor G C-terminus 2e-25
PRK12740668 PRK12740, PRK12740, elongation factor G; Reviewed 2e-25
PTZ00416836 PTZ00416, PTZ00416, elongation factor 2; Provision 4e-22
COG0480697 COG0480, FusA, Translation elongation factors (GTP 4e-22
pfam00406186 pfam00406, ADK, Adenylate kinase 3e-21
PRK07560731 PRK07560, PRK07560, elongation factor EF-2; Review 1e-20
PRK13351687 PRK13351, PRK13351, elongation factor G; Reviewed 3e-20
TIGR01360188 TIGR01360, aden_kin_iso1, adenylate kinase, isozym 4e-20
COG0480697 COG0480, FusA, Translation elongation factors (GTP 5e-20
TIGR00484689 TIGR00484, EF-G, translation elongation factor EF- 9e-20
cd00881183 cd00881, GTP_translation_factor, GTP translation f 3e-19
pfam00009184 pfam00009, GTP_EFTU, Elongation factor Tu GTP bind 4e-19
smart00889120 smart00889, EFG_IV, Elongation factor G, domain IV 6e-19
PRK00279215 PRK00279, adk, adenylate kinase; Reviewed 8e-19
TIGR00490720 TIGR00490, aEF-2, translation elongation factor aE 7e-18
PRK12739691 PRK12739, PRK12739, elongation factor G; Reviewed 7e-18
TIGR00490720 TIGR00490, aEF-2, translation elongation factor aE 1e-17
pfam03764120 pfam03764, EFG_IV, Elongation factor G, domain IV 2e-17
PLN00116843 PLN00116, PLN00116, translation elongation factor 4e-17
smart0083885 smart00838, EFG_C, Elongation factor G C-terminus 4e-17
PLN02200234 PLN02200, PLN02200, adenylate kinase family protei 1e-16
pfam00009184 pfam00009, GTP_EFTU, Elongation factor Tu GTP bind 2e-16
TIGR01351210 TIGR01351, adk, adenylate kinase 1e-15
cd01890179 cd01890, LepA, LepA also known as Elongation Facto 3e-15
cd00881183 cd00881, GTP_translation_factor, GTP translation f 1e-14
PRK14528186 PRK14528, PRK14528, adenylate kinase; Provisional 1e-14
cd01680116 cd01680, EFG_like_IV, Elongation Factor G-like dom 3e-14
cd0409094 cd04090, eEF2_II_snRNP, Loc2 eEF2_C_snRNP, cd01514 2e-13
cd01885218 cd01885, EF2, Elongation Factor 2 (EF2) in archaea 2e-13
PRK14527191 PRK14527, PRK14527, adenylate kinase; Provisional 2e-13
PRK02496184 PRK02496, adk, adenylate kinase; Provisional 1e-12
cd01891194 cd01891, TypA_BipA, Tyrosine phosphorylated protei 1e-12
COG0481603 COG0481, LepA, Membrane GTPase LepA [Cell envelope 4e-12
cd01891194 cd01891, TypA_BipA, Tyrosine phosphorylated protei 6e-12
PLN00116843 PLN00116, PLN00116, translation elongation factor 9e-12
PTZ00416836 PTZ00416, PTZ00416, elongation factor 2; Provision 2e-11
PRK07560731 PRK07560, PRK07560, elongation factor EF-2; Review 2e-11
cd0371378 cd03713, EFG_mtEFG_C, EFG_mtEFG_C: domains similar 2e-11
COG0563178 COG0563, Adk, Adenylate kinase and related kinases 3e-11
PRK14531183 PRK14531, PRK14531, adenylate kinase; Provisional 3e-11
TIGR01393595 TIGR01393, lepA, GTP-binding protein LepA 4e-11
COG0480697 COG0480, FusA, Translation elongation factors (GTP 2e-10
TIGR01394594 TIGR01394, TypA_BipA, GTP-binding protein TypA/Bip 6e-10
PRK14532188 PRK14532, PRK14532, adenylate kinase; Provisional 2e-09
COG1217603 COG1217, TypA, Predicted membrane GTPase involved 2e-09
COG1217603 COG1217, TypA, Predicted membrane GTPase involved 7e-09
TIGR01394594 TIGR01394, TypA_BipA, GTP-binding protein TypA/Bip 8e-09
cd0371178 cd03711, Tet_C, Tet_C: C-terminus of ribosomal pro 9e-09
PRK05433600 PRK05433, PRK05433, GTP-binding protein LepA; Prov 9e-09
PRK13351687 PRK13351, PRK13351, elongation factor G; Reviewed 2e-08
TIGR00490720 TIGR00490, aEF-2, translation elongation factor aE 3e-08
cd04170268 cd04170, EF-G_bact, Elongation factor G (EF-G) fam 3e-08
PRK12740668 PRK12740, PRK12740, elongation factor G; Reviewed 4e-08
cd0370093 cd03700, eEF2_snRNP_like_II, EF2_snRNP_like_II: th 8e-08
cd01890179 cd01890, LepA, LepA also known as Elongation Facto 2e-07
cd01680116 cd01680, EFG_like_IV, Elongation Factor G-like dom 5e-07
PRK10218607 PRK10218, PRK10218, GTP-binding protein; Provision 7e-07
TIGR01393595 TIGR01393, lepA, GTP-binding protein LepA 8e-07
PRK00007693 PRK00007, PRK00007, elongation factor G; Reviewed 9e-07
cd04168237 cd04168, TetM_like, Tet(M)-like family includes Te 4e-06
cd0409778 cd04097, mtEFG1_C, mtEFG1_C: C-terminus of mitocho 6e-06
cd01887169 cd01887, IF2_eIF5B, Initiation Factor 2 (IF2)/ euk 9e-06
PRK14530215 PRK14530, PRK14530, adenylate kinase; Provisional 1e-05
cd01886270 cd01886, EF-G, Elongation factor G (EF-G) family i 1e-05
cd0134283 cd01342, Translation_Factor_II_like, Translation_F 3e-05
pfam0314470 pfam03144, GTP_EFTU_D2, Elongation factor Tu domai 4e-05
PRK14526211 PRK14526, PRK14526, adenylate kinase; Provisional 4e-05
PRK13351687 PRK13351, PRK13351, elongation factor G; Reviewed 5e-05
COG0481603 COG0481, LepA, Membrane GTPase LepA [Cell envelope 5e-05
PRK13808333 PRK13808, PRK13808, adenylate kinase; Provisional 5e-05
TIGR00484689 TIGR00484, EF-G, translation elongation factor EF- 6e-05
cd0369186 cd03691, BipA_TypA_II, BipA_TypA_II: domain II of 1e-04
PRK10218607 PRK10218, PRK10218, GTP-binding protein; Provision 2e-04
PRK05433600 PRK05433, PRK05433, GTP-binding protein LepA; Prov 3e-04
COG0532509 COG0532, InfB, Translation initiation factor 2 (IF 3e-04
PLN02459261 PLN02459, PLN02459, probable adenylate kinase 3e-04
PTZ00416836 PTZ00416, PTZ00416, elongation factor 2; Provision 0.001
PRK00007693 PRK00007, PRK00007, elongation factor G; Reviewed 0.001
PRK12317425 PRK12317, PRK12317, elongation factor 1-alpha; Rev 0.001
COG5256428 COG5256, TEF1, Translation elongation factor EF-1a 0.001
PTZ00416836 PTZ00416, PTZ00416, elongation factor 2; Provision 0.003
TIGR01394594 TIGR01394, TypA_BipA, GTP-binding protein TypA/Bip 0.004
cd04163168 cd04163, Era, E 0.004
>gnl|CDD|240409 PTZ00416, PTZ00416, elongation factor 2; Provisional Back     alignment and domain information 
 Score =  538 bits (1387), Expect = e-174
 Identities = 241/610 (39%), Positives = 339/610 (55%), Gaps = 67/610 (10%)

Query: 672  DDNEESLKKRISVYNTETMPIIKFFEAKNLVKR-----FNAEKSLVEMCVKHIPSPAENA 726
            ++++E   K +   N       K    K L+K        A  +L+EM V H+PSP E  
Sbjct: 284  NEDKEKYDKMLKSLNISLTGEDKELTGKPLLKAVMQKWLPAADTLLEMIVDHLPSPKEAQ 343

Query: 727  ETKVSYMYTGPGDSDVARDMKACNPEGRLMVHSSKKNAETKVSYMYTGPGDSDVARDMKA 786
            + +V  +Y GP D + A  ++ C+P G LM              MY              
Sbjct: 344  KYRVENLYEGPMDDEAANAIRNCDPNGPLM--------------MYI------------- 376

Query: 787  CNPEGRLMVHSSKMYPTEECTFFQVLARVMSGTLHAGQEVRVLGENYSLMDEEDSRILTV 846
                       SKM PT +   F    RV SGT+  GQ+VR+ G NY    +ED     +
Sbjct: 377  -----------SKMVPTSDKGRFYAFGRVFSGTVATGQKVRIQGPNYVPGKKEDLFEKNI 425

Query: 847  GRLWIYEARYKVEVNRVPAGNWVLIEGIDQPIVKTSTITDLITNEDMYIFRPLKFNTQSV 906
             R  +   RY  ++  VP GN V + G+DQ +VK+ TIT   T+E  +  R +K++   V
Sbjct: 426  QRTVLMMGRYVEQIEDVPCGNTVGLVGVDQYLVKSGTIT---TSETAHNIRDMKYSVSPV 482

Query: 907  IKIAVEPVNPSELPKMLDGLRKVNKSYPLLTTKVEESGEHVVLGTGELYLDCVMHDLRKM 966
            +++AVEP NP +LPK+++GL+++ KS PL+    EESGEH+V G GEL+++  + DL   
Sbjct: 483  VRVAVEPKNPKDLPKLVEGLKRLAKSDPLVVCTTEESGEHIVAGCGELHVEICLKDLEDD 542

Query: 967  YSEIDIKVADPVVAFCETVVETSSLKCFAETPNKRNKITMIAEPLEKGLAEDIENQIVHI 1026
            Y+ IDI V+DPVV++ ETV E SS  C +++PNK N++ M AEPL + LAE IE   V  
Sbjct: 543  YANIDIIVSDPVVSYRETVTEESSQTCLSKSPNKHNRLYMKAEPLTEELAEAIEEGKVGP 602

Query: 1027 AWNKKRLGEFFQSKYDWDLLAARSIWAFGPEVTGPNILVDDTLPSEVDKGL--LGSVKDS 1084
              + K    F   KY+WD   AR IW FGPE  GPN+LVD T      KG+  +  +KDS
Sbjct: 603  EDDPKERANFLADKYEWDKNDARKIWCFGPENKGPNVLVDVT------KGVQYMNEIKDS 656

Query: 1085 IVQGFQWGTREGPLCEEPIRNVKFKILDAVIATEPLHRGGGQIIPTARRVAYSAFLMATP 1144
             V  FQW T+EG LC+E +R ++F ILD  +  + +HRG GQIIPTARRV Y+  L A+P
Sbjct: 657  CVSAFQWATKEGVLCDENMRGIRFNILDVTLHADAIHRGAGQIIPTARRVFYACELTASP 716

Query: 1145 RLMEPYLFVEVQAPADCVSAVYTVLAKRRGHVTQDAPVPGSPLYTIKAFIPAIDSFGFET 1204
            RL+EP   V++ AP D +  +Y+VL +RRG V  +   PG+PL  IKA++P  +SFGF  
Sbjct: 717  RLLEPMFLVDITAPEDAMGGIYSVLNRRRGVVIGEEQRPGTPLSNIKAYLPVAESFGFTA 776

Query: 1205 DLRTHTQGQAFCLSVFHHWQIVPGDPLDKSIVIRPLEPQPATHLAREFMIKTRRRKGLSE 1264
             LR  T GQAF   VF HWQ+VPGDPL+                A E ++  R+RKGL  
Sbjct: 777  ALRAATSGQAFPQCVFDHWQVVPGDPLEPG------------SKANEIVLSIRKRKGLKP 824

Query: 1265 DV-SINKFFD 1273
            ++  ++ + D
Sbjct: 825  EIPDLDNYLD 834

Length = 836
>gnl|CDD|177730 PLN00116, PLN00116, translation elongation factor EF-2 subunit; Provisional Back     alignment and domain information
>gnl|CDD|238840 cd01683, EF2_IV_snRNP, EF-2_domain IV_snRNP domain is a part of 116kD U5-specific protein of the U5 small nucleoprotein (snRNP) particle, essential component of the spliceosome Back     alignment and domain information
>gnl|CDD|238839 cd01681, aeEF2_snRNP_like_IV, This family represents domain IV of archaeal and eukaryotic elongation factor 2 (aeEF-2) and of an evolutionarily conserved U5 snRNP-specific protein Back     alignment and domain information
>gnl|CDD|223556 COG0480, FusA, Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|236047 PRK07560, PRK07560, elongation factor EF-2; Reviewed Back     alignment and domain information
>gnl|CDD|238840 cd01683, EF2_IV_snRNP, EF-2_domain IV_snRNP domain is a part of 116kD U5-specific protein of the U5 small nucleoprotein (snRNP) particle, essential component of the spliceosome Back     alignment and domain information
>gnl|CDD|238839 cd01681, aeEF2_snRNP_like_IV, This family represents domain IV of archaeal and eukaryotic elongation factor 2 (aeEF-2) and of an evolutionarily conserved U5 snRNP-specific protein Back     alignment and domain information
>gnl|CDD|129581 TIGR00490, aEF-2, translation elongation factor aEF-2 Back     alignment and domain information
>gnl|CDD|240409 PTZ00416, PTZ00416, elongation factor 2; Provisional Back     alignment and domain information
>gnl|CDD|239765 cd04098, eEF2_C_snRNP, eEF2_C_snRNP: This family includes a C-terminal portion of the spliceosomal human 116kD U5 small nuclear ribonucleoprotein (snRNP) protein (U5-116 kD) and, its yeast counterpart Snu114p Back     alignment and domain information
>gnl|CDD|177730 PLN00116, PLN00116, translation elongation factor EF-2 subunit; Provisional Back     alignment and domain information
>gnl|CDD|239757 cd04090, eEF2_II_snRNP, Loc2 eEF2_C_snRNP, cd01514/C terminal domain:eEF2_C_snRNP: This family includes C-terminal portion of the spliceosomal human 116kD U5 small nuclear ribonucleoprotein (snRNP) protein (U5-116 kD) and, its yeast counterpart Snu114p Back     alignment and domain information
>gnl|CDD|206730 cd04167, Snu114p, Snu114p, a spliceosome protein, is a GTPase Back     alignment and domain information
>gnl|CDD|239763 cd04096, eEF2_snRNP_like_C, eEF2_snRNP_like_C: this family represents a C-terminal domain of eukaryotic elongation factor 2 (eEF-2) and a homologous domain of the spliceosomal human 116kD U5 small nuclear ribonucleoprotein (snRNP) protein (U5-116 kD) and, its yeast counterpart Snu114p Back     alignment and domain information
>gnl|CDD|130426 TIGR01359, UMP_CMP_kin_fam, UMP-CMP kinase family Back     alignment and domain information
>gnl|CDD|239671 cd03700, eEF2_snRNP_like_II, EF2_snRNP_like_II: this subfamily represents domain II of elongation factor (EF) EF-2 found eukaryotes and archaea and, the C-terminal portion of the spliceosomal human 116kD U5 small nuclear ribonucleoprotein (snRNP) protein (U5-116 kD) and, its yeast counterpart Snu114p Back     alignment and domain information
>gnl|CDD|206672 cd01885, EF2, Elongation Factor 2 (EF2) in archaea and eukarya Back     alignment and domain information
>gnl|CDD|206730 cd04167, Snu114p, Snu114p, a spliceosome protein, is a GTPase Back     alignment and domain information
>gnl|CDD|202760 pfam03764, EFG_IV, Elongation factor G, domain IV Back     alignment and domain information
>gnl|CDD|214887 smart00889, EFG_IV, Elongation factor G, domain IV Back     alignment and domain information
>gnl|CDD|238772 cd01514, Elongation_Factor_C, Elongation factor G C-terminus Back     alignment and domain information
>gnl|CDD|238713 cd01428, ADK, Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>gnl|CDD|236047 PRK07560, PRK07560, elongation factor EF-2; Reviewed Back     alignment and domain information
>gnl|CDD|201388 pfam00679, EFG_C, Elongation factor G C-terminus Back     alignment and domain information
>gnl|CDD|237186 PRK12740, PRK12740, elongation factor G; Reviewed Back     alignment and domain information
>gnl|CDD|240409 PTZ00416, PTZ00416, elongation factor 2; Provisional Back     alignment and domain information
>gnl|CDD|223556 COG0480, FusA, Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|201213 pfam00406, ADK, Adenylate kinase Back     alignment and domain information
>gnl|CDD|236047 PRK07560, PRK07560, elongation factor EF-2; Reviewed Back     alignment and domain information
>gnl|CDD|237358 PRK13351, PRK13351, elongation factor G; Reviewed Back     alignment and domain information
>gnl|CDD|130427 TIGR01360, aden_kin_iso1, adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>gnl|CDD|223556 COG0480, FusA, Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|129575 TIGR00484, EF-G, translation elongation factor EF-G Back     alignment and domain information
>gnl|CDD|206647 cd00881, GTP_translation_factor, GTP translation factor family primarily contains translation initiation, elongation and release factors Back     alignment and domain information
>gnl|CDD|215653 pfam00009, GTP_EFTU, Elongation factor Tu GTP binding domain Back     alignment and domain information
>gnl|CDD|214887 smart00889, EFG_IV, Elongation factor G, domain IV Back     alignment and domain information
>gnl|CDD|234711 PRK00279, adk, adenylate kinase; Reviewed Back     alignment and domain information
>gnl|CDD|129581 TIGR00490, aEF-2, translation elongation factor aEF-2 Back     alignment and domain information
>gnl|CDD|237185 PRK12739, PRK12739, elongation factor G; Reviewed Back     alignment and domain information
>gnl|CDD|129581 TIGR00490, aEF-2, translation elongation factor aEF-2 Back     alignment and domain information
>gnl|CDD|202760 pfam03764, EFG_IV, Elongation factor G, domain IV Back     alignment and domain information
>gnl|CDD|177730 PLN00116, PLN00116, translation elongation factor EF-2 subunit; Provisional Back     alignment and domain information
>gnl|CDD|197906 smart00838, EFG_C, Elongation factor G C-terminus Back     alignment and domain information
>gnl|CDD|215125 PLN02200, PLN02200, adenylate kinase family protein Back     alignment and domain information
>gnl|CDD|215653 pfam00009, GTP_EFTU, Elongation factor Tu GTP binding domain Back     alignment and domain information
>gnl|CDD|233369 TIGR01351, adk, adenylate kinase Back     alignment and domain information
>gnl|CDD|206677 cd01890, LepA, LepA also known as Elongation Factor 4 (EF4) Back     alignment and domain information
>gnl|CDD|206647 cd00881, GTP_translation_factor, GTP translation factor family primarily contains translation initiation, elongation and release factors Back     alignment and domain information
>gnl|CDD|172994 PRK14528, PRK14528, adenylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|238838 cd01680, EFG_like_IV, Elongation Factor G-like domain IV Back     alignment and domain information
>gnl|CDD|239757 cd04090, eEF2_II_snRNP, Loc2 eEF2_C_snRNP, cd01514/C terminal domain:eEF2_C_snRNP: This family includes C-terminal portion of the spliceosomal human 116kD U5 small nuclear ribonucleoprotein (snRNP) protein (U5-116 kD) and, its yeast counterpart Snu114p Back     alignment and domain information
>gnl|CDD|206672 cd01885, EF2, Elongation Factor 2 (EF2) in archaea and eukarya Back     alignment and domain information
>gnl|CDD|237745 PRK14527, PRK14527, adenylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|179433 PRK02496, adk, adenylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|206678 cd01891, TypA_BipA, Tyrosine phosphorylated protein A (TypA)/BipA family belongs to ribosome-binding GTPases Back     alignment and domain information
>gnl|CDD|223557 COG0481, LepA, Membrane GTPase LepA [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|206678 cd01891, TypA_BipA, Tyrosine phosphorylated protein A (TypA)/BipA family belongs to ribosome-binding GTPases Back     alignment and domain information
>gnl|CDD|177730 PLN00116, PLN00116, translation elongation factor EF-2 subunit; Provisional Back     alignment and domain information
>gnl|CDD|240409 PTZ00416, PTZ00416, elongation factor 2; Provisional Back     alignment and domain information
>gnl|CDD|236047 PRK07560, PRK07560, elongation factor EF-2; Reviewed Back     alignment and domain information
>gnl|CDD|239683 cd03713, EFG_mtEFG_C, EFG_mtEFG_C: domains similar to the C-terminal domain of the bacterial translational elongation factor (EF) EF-G Back     alignment and domain information
>gnl|CDD|223637 COG0563, Adk, Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|172997 PRK14531, PRK14531, adenylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|130460 TIGR01393, lepA, GTP-binding protein LepA Back     alignment and domain information
>gnl|CDD|223556 COG0480, FusA, Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|233394 TIGR01394, TypA_BipA, GTP-binding protein TypA/BipA Back     alignment and domain information
>gnl|CDD|184729 PRK14532, PRK14532, adenylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|224138 COG1217, TypA, Predicted membrane GTPase involved in stress response [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|224138 COG1217, TypA, Predicted membrane GTPase involved in stress response [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|233394 TIGR01394, TypA_BipA, GTP-binding protein TypA/BipA Back     alignment and domain information
>gnl|CDD|239682 cd03711, Tet_C, Tet_C: C-terminus of ribosomal protection proteins Tet(M) and Tet(O) Back     alignment and domain information
>gnl|CDD|235462 PRK05433, PRK05433, GTP-binding protein LepA; Provisional Back     alignment and domain information
>gnl|CDD|237358 PRK13351, PRK13351, elongation factor G; Reviewed Back     alignment and domain information
>gnl|CDD|129581 TIGR00490, aEF-2, translation elongation factor aEF-2 Back     alignment and domain information
>gnl|CDD|206733 cd04170, EF-G_bact, Elongation factor G (EF-G) family Back     alignment and domain information
>gnl|CDD|237186 PRK12740, PRK12740, elongation factor G; Reviewed Back     alignment and domain information
>gnl|CDD|239671 cd03700, eEF2_snRNP_like_II, EF2_snRNP_like_II: this subfamily represents domain II of elongation factor (EF) EF-2 found eukaryotes and archaea and, the C-terminal portion of the spliceosomal human 116kD U5 small nuclear ribonucleoprotein (snRNP) protein (U5-116 kD) and, its yeast counterpart Snu114p Back     alignment and domain information
>gnl|CDD|206677 cd01890, LepA, LepA also known as Elongation Factor 4 (EF4) Back     alignment and domain information
>gnl|CDD|238838 cd01680, EFG_like_IV, Elongation Factor G-like domain IV Back     alignment and domain information
>gnl|CDD|104396 PRK10218, PRK10218, GTP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|130460 TIGR01393, lepA, GTP-binding protein LepA Back     alignment and domain information
>gnl|CDD|234569 PRK00007, PRK00007, elongation factor G; Reviewed Back     alignment and domain information
>gnl|CDD|206731 cd04168, TetM_like, Tet(M)-like family includes Tet(M), Tet(O), Tet(W), and OtrA, containing tetracycline resistant proteins Back     alignment and domain information
>gnl|CDD|239764 cd04097, mtEFG1_C, mtEFG1_C: C-terminus of mitochondrial Elongation factor G1 (mtEFG1)-like proteins found in eukaryotes Back     alignment and domain information
>gnl|CDD|206674 cd01887, IF2_eIF5B, Initiation Factor 2 (IF2)/ eukaryotic Initiation Factor 5B (eIF5B) family Back     alignment and domain information
>gnl|CDD|237747 PRK14530, PRK14530, adenylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|206673 cd01886, EF-G, Elongation factor G (EF-G) family involved in both the elongation and ribosome recycling phases of protein synthesis Back     alignment and domain information
>gnl|CDD|238652 cd01342, Translation_Factor_II_like, Translation_Factor_II_like: Elongation factor Tu (EF-Tu) domain II-like proteins Back     alignment and domain information
>gnl|CDD|217388 pfam03144, GTP_EFTU_D2, Elongation factor Tu domain 2 Back     alignment and domain information
>gnl|CDD|172992 PRK14526, PRK14526, adenylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|237358 PRK13351, PRK13351, elongation factor G; Reviewed Back     alignment and domain information
>gnl|CDD|223557 COG0481, LepA, Membrane GTPase LepA [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|172341 PRK13808, PRK13808, adenylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|129575 TIGR00484, EF-G, translation elongation factor EF-G Back     alignment and domain information
>gnl|CDD|239662 cd03691, BipA_TypA_II, BipA_TypA_II: domain II of BipA (also called TypA) having homology to domain II of the elongation factors (EFs) EF-G and EF-Tu Back     alignment and domain information
>gnl|CDD|104396 PRK10218, PRK10218, GTP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|235462 PRK05433, PRK05433, GTP-binding protein LepA; Provisional Back     alignment and domain information
>gnl|CDD|223606 COG0532, InfB, Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|215253 PLN02459, PLN02459, probable adenylate kinase Back     alignment and domain information
>gnl|CDD|240409 PTZ00416, PTZ00416, elongation factor 2; Provisional Back     alignment and domain information
>gnl|CDD|234569 PRK00007, PRK00007, elongation factor G; Reviewed Back     alignment and domain information
>gnl|CDD|237055 PRK12317, PRK12317, elongation factor 1-alpha; Reviewed Back     alignment and domain information
>gnl|CDD|227581 COG5256, TEF1, Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|240409 PTZ00416, PTZ00416, elongation factor 2; Provisional Back     alignment and domain information
>gnl|CDD|233394 TIGR01394, TypA_BipA, GTP-binding protein TypA/BipA Back     alignment and domain information
>gnl|CDD|206726 cd04163, Era, E Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1291
KOG0468|consensus971 100.0
KOG0469|consensus842 100.0
PLN00116843 translation elongation factor EF-2 subunit; Provis 100.0
PTZ00416836 elongation factor 2; Provisional 100.0
COG0480697 FusA Translation elongation factors (GTPases) [Tra 100.0
KOG0467|consensus887 100.0
PRK07560731 elongation factor EF-2; Reviewed 100.0
TIGR00490720 aEF-2 translation elongation factor aEF-2. This mo 100.0
KOG0465|consensus721 100.0
PRK12739691 elongation factor G; Reviewed 100.0
PRK00007693 elongation factor G; Reviewed 100.0
TIGR00484689 EF-G translation elongation factor EF-G. After pep 100.0
PRK13351687 elongation factor G; Reviewed 100.0
PRK12740668 elongation factor G; Reviewed 100.0
KOG0464|consensus753 100.0
TIGR01394594 TypA_BipA GTP-binding protein TypA/BipA. This bact 100.0
PRK05433600 GTP-binding protein LepA; Provisional 100.0
PRK10218607 GTP-binding protein; Provisional 100.0
TIGR01393595 lepA GTP-binding protein LepA. LepA (GUF1 in Sacca 100.0
KOG0462|consensus650 100.0
PRK00741526 prfC peptide chain release factor 3; Provisional 100.0
TIGR00503527 prfC peptide chain release factor 3. This translat 100.0
COG0481603 LepA Membrane GTPase LepA [Cell envelope biogenesi 100.0
KOG0469|consensus842 100.0
COG1217603 TypA Predicted membrane GTPase involved in stress 100.0
COG4108528 PrfC Peptide chain release factor RF-3 [Translatio 100.0
KOG0468|consensus971 100.0
cd01683178 EF2_IV_snRNP EF-2_domain IV_snRNP domain is a part 100.0
COG1160444 Predicted GTPases [General function prediction onl 100.0
cd01681177 aeEF2_snRNP_like_IV This family represents domain 100.0
cd01683178 EF2_IV_snRNP EF-2_domain IV_snRNP domain is a part 100.0
PTZ00416836 elongation factor 2; Provisional 100.0
PLN00116843 translation elongation factor EF-2 subunit; Provis 100.0
TIGR00490720 aEF-2 translation elongation factor aEF-2. This mo 99.97
cd01886270 EF-G Elongation factor G (EF-G) subfamily. Translo 99.97
PRK07560731 elongation factor EF-2; Reviewed 99.97
cd01681177 aeEF2_snRNP_like_IV This family represents domain 99.96
cd04169267 RF3 RF3 subfamily. Peptide chain release factor 3 99.95
KOG0467|consensus887 99.94
cd04168237 TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T 99.93
CHL00071409 tufA elongation factor Tu 99.93
COG5256428 TEF1 Translation elongation factor EF-1alpha (GTPa 99.93
PRK12736394 elongation factor Tu; Reviewed 99.93
cd04170268 EF-G_bact Elongation factor G (EF-G) subfamily. Tr 99.91
KOG0460|consensus449 99.91
PLN03126478 Elongation factor Tu; Provisional 99.91
PRK12735396 elongation factor Tu; Reviewed 99.91
PTZ00141446 elongation factor 1- alpha; Provisional 99.91
TIGR00485394 EF-Tu translation elongation factor TU. This align 99.91
PLN00043447 elongation factor 1-alpha; Provisional 99.9
PRK00049396 elongation factor Tu; Reviewed 99.9
COG0480697 FusA Translation elongation factors (GTPases) [Tra 99.9
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA 99.9
PRK00093435 GTP-binding protein Der; Reviewed 99.9
COG0050394 TufB GTPases - translation elongation factors [Tra 99.9
PLN03127447 Elongation factor Tu; Provisional 99.88
PRK12739691 elongation factor G; Reviewed 99.88
PRK12317425 elongation factor 1-alpha; Reviewed 99.88
PRK05306787 infB translation initiation factor IF-2; Validated 99.87
TIGR02034406 CysN sulfate adenylyltransferase, large subunit. H 99.87
PRK03003472 GTP-binding protein Der; Reviewed 99.87
PRK00007693 elongation factor G; Reviewed 99.87
PRK05124474 cysN sulfate adenylyltransferase subunit 1; Provis 99.87
PRK09518712 bifunctional cytidylate kinase/GTPase Der; Reviewe 99.86
PRK13351687 elongation factor G; Reviewed 99.86
TIGR00484689 EF-G translation elongation factor EF-G. After pep 99.85
TIGR00483426 EF-1_alpha translation elongation factor EF-1 alph 99.85
cd01885222 EF2 EF2 (for archaea and eukarya). Translocation r 99.85
KOG0458|consensus603 99.84
cd0409880 eEF2_C_snRNP eEF2_C_snRNP: This family includes a 99.83
TIGR00487587 IF-2 translation initiation factor IF-2. This mode 99.83
PTZ00327460 eukaryotic translation initiation factor 2 gamma s 99.83
PRK12740668 elongation factor G; Reviewed 99.83
PRK05506632 bifunctional sulfate adenylyltransferase subunit 1 99.82
KOG0465|consensus721 99.81
PF00009188 GTP_EFTU: Elongation factor Tu GTP binding domain; 99.81
PRK10512614 selenocysteinyl-tRNA-specific translation factor; 99.8
CHL00189742 infB translation initiation factor 2; Provisional 99.79
COG2895431 CysN GTPases - Sulfate adenylate transferase subun 99.79
COG1217603 TypA Predicted membrane GTPase involved in stress 99.79
PRK04000411 translation initiation factor IF-2 subunit gamma; 99.77
COG5257415 GCD11 Translation initiation factor 2, gamma subun 99.77
PF0067989 EFG_C: Elongation factor G C-terminus; InterPro: I 99.76
smart0083885 EFG_C Elongation factor G C-terminus. This domain 99.76
cd01884195 EF_Tu EF-Tu subfamily. This subfamily includes ort 99.76
TIGR03680406 eif2g_arch translation initiation factor 2 subunit 99.75
TIGR00475581 selB selenocysteine-specific elongation factor Sel 99.75
cd0409680 eEF2_snRNP_like_C eEF2_snRNP_like_C: this family r 99.73
cd0409778 mtEFG1_C mtEFG1_C: C-terminus of mitochondrial Elo 99.73
cd0371178 Tet_C Tet_C: C-terminus of ribosomal protection pr 99.72
cd0371378 EFG_mtEFG_C EFG_mtEFG_C: domains similar to the C- 99.71
COG3276447 SelB Selenocysteine-specific translation elongatio 99.7
PF1449275 EFG_II: Elongation Factor G, domain II; PDB: 1WDT_ 99.7
cd01885222 EF2 EF2 (for archaea and eukarya). Translocation r 99.69
cd0151479 Elongation_Factor_C Elongation factor G C-terminus 99.69
PF03764120 EFG_IV: Elongation factor G, domain IV; InterPro: 99.68
cd0371079 BipA_TypA_C BipA_TypA_C: a C-terminal portion of B 99.67
COG5256428 TEF1 Translation elongation factor EF-1alpha (GTPa 99.66
cd04167213 Snu114p Snu114p subfamily. Snu114p is one of sever 99.64
cd04166208 CysN_ATPS CysN_ATPS subfamily. CysN, together with 99.64
KOG0462|consensus650 99.63
cd0370980 lepA_C lepA_C: This family represents the C-termin 99.62
cd0409094 eEF2_II_snRNP Loc2 eEF2_C_snRNP, cd01514/C termina 99.62
COG5258527 GTPBP1 GTPase [General function prediction only] 99.62
cd01883219 EF1_alpha Eukaryotic elongation factor 1 (EF1) alp 99.62
KOG1145|consensus683 99.61
KOG0459|consensus501 99.61
COG2895431 CysN GTPases - Sulfate adenylate transferase subun 99.59
COG0050394 TufB GTPases - translation elongation factors [Tra 99.58
PRK04004586 translation initiation factor IF-2; Validated 99.57
COG0532509 InfB Translation initiation factor 2 (IF-2; GTPase 99.54
cd01884195 EF_Tu EF-Tu subfamily. This subfamily includes ort 99.54
PF00009188 GTP_EFTU: Elongation factor Tu GTP binding domain; 99.53
TIGR02034406 CysN sulfate adenylyltransferase, large subunit. H 99.52
cd01890179 LepA LepA subfamily. LepA belongs to the GTPase fa 99.51
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei 99.5
COG0481603 LepA Membrane GTPase LepA [Cell envelope biogenesi 99.49
PTZ00141446 elongation factor 1- alpha; Provisional 99.49
KOG0461|consensus522 99.47
PLN00043447 elongation factor 1-alpha; Provisional 99.47
KOG0460|consensus449 99.47
cd0369085 Tet_II Tet_II: This subfamily represents domain II 99.44
cd01888203 eIF2_gamma eIF2-gamma (gamma subunit of initiation 99.44
PF03764120 EFG_IV: Elongation factor G, domain IV; InterPro: 99.44
cd0370093 eEF2_snRNP_like_II EF2_snRNP_like_II: this subfami 99.42
TIGR00491590 aIF-2 translation initiation factor aIF-2/yIF-2. T 99.42
KOG0458|consensus603 99.42
cd0409283 mtEFG2_II_like mtEFG2_C: C-terminus of mitochondri 99.41
PRK05124474 cysN sulfate adenylyltransferase subunit 1; Provis 99.41
cd01889192 SelB_euk SelB subfamily. SelB is an elongation fac 99.41
COG4108528 PrfC Peptide chain release factor RF-3 [Translatio 99.4
cd01680116 EFG_like_IV Elongation Factor G-like domain IV. Th 99.39
TIGR01394594 TypA_BipA GTP-binding protein TypA/BipA. This bact 99.38
cd04166208 CysN_ATPS CysN_ATPS subfamily. CysN, together with 99.38
cd01883219 EF1_alpha Eukaryotic elongation factor 1 (EF1) alp 99.38
PLN03126478 Elongation factor Tu; Provisional 99.38
cd01891194 TypA_BipA TypA (tyrosine phosphorylated protein A) 99.38
cd01857141 HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t 99.38
cd0408883 EFG_mtEFG_II EFG_mtEFG_II: this subfamily represen 99.36
KOG3079|consensus195 99.36
PRK05506632 bifunctional sulfate adenylyltransferase subunit 1 99.36
CHL00071409 tufA elongation factor Tu 99.36
KOG0464|consensus753 99.34
cd01886270 EF-G Elongation factor G (EF-G) subfamily. Translo 99.34
PRK12736394 elongation factor Tu; Reviewed 99.34
PRK10218607 GTP-binding protein; Provisional 99.33
cd04167213 Snu114p Snu114p subfamily. Snu114p is one of sever 99.33
cd01849155 YlqF_related_GTPase YlqF-related GTPases. These pr 99.3
PRK12317425 elongation factor 1-alpha; Reviewed 99.3
COG1160444 Predicted GTPases [General function prediction onl 99.3
PLN03127447 Elongation factor Tu; Provisional 99.29
cd0368985 RF3_II RF3_II: this subfamily represents the domai 99.29
PRK00049396 elongation factor Tu; Reviewed 99.29
TIGR00485394 EF-Tu translation elongation factor TU. This align 99.29
cd0369186 BipA_TypA_II BipA_TypA_II: domain II of BipA (also 99.28
cd0409181 mtEFG1_II_like mtEFG1_C: C-terminus of mitochondri 99.28
COG0532509 InfB Translation initiation factor 2 (IF-2; GTPase 99.27
PRK10512614 selenocysteinyl-tRNA-specific translation factor; 99.27
PF1449275 EFG_II: Elongation Factor G, domain II; PDB: 1WDT_ 99.26
TIGR03596276 GTPase_YlqF ribosome biogenesis GTP-binding protei 99.26
cd01684115 Tet_like_IV EF-G_domain IV_RPP domain is a part of 99.25
cd01855190 YqeH YqeH. YqeH is an essential GTP-binding protei 99.25
PRK12735396 elongation factor Tu; Reviewed 99.25
cd04165224 GTPBP1_like GTPBP1-like. Mammalian GTP binding pro 99.24
KOG1145|consensus683 99.24
cd01859156 MJ1464 MJ1464. This family represents archaeal GTP 99.24
cd04168237 TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T 99.23
cd01856171 YlqF YlqF. Proteins of the YlqF family contain all 99.22
PTZ00327460 eukaryotic translation initiation factor 2 gamma s 99.21
PRK09563287 rbgA GTPase YlqF; Reviewed 99.21
cd04178172 Nucleostemin_like Nucleostemin-like. Nucleostemin 99.19
TIGR00483426 EF-1_alpha translation elongation factor EF-1 alph 99.18
COG1159298 Era GTPase [General function prediction only] 99.17
PLN02674244 adenylate kinase 99.17
TIGR00475581 selB selenocysteine-specific elongation factor Sel 99.16
cd04165224 GTPBP1_like GTPBP1-like. Mammalian GTP binding pro 99.15
cd04169267 RF3 RF3 subfamily. Peptide chain release factor 3 99.14
cd00881189 GTP_translation_factor GTP translation factor fami 99.14
PRK14529223 adenylate kinase; Provisional 99.13
cd01434116 EFG_mtEFG1_IV EFG_mtEFG1_IV: domains similar to do 99.11
PRK00741526 prfC peptide chain release factor 3; Provisional 99.11
cd0369986 lepA_II lepA_II: This subfamily represents the dom 99.1
PRK148451049 translation initiation factor IF-2; Provisional 99.09
TIGR00503527 prfC peptide chain release factor 3. This translat 99.07
PLN02459261 probable adenylate kinase 99.07
cd01693120 mtEFG2_like_IV mtEF-G2 domain IV. This subfamily i 99.07
PRK12289352 GTPase RsgA; Reviewed 99.06
PRK05433600 GTP-binding protein LepA; Provisional 99.06
COG0486454 ThdF Predicted GTPase [General function prediction 99.04
COG3276447 SelB Selenocysteine-specific translation elongatio 99.02
cd01891194 TypA_BipA TypA (tyrosine phosphorylated protein A) 99.02
TIGR03597360 GTPase_YqeH ribosome biogenesis GTPase YqeH. This 99.02
KOG1191|consensus531 99.01
PRK13796365 GTPase YqeH; Provisional 99.01
PRK05306787 infB translation initiation factor IF-2; Validated 99.01
TIGR01393595 lepA GTP-binding protein LepA. LepA (GUF1 in Sacca 99.0
PRK14526211 adenylate kinase; Provisional 98.98
cd01889192 SelB_euk SelB subfamily. SelB is an elongation fac 98.98
cd01888203 eIF2_gamma eIF2-gamma (gamma subunit of initiation 98.97
PF02421156 FeoB_N: Ferrous iron transport protein B; InterPro 98.93
cd04171164 SelB SelB subfamily. SelB is an elongation factor 98.93
KOG1144|consensus1064 98.9
TIGR03680406 eif2g_arch translation initiation factor 2 subunit 98.9
KOG0459|consensus501 98.9
PRK14528186 adenylate kinase; Provisional 98.89
TIGR00487587 IF-2 translation initiation factor IF-2. This mode 98.89
TIGR00157245 ribosome small subunit-dependent GTPase A. The Aqu 98.88
cd04170268 EF-G_bact Elongation factor G (EF-G) subfamily. Tr 98.88
PRK09554772 feoB ferrous iron transport protein B; Reviewed 98.88
PRK13808333 adenylate kinase; Provisional 98.87
cd04171164 SelB SelB subfamily. SelB is an elongation factor 98.87
PRK04004586 translation initiation factor IF-2; Validated 98.86
COG5257415 GCD11 Translation initiation factor 2, gamma subun 98.84
cd01854287 YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil 98.83
TIGR01351210 adk adenylate kinases. Adenylate kinase (EC 2.7.4. 98.82
PRK12288347 GTPase RsgA; Reviewed 98.81
cd01680116 EFG_like_IV Elongation Factor G-like domain IV. Th 98.8
PRK00098298 GTPase RsgA; Reviewed 98.79
TIGR00491590 aIF-2 translation initiation factor aIF-2/yIF-2. T 98.78
CHL00189742 infB translation initiation factor 2; Provisional 98.78
PRK148451049 translation initiation factor IF-2; Provisional 98.78
PRK04000411 translation initiation factor IF-2 subunit gamma; 98.78
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 98.76
cd01890179 LepA LepA subfamily. LepA belongs to the GTPase fa 98.75
PRK14531183 adenylate kinase; Provisional 98.75
cd01895174 EngA2 EngA2 subfamily. This CD represents the seco 98.75
KOG0466|consensus466 98.74
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA 98.74
KOG0461|consensus522 98.74
PTZ00088229 adenylate kinase 1; Provisional 98.74
PRK15494339 era GTPase Era; Provisional 98.71
cd01894157 EngA1 EngA1 subfamily. This CD represents the firs 98.7
cd00881189 GTP_translation_factor GTP translation factor fami 98.7
TIGR00436270 era GTP-binding protein Era. Era is an essential G 98.68
COG1161322 Predicted GTPases [General function prediction onl 98.68
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 98.66
cd01887168 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo 98.63
PRK14527191 adenylate kinase; Provisional 98.62
PRK14530215 adenylate kinase; Provisional 98.62
PRK00279215 adk adenylate kinase; Reviewed 98.61
PRK03003472 GTP-binding protein Der; Reviewed 98.6
PRK09518712 bifunctional cytidylate kinase/GTPase Der; Reviewe 98.59
PRK00093435 GTP-binding protein Der; Reviewed 98.59
PRK14532188 adenylate kinase; Provisional 98.58
COG1159298 Era GTPase [General function prediction only] 98.57
cd01887168 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo 98.56
PRK00089292 era GTPase Era; Reviewed 98.55
TIGR00450442 mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE 98.53
cd01852196 AIG1 AIG1 (avrRpt2-induced gene 1). This represent 98.52
PRK05291449 trmE tRNA modification GTPase TrmE; Reviewed 98.51
PF0314474 GTP_EFTU_D2: Elongation factor Tu domain 2; InterP 98.5
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein 98.5
cd01684115 Tet_like_IV EF-G_domain IV_RPP domain is a part of 98.49
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 98.48
PLN02200234 adenylate kinase family protein 98.48
cd01879158 FeoB Ferrous iron transport protein B (FeoB) subfa 98.47
cd01894157 EngA1 EngA1 subfamily. This CD represents the firs 98.47
PRK09866741 hypothetical protein; Provisional 98.47
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protei 98.47
PRK01889356 GTPase RsgA; Reviewed 98.46
KOG2423|consensus572 98.45
PRK02496184 adk adenylate kinase; Provisional 98.44
KOG1144|consensus1064 98.44
cd01898170 Obg Obg subfamily. The Obg nucleotide binding prot 98.43
COG1162301 Predicted GTPases [General function prediction onl 98.41
cd01882225 BMS1 Bms1. Bms1 is an essential, evolutionarily co 98.38
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversibl 98.38
cd01434116 EFG_mtEFG1_IV EFG_mtEFG1_IV: domains similar to do 98.38
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 98.37
KOG2484|consensus435 98.35
KOG1424|consensus562 98.33
KOG0052|consensus391 98.33
TIGR00231161 small_GTP small GTP-binding protein domain. This m 98.32
cd01895174 EngA2 EngA2 subfamily. This CD represents the seco 98.3
TIGR00436270 era GTP-binding protein Era. Era is an essential G 98.3
TIGR03156351 GTP_HflX GTP-binding protein HflX. This protein fa 98.29
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein presen 98.29
KOG1143|consensus591 98.28
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 98.27
KOG1423|consensus379 98.26
PRK04213201 GTP-binding protein; Provisional 98.25
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protei 98.25
cd01882225 BMS1 Bms1. Bms1 is an essential, evolutionarily co 98.23
PRK00454196 engB GTP-binding protein YsxC; Reviewed 98.23
PLN02842505 nucleotide kinase 98.23
COG2229187 Predicted GTPase [General function prediction only 98.16
KOG0463|consensus641 98.14
PRK11058426 GTPase HflX; Provisional 98.13
cd00880163 Era_like Era (E. coli Ras-like protein)-like. This 98.12
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 98.12
PRK12298390 obgE GTPase CgtA; Reviewed 98.09
PRK00089292 era GTPase Era; Reviewed 98.09
cd01878204 HflX HflX subfamily. A distinct conserved domain w 98.08
COG2229187 Predicted GTPase [General function prediction only 98.05
cd01693120 mtEFG2_like_IV mtEF-G2 domain IV. This subfamily i 98.05
COG0370653 FeoB Fe2+ transport system protein B [Inorganic io 98.05
PRK15494339 era GTPase Era; Provisional 98.03
cd04114169 Rab30 Rab30 subfamily. Rab30 appears to be associa 98.03
KOG2485|consensus335 98.03
COG0218200 Predicted GTPase [General function prediction only 98.03
cd01879158 FeoB Ferrous iron transport protein B (FeoB) subfa 97.98
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubu 97.98
cd04105203 SR_beta Signal recognition particle receptor, beta 97.98
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associat 97.97
TIGR02836492 spore_IV_A stage IV sporulation protein A. A compa 97.97
cd01881176 Obg_like The Obg-like subfamily consists of five w 97.96
cd04105203 SR_beta Signal recognition particle receptor, beta 97.94
TIGR00437591 feoB ferrous iron transporter FeoB. FeoB (773 amin 97.93
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential componen 97.93
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 97.92
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily 97.92
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik 97.92
PRK15467158 ethanolamine utilization protein EutP; Provisional 97.92
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 97.9
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associat 97.9
smart00178184 SAR Sar1p-like members of the Ras-family of small 97.9
smart00053240 DYNc Dynamin, GTPase. Large GTPases that mediate v 97.89
KOG3078|consensus235 97.89
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are 97.88
TIGR00991313 3a0901s02IAP34 GTP-binding protein (Chloroplast En 97.88
cd04151158 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t 97.87
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 97.87
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg 97.87
COG0486454 ThdF Predicted GTPase [General function prediction 97.86
cd01853249 Toc34_like Toc34-like (Translocon at the Outer-env 97.85
PRK12299335 obgE GTPase CgtA; Reviewed 97.85
KOG0052|consensus391 97.84
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf 97.84
PTZ00258390 GTP-binding protein; Provisional 97.83
PF02421156 FeoB_N: Ferrous iron transport protein B; InterPro 97.83
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicat 97.81
PRK12296500 obgE GTPase CgtA; Reviewed 97.81
cd01860163 Rab5_related Rab5-related subfamily. This subfamil 97.8
KOG0466|consensus466 97.8
cd04152183 Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i 97.78
TIGR02528142 EutP ethanolamine utilization protein, EutP. This 97.77
PRK12297424 obgE GTPase CgtA; Reviewed 97.77
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamil 97.77
cd00157171 Rho Rho (Ras homology) family. Members of the Rho 97.77
cd0134283 Translation_Factor_II_like Translation_Factor_II_l 97.76
cd00154159 Rab Rab family. Rab GTPases form the largest famil 97.76
cd04147198 Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v 97.76
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in 97.76
PF00350168 Dynamin_N: Dynamin family; InterPro: IPR001401 Mem 97.75
cd0369883 eRF3_II_like eRF3_II_like: domain similar to domai 97.75
cd04115170 Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u 97.75
cd04151158 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t 97.75
cd01900274 YchF YchF subfamily. YchF is a member of the Obg f 97.75
COG1084346 Predicted GTPase [General function prediction only 97.73
cd01896233 DRG The developmentally regulated GTP-binding prot 97.73
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a 97.73
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub 97.73
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub 97.72
cd00877166 Ran Ran (Ras-related nuclear proteins) /TC4 subfam 97.72
cd01893166 Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr 97.72
TIGR00231161 small_GTP small GTP-binding protein domain. This m 97.71
cd00880163 Era_like Era (E. coli Ras-like protein)-like. This 97.71
PF09439181 SRPRB: Signal recognition particle receptor beta s 97.7
PRK09601364 GTP-binding protein YchF; Reviewed 97.7
PLN03118211 Rab family protein; Provisional 97.7
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 97.69
cd04142198 RRP22 RRP22 subfamily. RRP22 (Ras-related protein 97.69
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp 97.69
cd04161167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( 97.68
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein 97.68
cd01850276 CDC_Septin CDC/Septin. Septins are a conserved fam 97.68
TIGR00450442 mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE 97.68
PRK09554772 feoB ferrous iron transport protein B; Reviewed 97.68
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 97.67
cd04135174 Tc10 TC10 subfamily. TC10 is a Rho family protein 97.67
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf 97.67
cd04177168 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the 97.67
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a 97.66
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamil 97.66
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 97.65
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicat 97.65
PF00406151 ADK: Adenylate kinase; InterPro: IPR000850 Adenyla 97.64
cd04146165 RERG_RasL11_like RERG/RasL11-like subfamily. RERG 97.64
PF04548212 AIG1: AIG1 family; InterPro: IPR006703 This entry 97.64
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 97.63
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 97.62
cd04106162 Rab23_lke Rab23-like subfamily. Rab23 is a member 97.62
TIGR02729329 Obg_CgtA Obg family GTPase CgtA. This model descri 97.62
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a 97.62
cd04152183 Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i 97.61
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 97.61
cd04147198 Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v 97.61
COG5258527 GTPBP1 GTPase [General function prediction only] 97.61
cd04140165 ARHI_like ARHI subfamily. ARHI (A Ras homolog memb 97.61
cd04175164 Rap1 Rap1 subgroup. The Rap1 subgroup is part of t 97.61
PTZ00369189 Ras-like protein; Provisional 97.6
cd01860163 Rab5_related Rab5-related subfamily. This subfamil 97.59
PRK05291449 trmE tRNA modification GTPase TrmE; Reviewed 97.59
PRK12298390 obgE GTPase CgtA; Reviewed 97.58
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th 97.58
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily 97.57
smart00178184 SAR Sar1p-like members of the Ras-family of small 97.57
PRK15467158 ethanolamine utilization protein EutP; Provisional 97.57
cd04158169 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor 97.57
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik 97.55
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev 97.55
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are 97.55
cd04161167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( 97.54
smart00174174 RHO Rho (Ras homology) subfamily of Ras-like small 97.53
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su 97.53
cd04149168 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 97.53
cd0369391 EF1_alpha_II EF1_alpha_II: this family represents 97.52
cd04104197 p47_IIGP_like p47 (47-kDa) family. The p47 GTPase 97.51
cd00882157 Ras_like_GTPase Ras-like GTPase superfamily. The R 97.51
cd01893166 Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr 97.5
cd01870175 RhoA_like RhoA-like subfamily. The RhoA subfamily 97.5
cd01898170 Obg Obg subfamily. The Obg nucleotide binding prot 97.5
cd04118193 Rab24 Rab24 subfamily. Rab24 is distinct from othe 97.5
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 97.49
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily con 97.48
cd01850276 CDC_Septin CDC/Septin. Septins are a conserved fam 97.48
cd00876160 Ras Ras family. The Ras family of the Ras superfam 97.48
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubu 97.47
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein presen 97.47
cd04123162 Rab21 Rab21 subfamily. The localization and functi 97.47
cd04130173 Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive 97.47
TIGR03156351 GTP_HflX GTP-binding protein HflX. This protein fa 97.46
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 97.46
COG0218200 Predicted GTPase [General function prediction only 97.46
cd04162164 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 97.44
TIGR00437591 feoB ferrous iron transporter FeoB. FeoB (773 amin 97.44
cd01881176 Obg_like The Obg-like subfamily consists of five w 97.43
cd04162164 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 97.43
smart00176200 RAN Ran (Ras-related nuclear proteins) /TC4 subfam 97.42
PRK00454196 engB GTP-binding protein YsxC; Reviewed 97.41
cd04112191 Rab26 Rab26 subfamily. First identified in rat pan 97.41
cd01865165 Rab3 Rab3 subfamily. The Rab3 subfamily contains R 97.39
cd04134189 Rho3 Rho3 subfamily. Rho3 is a member of the Rho f 97.39
COG5192 1077 BMS1 GTP-binding protein required for 40S ribosome 97.39
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su 97.39
TIGR02528142 EutP ethanolamine utilization protein, EutP. This 97.36
cd04114169 Rab30 Rab30 subfamily. Rab30 appears to be associa 97.36
cd04149168 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 97.36
cd04115170 Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u 97.35
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential componen 97.35
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 97.33
cd04110199 Rab35 Rab35 subfamily. Rab35 is one of several Rab 97.32
PRK11058426 GTPase HflX; Provisional 97.32
cd04106162 Rab23_lke Rab23-like subfamily. Rab23 is a member 97.32
cd04158169 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor 97.31
cd00154159 Rab Rab family. Rab GTPases form the largest famil 97.31
PRK13768253 GTPase; Provisional 97.31
PLN00223181 ADP-ribosylation factor; Provisional 97.31
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in 97.31
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 97.31
cd04132187 Rho4_like Rho4-like subfamily. Rho4 is a GTPase th 97.3
cd04176163 Rap2 Rap2 subgroup. The Rap2 subgroup is part of t 97.3
PTZ00133182 ADP-ribosylation factor; Provisional 97.29
cd00882157 Ras_like_GTPase Ras-like GTPase superfamily. The R 97.29
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 97.28
cd04101164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove 97.28
PTZ00369189 Ras-like protein; Provisional 97.28
cd04122166 Rab14 Rab14 subfamily. Rab14 GTPases are localized 97.28
cd0408982 eRF3_II eRF3_II: domain II of the eukaryotic class 97.28
cd04127180 Rab27A Rab27a subfamily. The Rab27a subfamily cons 97.27
cd01878204 HflX HflX subfamily. A distinct conserved domain w 97.26
PRK04213201 GTP-binding protein; Provisional 97.26
cd04144190 Ras2 Ras2 subfamily. The Ras2 subfamily, found exc 97.24
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 97.24
cd04140165 ARHI_like ARHI subfamily. ARHI (A Ras homolog memb 97.24
PLN03071219 GTP-binding nuclear protein Ran; Provisional 97.23
PTZ00133182 ADP-ribosylation factor; Provisional 97.22
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg 97.22
cd04107201 Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 97.22
cd04125188 RabA_like RabA-like subfamily. RabA was first iden 97.22
PTZ00099176 rab6; Provisional 97.22
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev 97.22
cd04150159 Arf1_5_like Arf1-Arf5-like subfamily. This subfami 97.21
cd04150159 Arf1_5_like Arf1-Arf5-like subfamily. This subfami 97.2
cd04126220 Rab20 Rab20 subfamily. Rab20 is one of several Rab 97.19
cd04177168 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the 97.19
PLN03108210 Rab family protein; Provisional 97.19
COG1163365 DRG Predicted GTPase [General function prediction 97.18
PLN03118211 Rab family protein; Provisional 97.18
PRK12296500 obgE GTPase CgtA; Reviewed 97.18
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 97.18
smart00177175 ARF ARF-like small GTPases; ARF, ADP-ribosylation 97.17
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 97.17
cd04116170 Rab9 Rab9 subfamily. Rab9 is found in late endosom 97.17
cd04141172 Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p 97.17
cd04110199 Rab35 Rab35 subfamily. Rab35 is one of several Rab 97.16
cd04148221 RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki 97.16
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th 97.16
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 97.15
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamil 97.15
cd01852196 AIG1 AIG1 (avrRpt2-induced gene 1). This represent 97.14
cd04135174 Tc10 TC10 subfamily. TC10 is a Rho family protein 97.14
PF09439181 SRPRB: Signal recognition particle receptor beta s 97.13
cd04101164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove 97.13
cd04111211 Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 97.13
cd04141172 Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p 97.12
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp 97.08
PLN00223181 ADP-ribosylation factor; Provisional 97.08
cd04146165 RERG_RasL11_like RERG/RasL11-like subfamily. RERG 97.08
cd04108170 Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr 97.08
>KOG0468|consensus Back     alignment and domain information 
Probab=100.00  E-value=1.9e-158  Score=1350.53  Aligned_cols=804  Identities=70%  Similarity=1.133  Sum_probs=755.5

Q ss_pred             ccchhhcccCcccccCcccccCCCccccccccccccccccccccccccccccccccCCCcccchHHHhhhcCCccccceE
Q psy15088        324 DSQAVVLHEDKRYYPTAVEVFGPDVETVVQEEDTQALSVPLIAPIKKKKFQLKEQDLPDTVYNMEFLADMMDTPHLIRNV  403 (1291)
Q Consensus       324 ~~~~v~~~~~~~~~~sa~~~~g~~~e~~~~~~d~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~irnI  403 (1291)
                      ...+++|||||+||+||.+.||.++|++++++|.|++.+|+++|++.++|...++++|++.|+.+|+..||++|+++|||
T Consensus        52 ~~~~vvLhedK~yypsaeevYG~dVE~lvqeed~Qpl~~Pli~Pv~~~k~q~~~~~~p~T~y~~~yl~~l~~~p~~irnV  131 (971)
T KOG0468|consen   52 PQNAVVLHEDKKYYPSAEEVYGEDVETLVQEEDTQPLREPLIEPVRRLKFQIHERDVPETVYDLEYLAGLMDNPERIRNV  131 (971)
T ss_pred             ccceeeeccccccCcccccccCCcceeeeeccccCCcccccchhhhhhhhhhhhcccchhhhhHHHHHHhccCcceEEEE
Confidence            45679999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEcccCCChhHHHHHHHhhcCCcccCCccccccccccccccccccCceeeeccceecccccCCCCeEEEEEeCCCcccc
Q psy15088        404 ALVGHLHHGKTTMIDCLIRQTHPGYRQPAEEKNLRYTDTLFTEQERGVSIKASPVTLLLPDVKGKNYLMNIFDTPASPVT  483 (1291)
Q Consensus       404 ~iiG~~~~GKsTl~~~ll~~~~~i~~~~~~~~~~~~~D~~~~E~erGiTi~~~~~~~~~~~~~~~~~~~~liDTpGh~~~  483 (1291)
                      +++||.|||||+|.++|+.+++.-.+ ...+...+|+|.+..|+|||.||++.++++..++.+++++.+|++|||||.+|
T Consensus       132 ~l~GhLhhGKT~l~D~Lv~~tHp~~~-~~~e~~lrytD~l~~E~eRg~sIK~~p~Tl~l~D~~~KS~l~nilDTPGHVnF  210 (971)
T KOG0468|consen  132 GLVGHLHHGKTALMDLLVEQTHPDFS-KNTEADLRYTDTLFYEQERGCSIKSTPVTLVLSDSKGKSYLMNILDTPGHVNF  210 (971)
T ss_pred             EEeeccccChhHHHHhhceecccccc-ccccccccccccchhhHhcCceEeecceEEEEecCcCceeeeeeecCCCcccc
Confidence            99999999999999999999984332 23456789999999999999999999999999999999999999999999655


Q ss_pred             c--ccccccccceEEEEe--------------------------------------------------------------
Q psy15088        484 L--LLPDVKGKNYLMNIF--------------------------------------------------------------  499 (1291)
Q Consensus       484 ~--~l~~~~~ad~~v~vi--------------------------------------------------------------  499 (1291)
                      .  +..++..+|++|+++                                                              
T Consensus       211 ~DE~ta~l~~sDgvVlvvDv~EGVmlntEr~ikhaiq~~~~i~vviNKiDRLilELkLPP~DAY~KLrHii~~iN~~is~  290 (971)
T KOG0468|consen  211 SDETTASLRLSDGVVLVVDVAEGVMLNTERIIKHAIQNRLPIVVVINKVDRLILELKLPPMDAYYKLRHIIDEINNLIST  290 (971)
T ss_pred             hHHHHHHhhhcceEEEEEEcccCceeeHHHHHHHHHhccCcEEEEEehhHHHHHHhcCChHHHHHHHHHHHHHhcchhhh
Confidence            4  333333445666644                                                              


Q ss_pred             --------------------------------------------------cCCCc--cchhhHhhHHHHHhhcCccchhh
Q psy15088        500 --------------------------------------------------DTPGM--WDIHVRKFSKKAAHASAQRSFVE  527 (1291)
Q Consensus       500 --------------------------------------------------da~~g--~~~qt~~~~~~~~~~~~~~~fv~  527 (1291)
                                                                        .+||+  |+..|+++.+.......+|.||+
T Consensus       291 ~s~~~~~~~sP~~gNvcFaS~~~g~cFtl~sFak~Y~~~~~~~~~d~Fa~RLWGdvYf~~ktrkF~kk~~~~~~~rsFVe  370 (971)
T KOG0468|consen  291 FSKDDNPVVSPILGNVCFASGKLGFCFTLKSFAKLYADAHGHIDVDDFAKRLWGDVYFHSKTRKFVKKPPDGSGSRSFVE  370 (971)
T ss_pred             cccccccccccccCceeeeccccceeeehHHHHHHHHHhcCCcchhhhhhhhhccccccccccccccCCCCCcccchhhh
Confidence                                                              34555  35666666666666667899999


Q ss_pred             hhhhHHHHHHHHhhCCccCcHHHHHHHhCCCcChhhhhcCchHHHHHHHhhccccccCCCccccccccccccccCceEEc
Q psy15088        528 FVLEPVYKLVAQVVGDVDSSLPAVLDQLGIHMNKEESKINIRPLLRLVYKVEVNRVPAGNWVLIEGIDQPIVKTSTITDL  607 (1291)
Q Consensus       528 fil~~i~k~~d~~~~~~~~~l~~i~~~lg~~l~~~~~~~~~~~~l~~i~~~~~~~~P~~~~~~~~~~~~~~~~~~~liDl  607 (1291)
                      |||+|+||++.++..+.+.+++.+++.||+.+++++++++++|+|+.+|+                              
T Consensus       371 FILePlYKi~sq~igd~~~~l~~~l~e~~v~ls~e~~k~n~rPll~lvc~------------------------------  420 (971)
T KOG0468|consen  371 FILEPLYKIFSQVIGDEKDSLKGLLAELGVRLSKEAYKLNPRPLLRLVCK------------------------------  420 (971)
T ss_pred             hhHhHHHHHHHHHhcchhhhhhhhhhhhcccccHHHhhcCccHHHHHHHH------------------------------
Confidence            99999999999999999999999999999999999999999999999987                              


Q ss_pred             ccccccccCceeecCCCCccCccchHHHHHHHHHHHHHhhhcCCCchHHHHHHhhcccCCCCCCCCCHHHHHHHHhhccc
Q psy15088        608 ITNEDITSNKFLIDGFPRNQNNLDGWNKEMADKVELLYVLFFDCPEDVCVRRCLKRGAEGSGRADDNEESLKKRISVYNT  687 (1291)
Q Consensus       608 l~~~~i~~~~~liDGfPr~~~qa~~~~~~l~e~~~l~~v~~ld~~~e~l~~R~l~rg~~~~~r~dd~~e~i~~rl~~~~~  687 (1291)
                               .|+                                                                    
T Consensus       421 ---------~ff--------------------------------------------------------------------  423 (971)
T KOG0468|consen  421 ---------SFF--------------------------------------------------------------------  423 (971)
T ss_pred             ---------Hhc--------------------------------------------------------------------
Confidence                     111                                                                    


Q ss_pred             cccceEEeecchhhhhhhchhHHHHHHHHhhCCCCccchhhhhhcccCCCCCchhhhhhhccCCcccccccccccccccc
Q psy15088        688 ETMPIIKFFEAKNLVKRFNAEKSLVEMCVKHIPSPAENAETKVSYMYTGPGDSDVARDMKACNPEGRLMVHSSKKNAETK  767 (1291)
Q Consensus       688 ~~~PVl~~sa~k~~~~~~~g~~~LLD~Iv~~lPsP~~~~~~r~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  767 (1291)
                                        .-...+.||+++|+|||.+.++.++...|.|+.                             
T Consensus       424 ------------------g~~sgfvd~~v~hi~sP~e~a~~K~~hsy~G~~-----------------------------  456 (971)
T KOG0468|consen  424 ------------------GIESGFVDMPVEHIPSPRENAARKAEHSYTGTK-----------------------------  456 (971)
T ss_pred             ------------------cchhhhhHhhHhhcCChhhhhccccceeecCCC-----------------------------
Confidence                              012356799999999999988877777777754                             


Q ss_pred             cccccCCCCCchhhhhhhccCCCCCeEEEEEeeccCCCCceeEEEEEEEeeEecCCCEEEEcccCCCCCCcccceEEEEc
Q psy15088        768 VSYMYTGPGDSDVARDMKACNPEGRLMVHSSKMYPTEECTFFQVLARVMSGTLHAGQEVRVLGENYSLMDEEDSRILTVG  847 (1291)
Q Consensus       768 ~~~~~~~~~~~~~~~~~~~~d~~~pl~~~V~K~~~~~~~~~~ia~~RV~sGtL~~G~~v~v~~~~~~~~~~~~~~~~~V~  847 (1291)
                               ++.+...|..|++.+|++++++|+++..+...|.+|+||+||+++.|+.|.+++.+|+..+.++...+.|+
T Consensus       457 ---------~~~i~~~m~~c~~~~pLm~h~tklyp~dD~~~f~~f~rv~Sg~~~~~q~V~vlgeny~leDEeD~~~~~v~  527 (971)
T KOG0468|consen  457 ---------DSLIYEGMVECNASGPLMVHVTKLYPRDDTVQFHVFGRVYSGQVVTGQDVRVLGENYSLEDEEDMVICEVG  527 (971)
T ss_pred             ---------cchHHHHHHhhCCCCceeEEeecceecCCceeeeeeeeeeecceeecceeeEeeccccCCCcccceeeeee
Confidence                     67788999999999999999999999988889999999999999999999999999999999999999999


Q ss_pred             eEEEEecCceeeeceeeCCCeEEEccCCCcccccceeeccccCCccccccCCCCCCCceEEEEEEeCCCCChhHHHHHHH
Q psy15088        848 RLWIYEARYKVEVNRVPAGNWVLIEGIDQPIVKTSTITDLITNEDMYIFRPLKFNTQSVIKIAVEPVNPSELPKMLDGLR  927 (1291)
Q Consensus       848 ~l~~~~g~~~~~v~~a~aGnIv~I~Gl~~~~~k~~Tl~~~~~~~~~~~~~~~~~~~~Pv~~vaIeP~~~~d~~kL~~~L~  927 (1291)
                      +++++.+|+..+|++|+||++|.|.|+++.+.||+|+.+....+....|+|++|...||+++++||.||+++|||++||+
T Consensus       528 el~v~~arY~i~V~~~~~G~~VLI~Gidq~i~KtaTi~~~~~ked~yiFrpl~~~t~~VvKiaveP~nPsELPKmldgLr  607 (971)
T KOG0468|consen  528 ELWVVRARYRIPVSRAPAGLWVLIEGVDQSIVKTATIKSLEYKEDVYIFRPLKFNTEPVVKVAVEPLNPSELPKMLDGLR  607 (971)
T ss_pred             eeeeeeeeEEEEecccCCCcEEEEeccchHHhhhhheeccccccceeeccchhcCCcceEEEEeccCChhhhhHHHHHHH
Confidence            99999999999999999999999999999999999999987777889999999999999999999999999999999999


Q ss_pred             HHHHhCCceeEEECcCCcEEEEecchhHHHHHHHHHHhhhcceeEEEcCceEEEEEeeeecccceeeeecCCcceEEEEE
Q psy15088        928 KVNKSYPLLTTKVEESGEHVVLGTGELYLDCVMHDLRKMYSEIDIKVADPVVAFCETVVETSSLKCFAETPNKRNKITMI 1007 (1291)
Q Consensus       928 ~L~~~DPsl~v~~~etGe~ii~g~GELHLEi~l~~L~~~f~~i~i~vs~p~V~yrEti~~~~~~~~~~~s~nk~~~i~~~ 1007 (1291)
                      +.++.+|.+..++||+|||+|.|.|||+|+|+++|||..|+.|+|++++|.|.|+||+.++++.+|++++|||+|+|+|.
T Consensus       608 KinKsYPl~~tkVEESGEHvilGtGElYmDcvlyDLR~~yseieikvaDPvv~F~Et~vetssikcfaetpnkknkItmi  687 (971)
T KOG0468|consen  608 KINKSYPLVITKVEESGEHVILGTGELYMDCVLYDLRKSYSEIEIKVADPVVRFCETVVETSSIKCFAETPNKKNKITMI  687 (971)
T ss_pred             hhcccCCcEEEehhhcCceEEecCchhhHHHHHHHHHHHHhhhceeecCceeEEEEeeecccchhhhccCCCccCceeee
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EeecCcccccccccceeccccchhHHHHHHhhhccccHhhhcceeeeCCCCCCCceeccCCCCchhhhhhhhhHHHHHHH
Q psy15088       1008 AEPLEKGLAEDIENQIVHIAWNKKRLGEFFQSKYDWDLLAARSIWAFGPEVTGPNILVDDTLPSEVDKGLLGSVKDSIVQ 1087 (1291)
Q Consensus      1008 ~ePl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~w~~~~~~~iw~~gp~~~g~nilvd~~~~~~~~~~~~~~i~~si~~ 1087 (1291)
                      +||++.++.+++++|++.+.|+.++++++|+.+|+||.+++|+||||||+.+|||||+|+|+|.+++++++..++++|++
T Consensus       688 aEPlek~l~eDiEng~v~I~wn~krl~effqt~YdWDlLAaRsiWaFgpd~~GpNiL~dDTLp~evdk~ll~~vkesivQ  767 (971)
T KOG0468|consen  688 AEPLEKGLAEDIENGVVVIDWNRKRLGEFFQTKYDWDLLAARSIWAFGPDYTGPNILLDDTLPTEVDKNLLSSVKESIVQ  767 (971)
T ss_pred             echhhhhhhHHhhcCeEEeccchhhhhhhhhcccchhhhhhcceeccCCCCCCCceeecCcCcchhhHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhhhcCccCCCCceeeEEEEEEeeeecCCCCCCcCcHHHHHHHHHHHHHHhCCCceeccEEEEEEEecccchhHHHH
Q psy15088       1088 GFQWGTREGPLCEEPIRNVKFKILDAVIATEPLHRGGGQIIPTARRVAYSAFLMATPRLMEPYLFVEVQAPADCVSAVYT 1167 (1291)
Q Consensus      1088 Gf~~a~~~GPL~~epv~gv~~~l~d~~~~~~~~~~~~~qii~~~r~~~~~a~l~a~p~LlEPi~~~eI~~p~~~lg~V~~ 1167 (1291)
                      ||||++++||||+||+++|+|+|.|+.+.++++||++||+||+|||+||.||+.|.||||||+|.|||++|.+++..||+
T Consensus       768 GFqW~trEGPLc~EpIr~VkfKlld~~ia~e~l~rgggQiIPtaRrv~YsafL~AtPrLmEP~Y~VEi~apad~v~~Vy~  847 (971)
T KOG0468|consen  768 GFQWGTREGPLCDEPIRNVKFKLLDAVIAPEPLHRGGGQIIPTARRVAYSAFLMATPRLMEPVYLVEITAPADCVPAVYT  847 (971)
T ss_pred             HHHHHhccCCccCCcccceeEEEeecccCccccccCCCccchHHHHHHHHHHHhhchhhcCceEEEEEecccchHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHhccCcEEeeccccCCCCcEEEEEecccccccCchHHHhhccccceEeeecccceeecCCCCcCcccccCCCCCCCccc
Q psy15088       1168 VLAKRRGHVTQDAPVPGSPLYTIKAFIPAIDSFGFETDLRTHTQGQAFCLSVFHHWQIVPGDPLDKSIVIRPLEPQPATH 1247 (1291)
Q Consensus      1168 ~L~~RRG~I~~~~~~~gt~~~~I~a~lPv~esfgf~~~LRs~T~G~a~~~~~f~~~~~v~~dp~~~~~~~~~~~~~~~~~ 1247 (1291)
                      +|++|||+|++..+.+||++++|+|++||.|||||.+|||.+|+|+|+|++.|+||++|||||+|+.+..++||+++.++
T Consensus       848 vl~rRRGhV~~d~p~pGSPly~v~a~iPvieSfGFETDLR~hTqGqa~C~~vF~HW~~VPGDpLDKsi~i~~Lep~p~~~  927 (971)
T KOG0468|consen  848 VLSRRRGHVTQDIPVPGSPLYTVKAYLPVIESFGFETDLRVHTQGQAFCLSVFDHWRIVPGDPLDKSIAIRPLEPAPIRH  927 (971)
T ss_pred             HHHhhcCceeecCCCCCCchhheeeecccccccCcccceeeeccchhHHHHhhhhcccCCCCccccccccccCCCCCcch
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHhhccCCCCCCCccccCCHHHHHHHHhcCccccCCC
Q psy15088       1248 LAREFMIKTRRRKGLSEDVSINKFFDDPMLLELARQDVMLNYPL 1291 (1291)
Q Consensus      1248 ~a~~~~~~iR~rKGl~~~~~~~~~~d~~~~~~~~~~~~~~~~~~ 1291 (1291)
                      +||+||.|+||||||+++++.++|||+.|+.+|++|++.++||+
T Consensus       928 LaReFmiKTRRRKGlsedvS~~kffd~~m~~eL~~q~~~~~l~~  971 (971)
T KOG0468|consen  928 LAREFMIKTRRRKGLSEDVSINKFFDDPMLLELAKQDVVLGLPM  971 (971)
T ss_pred             hHHHHHHHhhhhcccccccccCcccchHHHHHHHHhhhhcCCCC
Confidence            99999999999999999999999999999999999999999995

>KOG0469|consensus Back     alignment and domain information
>PLN00116 translation elongation factor EF-2 subunit; Provisional Back     alignment and domain information
>PTZ00416 elongation factor 2; Provisional Back     alignment and domain information
>COG0480 FusA Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0467|consensus Back     alignment and domain information
>PRK07560 elongation factor EF-2; Reviewed Back     alignment and domain information
>TIGR00490 aEF-2 translation elongation factor aEF-2 Back     alignment and domain information
>KOG0465|consensus Back     alignment and domain information
>PRK12739 elongation factor G; Reviewed Back     alignment and domain information
>PRK00007 elongation factor G; Reviewed Back     alignment and domain information
>TIGR00484 EF-G translation elongation factor EF-G Back     alignment and domain information
>PRK13351 elongation factor G; Reviewed Back     alignment and domain information
>PRK12740 elongation factor G; Reviewed Back     alignment and domain information
>KOG0464|consensus Back     alignment and domain information
>TIGR01394 TypA_BipA GTP-binding protein TypA/BipA Back     alignment and domain information
>PRK05433 GTP-binding protein LepA; Provisional Back     alignment and domain information
>PRK10218 GTP-binding protein; Provisional Back     alignment and domain information
>TIGR01393 lepA GTP-binding protein LepA Back     alignment and domain information
>KOG0462|consensus Back     alignment and domain information
>PRK00741 prfC peptide chain release factor 3; Provisional Back     alignment and domain information
>TIGR00503 prfC peptide chain release factor 3 Back     alignment and domain information
>COG0481 LepA Membrane GTPase LepA [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG0469|consensus Back     alignment and domain information
>COG1217 TypA Predicted membrane GTPase involved in stress response [Signal transduction mechanisms] Back     alignment and domain information
>COG4108 PrfC Peptide chain release factor RF-3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0468|consensus Back     alignment and domain information
>cd01683 EF2_IV_snRNP EF-2_domain IV_snRNP domain is a part of 116kD U5-specific protein of the U5 small nucleoprotein (snRNP) particle, essential component of the spliceosome Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>cd01681 aeEF2_snRNP_like_IV This family represents domain IV of archaeal and eukaryotic elongation factor 2 (aeEF-2) and of an evolutionarily conserved U5 snRNP-specific protein Back     alignment and domain information
>cd01683 EF2_IV_snRNP EF-2_domain IV_snRNP domain is a part of 116kD U5-specific protein of the U5 small nucleoprotein (snRNP) particle, essential component of the spliceosome Back     alignment and domain information
>PTZ00416 elongation factor 2; Provisional Back     alignment and domain information
>PLN00116 translation elongation factor EF-2 subunit; Provisional Back     alignment and domain information
>TIGR00490 aEF-2 translation elongation factor aEF-2 Back     alignment and domain information
>cd01886 EF-G Elongation factor G (EF-G) subfamily Back     alignment and domain information
>PRK07560 elongation factor EF-2; Reviewed Back     alignment and domain information
>cd01681 aeEF2_snRNP_like_IV This family represents domain IV of archaeal and eukaryotic elongation factor 2 (aeEF-2) and of an evolutionarily conserved U5 snRNP-specific protein Back     alignment and domain information
>cd04169 RF3 RF3 subfamily Back     alignment and domain information
>KOG0467|consensus Back     alignment and domain information
>cd04168 TetM_like Tet(M)-like subfamily Back     alignment and domain information
>CHL00071 tufA elongation factor Tu Back     alignment and domain information
>COG5256 TEF1 Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK12736 elongation factor Tu; Reviewed Back     alignment and domain information
>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily Back     alignment and domain information
>KOG0460|consensus Back     alignment and domain information
>PLN03126 Elongation factor Tu; Provisional Back     alignment and domain information
>PRK12735 elongation factor Tu; Reviewed Back     alignment and domain information
>PTZ00141 elongation factor 1- alpha; Provisional Back     alignment and domain information
>TIGR00485 EF-Tu translation elongation factor TU Back     alignment and domain information
>PLN00043 elongation factor 1-alpha; Provisional Back     alignment and domain information
>PRK00049 elongation factor Tu; Reviewed Back     alignment and domain information
>COG0480 FusA Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>COG0050 TufB GTPases - translation elongation factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN03127 Elongation factor Tu; Provisional Back     alignment and domain information
>PRK12739 elongation factor G; Reviewed Back     alignment and domain information
>PRK12317 elongation factor 1-alpha; Reviewed Back     alignment and domain information
>PRK05306 infB translation initiation factor IF-2; Validated Back     alignment and domain information
>TIGR02034 CysN sulfate adenylyltransferase, large subunit Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>PRK00007 elongation factor G; Reviewed Back     alignment and domain information
>PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>PRK13351 elongation factor G; Reviewed Back     alignment and domain information
>TIGR00484 EF-G translation elongation factor EF-G Back     alignment and domain information
>TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha Back     alignment and domain information
>cd01885 EF2 EF2 (for archaea and eukarya) Back     alignment and domain information
>KOG0458|consensus Back     alignment and domain information
>cd04098 eEF2_C_snRNP eEF2_C_snRNP: This family includes a C-terminal portion of the spliceosomal human 116kD U5 small nuclear ribonucleoprotein (snRNP) protein (U5-116 kD) and, its yeast counterpart Snu114p Back     alignment and domain information
>TIGR00487 IF-2 translation initiation factor IF-2 Back     alignment and domain information
>PTZ00327 eukaryotic translation initiation factor 2 gamma subunit; Provisional Back     alignment and domain information
>PRK12740 elongation factor G; Reviewed Back     alignment and domain information
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>KOG0465|consensus Back     alignment and domain information
>PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site Back     alignment and domain information
>PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional Back     alignment and domain information
>CHL00189 infB translation initiation factor 2; Provisional Back     alignment and domain information
>COG2895 CysN GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1217 TypA Predicted membrane GTPase involved in stress response [Signal transduction mechanisms] Back     alignment and domain information
>PRK04000 translation initiation factor IF-2 subunit gamma; Validated Back     alignment and domain information
>COG5257 GCD11 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF00679 EFG_C: Elongation factor G C-terminus; InterPro: IPR000640 Translation elongation factors are responsible for two main processes during protein synthesis on the ribosome [, , ] Back     alignment and domain information
>smart00838 EFG_C Elongation factor G C-terminus Back     alignment and domain information
>cd01884 EF_Tu EF-Tu subfamily Back     alignment and domain information
>TIGR03680 eif2g_arch translation initiation factor 2 subunit gamma Back     alignment and domain information
>TIGR00475 selB selenocysteine-specific elongation factor SelB Back     alignment and domain information
>cd04096 eEF2_snRNP_like_C eEF2_snRNP_like_C: this family represents a C-terminal domain of eukaryotic elongation factor 2 (eEF-2) and a homologous domain of the spliceosomal human 116kD U5 small nuclear ribonucleoprotein (snRNP) protein (U5-116 kD) and, its yeast counterpart Snu114p Back     alignment and domain information
>cd04097 mtEFG1_C mtEFG1_C: C-terminus of mitochondrial Elongation factor G1 (mtEFG1)-like proteins found in eukaryotes Back     alignment and domain information
>cd03711 Tet_C Tet_C: C-terminus of ribosomal protection proteins Tet(M) and Tet(O) Back     alignment and domain information
>cd03713 EFG_mtEFG_C EFG_mtEFG_C: domains similar to the C-terminal domain of the bacterial translational elongation factor (EF) EF-G Back     alignment and domain information
>COG3276 SelB Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF14492 EFG_II: Elongation Factor G, domain II; PDB: 1WDT_A 2DY1_A 2XEX_A 1ELO_A 2XSY_Y 2WRK_Y 1DAR_A 2WRI_Y 2XUY_Y 3J0E_H Back     alignment and domain information
>cd01885 EF2 EF2 (for archaea and eukarya) Back     alignment and domain information
>cd01514 Elongation_Factor_C Elongation factor G C-terminus Back     alignment and domain information
>PF03764 EFG_IV: Elongation factor G, domain IV; InterPro: IPR005517 Translation elongation factors are responsible for two main processes during protein synthesis on the ribosome [, , ] Back     alignment and domain information
>cd03710 BipA_TypA_C BipA_TypA_C: a C-terminal portion of BipA or TypA having homology to the C terminal domains of the elongation factors EF-G and EF-2 Back     alignment and domain information
>COG5256 TEF1 Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd04167 Snu114p Snu114p subfamily Back     alignment and domain information
>cd04166 CysN_ATPS CysN_ATPS subfamily Back     alignment and domain information
>KOG0462|consensus Back     alignment and domain information
>cd03709 lepA_C lepA_C: This family represents the C-terminal region of LepA, a GTP-binding protein localized in the cytoplasmic membrane Back     alignment and domain information
>cd04090 eEF2_II_snRNP Loc2 eEF2_C_snRNP, cd01514/C terminal domain:eEF2_C_snRNP: This family includes C-terminal portion of the spliceosomal human 116kD U5 small nuclear ribonucleoprotein (snRNP) protein (U5-116 kD) and, its yeast counterpart Snu114p Back     alignment and domain information
>COG5258 GTPBP1 GTPase [General function prediction only] Back     alignment and domain information
>cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily Back     alignment and domain information
>KOG1145|consensus Back     alignment and domain information
>KOG0459|consensus Back     alignment and domain information
>COG2895 CysN GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG0050 TufB GTPases - translation elongation factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK04004 translation initiation factor IF-2; Validated Back     alignment and domain information
>COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd01884 EF_Tu EF-Tu subfamily Back     alignment and domain information
>PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site Back     alignment and domain information
>TIGR02034 CysN sulfate adenylyltransferase, large subunit Back     alignment and domain information
>cd01890 LepA LepA subfamily Back     alignment and domain information
>cd01858 NGP_1 NGP-1 Back     alignment and domain information
>COG0481 LepA Membrane GTPase LepA [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PTZ00141 elongation factor 1- alpha; Provisional Back     alignment and domain information
>KOG0461|consensus Back     alignment and domain information
>PLN00043 elongation factor 1-alpha; Provisional Back     alignment and domain information
>KOG0460|consensus Back     alignment and domain information
>cd03690 Tet_II Tet_II: This subfamily represents domain II of ribosomal protection proteins Tet(M) and Tet(O) Back     alignment and domain information
>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2) Back     alignment and domain information
>PF03764 EFG_IV: Elongation factor G, domain IV; InterPro: IPR005517 Translation elongation factors are responsible for two main processes during protein synthesis on the ribosome [, , ] Back     alignment and domain information
>cd03700 eEF2_snRNP_like_II EF2_snRNP_like_II: this subfamily represents domain II of elongation factor (EF) EF-2 found eukaryotes and archaea and, the C-terminal portion of the spliceosomal human 116kD U5 small nuclear ribonucleoprotein (snRNP) protein (U5-116 kD) and, its yeast counterpart Snu114p Back     alignment and domain information
>TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2 Back     alignment and domain information
>KOG0458|consensus Back     alignment and domain information
>cd04092 mtEFG2_II_like mtEFG2_C: C-terminus of mitochondrial Elongation factor G2 (mtEFG2)-like proteins found in eukaryotes Back     alignment and domain information
>PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional Back     alignment and domain information
>cd01889 SelB_euk SelB subfamily Back     alignment and domain information
>COG4108 PrfC Peptide chain release factor RF-3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd01680 EFG_like_IV Elongation Factor G-like domain IV Back     alignment and domain information
>TIGR01394 TypA_BipA GTP-binding protein TypA/BipA Back     alignment and domain information
>cd04166 CysN_ATPS CysN_ATPS subfamily Back     alignment and domain information
>cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily Back     alignment and domain information
>PLN03126 Elongation factor Tu; Provisional Back     alignment and domain information
>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily Back     alignment and domain information
>cd01857 HSR1_MMR1 HSR1/MMR1 Back     alignment and domain information
>cd04088 EFG_mtEFG_II EFG_mtEFG_II: this subfamily represents the domain II of elongation factor G (EF-G) in bacteria and, the C-terminus of mitochondrial Elongation factor G1 (mtEFG1) and G2 (mtEFG2)_like proteins found in eukaryotes Back     alignment and domain information
>KOG3079|consensus Back     alignment and domain information
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>CHL00071 tufA elongation factor Tu Back     alignment and domain information
>KOG0464|consensus Back     alignment and domain information
>cd01886 EF-G Elongation factor G (EF-G) subfamily Back     alignment and domain information
>PRK12736 elongation factor Tu; Reviewed Back     alignment and domain information
>PRK10218 GTP-binding protein; Provisional Back     alignment and domain information
>cd04167 Snu114p Snu114p subfamily Back     alignment and domain information
>cd01849 YlqF_related_GTPase YlqF-related GTPases Back     alignment and domain information
>PRK12317 elongation factor 1-alpha; Reviewed Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>PLN03127 Elongation factor Tu; Provisional Back     alignment and domain information
>cd03689 RF3_II RF3_II: this subfamily represents the domain II of bacterial Release Factor 3 (RF3) Back     alignment and domain information
>PRK00049 elongation factor Tu; Reviewed Back     alignment and domain information
>TIGR00485 EF-Tu translation elongation factor TU Back     alignment and domain information
>cd03691 BipA_TypA_II BipA_TypA_II: domain II of BipA (also called TypA) having homology to domain II of the elongation factors (EFs) EF-G and EF-Tu Back     alignment and domain information
>cd04091 mtEFG1_II_like mtEFG1_C: C-terminus of mitochondrial Elongation factor G1 (mtEFG1)-like proteins found in eukaryotes Back     alignment and domain information
>COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional Back     alignment and domain information
>PF14492 EFG_II: Elongation Factor G, domain II; PDB: 1WDT_A 2DY1_A 2XEX_A 1ELO_A 2XSY_Y 2WRK_Y 1DAR_A 2WRI_Y 2XUY_Y 3J0E_H Back     alignment and domain information
>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>cd01684 Tet_like_IV EF-G_domain IV_RPP domain is a part of bacterial ribosomal protected proteins (RPP) family Back     alignment and domain information
>cd01855 YqeH YqeH Back     alignment and domain information
>PRK12735 elongation factor Tu; Reviewed Back     alignment and domain information
>cd04165 GTPBP1_like GTPBP1-like Back     alignment and domain information
>KOG1145|consensus Back     alignment and domain information
>cd01859 MJ1464 MJ1464 Back     alignment and domain information
>cd04168 TetM_like Tet(M)-like subfamily Back     alignment and domain information
>cd01856 YlqF YlqF Back     alignment and domain information
>PTZ00327 eukaryotic translation initiation factor 2 gamma subunit; Provisional Back     alignment and domain information
>PRK09563 rbgA GTPase YlqF; Reviewed Back     alignment and domain information
>cd04178 Nucleostemin_like Nucleostemin-like Back     alignment and domain information
>TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha Back     alignment and domain information
>COG1159 Era GTPase [General function prediction only] Back     alignment and domain information
>PLN02674 adenylate kinase Back     alignment and domain information
>TIGR00475 selB selenocysteine-specific elongation factor SelB Back     alignment and domain information
>cd04165 GTPBP1_like GTPBP1-like Back     alignment and domain information
>cd04169 RF3 RF3 subfamily Back     alignment and domain information
>cd00881 GTP_translation_factor GTP translation factor family Back     alignment and domain information
>PRK14529 adenylate kinase; Provisional Back     alignment and domain information
>cd01434 EFG_mtEFG1_IV EFG_mtEFG1_IV: domains similar to domain IV of the bacterial translational elongation factor (EF) EF-G Back     alignment and domain information
>PRK00741 prfC peptide chain release factor 3; Provisional Back     alignment and domain information
>cd03699 lepA_II lepA_II: This subfamily represents the domain II of LepA, a GTP-binding protein localized in the cytoplasmic membrane Back     alignment and domain information
>PRK14845 translation initiation factor IF-2; Provisional Back     alignment and domain information
>TIGR00503 prfC peptide chain release factor 3 Back     alignment and domain information
>PLN02459 probable adenylate kinase Back     alignment and domain information
>cd01693 mtEFG2_like_IV mtEF-G2 domain IV Back     alignment and domain information
>PRK12289 GTPase RsgA; Reviewed Back     alignment and domain information
>PRK05433 GTP-binding protein LepA; Provisional Back     alignment and domain information
>COG0486 ThdF Predicted GTPase [General function prediction only] Back     alignment and domain information
>COG3276 SelB Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily Back     alignment and domain information
>TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH Back     alignment and domain information
>KOG1191|consensus Back     alignment and domain information
>PRK13796 GTPase YqeH; Provisional Back     alignment and domain information
>PRK05306 infB translation initiation factor IF-2; Validated Back     alignment and domain information
>TIGR01393 lepA GTP-binding protein LepA Back     alignment and domain information
>PRK14526 adenylate kinase; Provisional Back     alignment and domain information
>cd01889 SelB_euk SelB subfamily Back     alignment and domain information
>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2) Back     alignment and domain information
>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions Back     alignment and domain information
>cd04171 SelB SelB subfamily Back     alignment and domain information
>KOG1144|consensus Back     alignment and domain information
>TIGR03680 eif2g_arch translation initiation factor 2 subunit gamma Back     alignment and domain information
>KOG0459|consensus Back     alignment and domain information
>PRK14528 adenylate kinase; Provisional Back     alignment and domain information
>TIGR00487 IF-2 translation initiation factor IF-2 Back     alignment and domain information
>TIGR00157 ribosome small subunit-dependent GTPase A Back     alignment and domain information
>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily Back     alignment and domain information
>PRK09554 feoB ferrous iron transport protein B; Reviewed Back     alignment and domain information
>PRK13808 adenylate kinase; Provisional Back     alignment and domain information
>cd04171 SelB SelB subfamily Back     alignment and domain information
>PRK04004 translation initiation factor IF-2; Validated Back     alignment and domain information
>COG5257 GCD11 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd01854 YjeQ_engC YjeQ/EngC Back     alignment and domain information
>TIGR01351 adk adenylate kinases Back     alignment and domain information
>PRK12288 GTPase RsgA; Reviewed Back     alignment and domain information
>cd01680 EFG_like_IV Elongation Factor G-like domain IV Back     alignment and domain information
>PRK00098 GTPase RsgA; Reviewed Back     alignment and domain information
>TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2 Back     alignment and domain information
>CHL00189 infB translation initiation factor 2; Provisional Back     alignment and domain information
>PRK14845 translation initiation factor IF-2; Provisional Back     alignment and domain information
>PRK04000 translation initiation factor IF-2 subunit gamma; Validated Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>cd01890 LepA LepA subfamily Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>cd01895 EngA2 EngA2 subfamily Back     alignment and domain information
>KOG0466|consensus Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>KOG0461|consensus Back     alignment and domain information
>PTZ00088 adenylate kinase 1; Provisional Back     alignment and domain information
>PRK15494 era GTPase Era; Provisional Back     alignment and domain information
>cd01894 EngA1 EngA1 subfamily Back     alignment and domain information
>cd00881 GTP_translation_factor GTP translation factor family Back     alignment and domain information
>TIGR00436 era GTP-binding protein Era Back     alignment and domain information
>COG1161 Predicted GTPases [General function prediction only] Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily Back     alignment and domain information
>PRK14527 adenylate kinase; Provisional Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>PRK00279 adk adenylate kinase; Reviewed Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>COG1159 Era GTPase [General function prediction only] Back     alignment and domain information
>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily Back     alignment and domain information
>PRK00089 era GTPase Era; Reviewed Back     alignment and domain information
>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE Back     alignment and domain information
>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1) Back     alignment and domain information
>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed Back     alignment and domain information
>PF03144 GTP_EFTU_D2: Elongation factor Tu domain 2; InterPro: IPR004161 Translation elongation factors are responsible for two main processes during protein synthesis on the ribosome [, , ] Back     alignment and domain information
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes Back     alignment and domain information
>cd01684 Tet_like_IV EF-G_domain IV_RPP domain is a part of bacterial ribosomal protected proteins (RPP) family Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>PLN02200 adenylate kinase family protein Back     alignment and domain information
>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily Back     alignment and domain information
>cd01894 EngA1 EngA1 subfamily Back     alignment and domain information
>PRK09866 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>PRK01889 GTPase RsgA; Reviewed Back     alignment and domain information
>KOG2423|consensus Back     alignment and domain information
>PRK02496 adk adenylate kinase; Provisional Back     alignment and domain information
>KOG1144|consensus Back     alignment and domain information
>cd01898 Obg Obg subfamily Back     alignment and domain information
>COG1162 Predicted GTPases [General function prediction only] Back     alignment and domain information
>cd01882 BMS1 Bms1 Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>cd01434 EFG_mtEFG1_IV EFG_mtEFG1_IV: domains similar to domain IV of the bacterial translational elongation factor (EF) EF-G Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>KOG2484|consensus Back     alignment and domain information
>KOG1424|consensus Back     alignment and domain information
>KOG0052|consensus Back     alignment and domain information
>TIGR00231 small_GTP small GTP-binding protein domain Back     alignment and domain information
>cd01895 EngA2 EngA2 subfamily Back     alignment and domain information
>TIGR00436 era GTP-binding protein Era Back     alignment and domain information
>TIGR03156 GTP_HflX GTP-binding protein HflX Back     alignment and domain information
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans Back     alignment and domain information
>KOG1143|consensus Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>KOG1423|consensus Back     alignment and domain information
>PRK04213 GTP-binding protein; Provisional Back     alignment and domain information
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>cd01882 BMS1 Bms1 Back     alignment and domain information
>PRK00454 engB GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>PLN02842 nucleotide kinase Back     alignment and domain information
>COG2229 Predicted GTPase [General function prediction only] Back     alignment and domain information
>KOG0463|consensus Back     alignment and domain information
>PRK11058 GTPase HflX; Provisional Back     alignment and domain information
>cd00880 Era_like Era (E Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>PRK12298 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>PRK00089 era GTPase Era; Reviewed Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>COG2229 Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd01693 mtEFG2_like_IV mtEF-G2 domain IV Back     alignment and domain information
>COG0370 FeoB Fe2+ transport system protein B [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK15494 era GTPase Era; Provisional Back     alignment and domain information
>cd04114 Rab30 Rab30 subfamily Back     alignment and domain information
>KOG2485|consensus Back     alignment and domain information
>COG0218 Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily Back     alignment and domain information
>cd01861 Rab6 Rab6 subfamily Back     alignment and domain information
>cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta) Back     alignment and domain information
>cd01864 Rab19 Rab19 subfamily Back     alignment and domain information
>TIGR02836 spore_IV_A stage IV sporulation protein A Back     alignment and domain information
>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta) Back     alignment and domain information
>TIGR00437 feoB ferrous iron transporter FeoB Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>cd04124 RabL2 RabL2 subfamily Back     alignment and domain information
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases Back     alignment and domain information
>PRK15467 ethanolamine utilization protein EutP; Provisional Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>cd01864 Rab19 Rab19 subfamily Back     alignment and domain information
>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases Back     alignment and domain information
>smart00053 DYNc Dynamin, GTPase Back     alignment and domain information
>KOG3078|consensus Back     alignment and domain information
>cd04154 Arl2 Arl2 subfamily Back     alignment and domain information
>TIGR00991 3a0901s02IAP34 GTP-binding protein (Chloroplast Envelope Protein Translocase) Back     alignment and domain information
>cd04151 Arl1 Arl1 subfamily Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>cd01866 Rab2 Rab2 subfamily Back     alignment and domain information
>COG0486 ThdF Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts) Back     alignment and domain information
>PRK12299 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>KOG0052|consensus Back     alignment and domain information
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily Back     alignment and domain information
>PTZ00258 GTP-binding protein; Provisional Back     alignment and domain information
>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions Back     alignment and domain information
>cd01863 Rab18 Rab18 subfamily Back     alignment and domain information
>PRK12296 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd01860 Rab5_related Rab5-related subfamily Back     alignment and domain information
>KOG0466|consensus Back     alignment and domain information
>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily Back     alignment and domain information
>TIGR02528 EutP ethanolamine utilization protein, EutP Back     alignment and domain information
>PRK12297 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily Back     alignment and domain information
>cd00157 Rho Rho (Ras homology) family Back     alignment and domain information
>cd01342 Translation_Factor_II_like Translation_Factor_II_like: Elongation factor Tu (EF-Tu) domain II-like proteins Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>cd04147 Ras_dva Ras-dva subfamily Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>PF00350 Dynamin_N: Dynamin family; InterPro: IPR001401 Membrane transport between compartments in eukaryotic cells requires proteins that allow the budding and scission of nascent cargo vesicles from one compartment and their targeting and fusion with another Back     alignment and domain information
>cd03698 eRF3_II_like eRF3_II_like: domain similar to domain II of the eukaryotic class II release factor (eRF3) Back     alignment and domain information
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily Back     alignment and domain information
>cd04151 Arl1 Arl1 subfamily Back     alignment and domain information
>cd01900 YchF YchF subfamily Back     alignment and domain information
>COG1084 Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins Back     alignment and domain information
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily Back     alignment and domain information
>cd04157 Arl6 Arl6 subfamily Back     alignment and domain information
>cd04157 Arl6 Arl6 subfamily Back     alignment and domain information
>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>cd01893 Miro1 Miro1 subfamily Back     alignment and domain information
>TIGR00231 small_GTP small GTP-binding protein domain Back     alignment and domain information
>cd00880 Era_like Era (E Back     alignment and domain information
>PF09439 SRPRB: Signal recognition particle receptor beta subunit; InterPro: IPR019009 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK09601 GTP-binding protein YchF; Reviewed Back     alignment and domain information
>PLN03118 Rab family protein; Provisional Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>cd04142 RRP22 RRP22 subfamily Back     alignment and domain information
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 Back     alignment and domain information
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily Back     alignment and domain information
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes Back     alignment and domain information
>cd01850 CDC_Septin CDC/Septin Back     alignment and domain information
>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE Back     alignment and domain information
>PRK09554 feoB ferrous iron transport protein B; Reviewed Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>cd04135 Tc10 TC10 subfamily Back     alignment and domain information
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily Back     alignment and domain information
>cd04177 RSR1 RSR1 subgroup Back     alignment and domain information
>cd01868 Rab11_like Rab11-like Back     alignment and domain information
>cd01876 YihA_EngB The YihA (EngB) subfamily Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>cd01863 Rab18 Rab18 subfamily Back     alignment and domain information
>PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction AMP + MgATP = ADP + MgADP an essential reaction for many processes in living cells Back     alignment and domain information
>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily Back     alignment and domain information
>PF04548 AIG1: AIG1 family; InterPro: IPR006703 This entry represents a domain found in Arabidopsis protein AIG1 which appears to be involved in plant resistance to bacteria Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>cd04106 Rab23_lke Rab23-like subfamily Back     alignment and domain information
>TIGR02729 Obg_CgtA Obg family GTPase CgtA Back     alignment and domain information
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily Back     alignment and domain information
>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>cd04147 Ras_dva Ras-dva subfamily Back     alignment and domain information
>COG5258 GTPBP1 GTPase [General function prediction only] Back     alignment and domain information
>cd04140 ARHI_like ARHI subfamily Back     alignment and domain information
>cd04175 Rap1 Rap1 subgroup Back     alignment and domain information
>PTZ00369 Ras-like protein; Provisional Back     alignment and domain information
>cd01860 Rab5_related Rab5-related subfamily Back     alignment and domain information
>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed Back     alignment and domain information
>PRK12298 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd01862 Rab7 Rab7 subfamily Back     alignment and domain information
>cd04124 RabL2 RabL2 subfamily Back     alignment and domain information
>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases Back     alignment and domain information
>PRK15467 ethanolamine utilization protein EutP; Provisional Back     alignment and domain information
>cd04158 ARD1 ARD1 subfamily Back     alignment and domain information
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases Back     alignment and domain information
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily Back     alignment and domain information
>cd04154 Arl2 Arl2 subfamily Back     alignment and domain information
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily Back     alignment and domain information
>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases Back     alignment and domain information
>cd04156 ARLTS1 ARLTS1 subfamily Back     alignment and domain information
>cd04149 Arf6 Arf6 subfamily Back     alignment and domain information
>cd03693 EF1_alpha_II EF1_alpha_II: this family represents the domain II of elongation factor 1-alpha (EF-1a) that is found in archaea and all eukaryotic lineages Back     alignment and domain information
>cd04104 p47_IIGP_like p47 (47-kDa) family Back     alignment and domain information
>cd00882 Ras_like_GTPase Ras-like GTPase superfamily Back     alignment and domain information
>cd01893 Miro1 Miro1 subfamily Back     alignment and domain information
>cd01870 RhoA_like RhoA-like subfamily Back     alignment and domain information
>cd01898 Obg Obg subfamily Back     alignment and domain information
>cd04118 Rab24 Rab24 subfamily Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>cd04136 Rap_like Rap-like subfamily Back     alignment and domain information
>cd01850 CDC_Septin CDC/Septin Back     alignment and domain information
>cd00876 Ras Ras family Back     alignment and domain information
>cd01861 Rab6 Rab6 subfamily Back     alignment and domain information
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans Back     alignment and domain information
>cd04123 Rab21 Rab21 subfamily Back     alignment and domain information
>cd04130 Wrch_1 Wrch-1 subfamily Back     alignment and domain information
>TIGR03156 GTP_HflX GTP-binding protein HflX Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>COG0218 Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily Back     alignment and domain information
>TIGR00437 feoB ferrous iron transporter FeoB Back     alignment and domain information
>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily Back     alignment and domain information
>smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>PRK00454 engB GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>cd04112 Rab26 Rab26 subfamily Back     alignment and domain information
>cd01865 Rab3 Rab3 subfamily Back     alignment and domain information
>cd04134 Rho3 Rho3 subfamily Back     alignment and domain information
>COG5192 BMS1 GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd04156 ARLTS1 ARLTS1 subfamily Back     alignment and domain information
>TIGR02528 EutP ethanolamine utilization protein, EutP Back     alignment and domain information
>cd04114 Rab30 Rab30 subfamily Back     alignment and domain information
>cd04149 Arf6 Arf6 subfamily Back     alignment and domain information
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>cd04110 Rab35 Rab35 subfamily Back     alignment and domain information
>PRK11058 GTPase HflX; Provisional Back     alignment and domain information
>cd04106 Rab23_lke Rab23-like subfamily Back     alignment and domain information
>cd04158 ARD1 ARD1 subfamily Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>PLN00223 ADP-ribosylation factor; Provisional Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>cd04132 Rho4_like Rho4-like subfamily Back     alignment and domain information
>cd04176 Rap2 Rap2 subgroup Back     alignment and domain information
>PTZ00133 ADP-ribosylation factor; Provisional Back     alignment and domain information
>cd00882 Ras_like_GTPase Ras-like GTPase superfamily Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>cd04101 RabL4 RabL4 (Rab-like4) subfamily Back     alignment and domain information
>PTZ00369 Ras-like protein; Provisional Back     alignment and domain information
>cd04122 Rab14 Rab14 subfamily Back     alignment and domain information
>cd04089 eRF3_II eRF3_II: domain II of the eukaryotic class II release factor (eRF3) Back     alignment and domain information
>cd04127 Rab27A Rab27a subfamily Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>PRK04213 GTP-binding protein; Provisional Back     alignment and domain information
>cd04144 Ras2 Ras2 subfamily Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>cd04140 ARHI_like ARHI subfamily Back     alignment and domain information
>PLN03071 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>PTZ00133 ADP-ribosylation factor; Provisional Back     alignment and domain information
>cd01866 Rab2 Rab2 subfamily Back     alignment and domain information
>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily Back     alignment and domain information
>cd04125 RabA_like RabA-like subfamily Back     alignment and domain information
>PTZ00099 rab6; Provisional Back     alignment and domain information
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily Back     alignment and domain information
>cd04150 Arf1_5_like Arf1-Arf5-like subfamily Back     alignment and domain information
>cd04150 Arf1_5_like Arf1-Arf5-like subfamily Back     alignment and domain information
>cd04126 Rab20 Rab20 subfamily Back     alignment and domain information
>cd04177 RSR1 RSR1 subgroup Back     alignment and domain information
>PLN03108 Rab family protein; Provisional Back     alignment and domain information
>COG1163 DRG Predicted GTPase [General function prediction only] Back     alignment and domain information
>PLN03118 Rab family protein; Provisional Back     alignment and domain information
>PRK12296 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>cd04116 Rab9 Rab9 subfamily Back     alignment and domain information
>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily Back     alignment and domain information
>cd04110 Rab35 Rab35 subfamily Back     alignment and domain information
>cd04148 RGK RGK subfamily Back     alignment and domain information
>cd01862 Rab7 Rab7 subfamily Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily Back     alignment and domain information
>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1) Back     alignment and domain information
>cd04135 Tc10 TC10 subfamily Back     alignment and domain information
>PF09439 SRPRB: Signal recognition particle receptor beta subunit; InterPro: IPR019009 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>cd04101 RabL4 RabL4 (Rab-like4) subfamily Back     alignment and domain information
>cd04111 Rab39 Rab39 subfamily Back     alignment and domain information
>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily Back     alignment and domain information
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 Back     alignment and domain information
>PLN00223 ADP-ribosylation factor; Provisional Back     alignment and domain information
>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily Back     alignment and domain information
>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1291
1n0v_C842 Crystal Structure Of Elongation Factor 2 Length = 8 1e-109
1u2r_A842 Crystal Structure Of Adp-Ribosylated Ribosomal Tran 1e-108
1tev_A196 Crystal Structure Of The Human UmpCMP KINASE IN OPE 2e-27
2bm0_A691 Ribosomal Elongation Factor G (Ef-G) Fusidic Acid R 6e-21
1efg_A691 The Crystal Structure Of Elongation Factor G Comple 6e-21
2j7k_A691 Crystal Structure Of The T84a Mutant Ef-G:gdpcp Com 6e-21
2bm1_A691 Ribosomal Elongation Factor G (Ef-G) Fusidic Acid R 6e-21
3izp_E688 Conformation Of Ef-G During Translocation Length = 6e-21
1fnm_A691 Structure Of Thermus Thermophilus Ef-G H573a Length 6e-21
1ktv_A691 Crystal Structure Of Elongation Factor G Dimer With 6e-21
1zn0_B655 Coordinates Of Rrf And Ef-G Fitted Into Cryo-Em Map 7e-21
2bv3_A691 Crystal Structure Of A Mutant Elongation Factor G T 9e-21
1uky_A203 Substrate Specificity And Assembly Of Catalytic Cen 3e-18
3zzt_A693 Crystal Structure Of Staphylococcus Aureus Elongati 5e-18
2xex_A693 Crystal Structure Of Staphylococcus Aureus Elongati 5e-18
3zzu_A693 Crystal Structure Of Staphylococcus Aureus Elongati 5e-18
3zz0_A693 Crystal Structure Of Ribosomal Elongation Factor (E 5e-18
4fn5_A709 Elongation Factor G 1 (Pseudomonas Aeruginosa) In C 2e-17
3adk_A195 Refined Structure Of Porcine Cytosolic Adenylate Ki 7e-16
3j0e_H702 Models For The T. Thermophilus Ribosome Recycling F 1e-15
2rdo_7704 50s Subunit With Ef-G(Gdpnp) And Rrf Bound Length = 1e-15
1z83_A196 Crystal Structure Of Human Ak1a In Complex With Ap5 2e-15
1qf9_A194 Ph Influences Fluoride Coordination Number Of The A 3e-15
3umf_A217 Schistosoma Mansoni Adenylate Kinase Length = 217 2e-09
3cm0_A186 Crystal Structure Of Adenylate Kinase From Thermus 2e-08
3tlx_A243 Crystal Structure Of Pf10_0086, Adenylate Kinase Fr 4e-08
1zin_A217 Adenylate Kinase With Bound Ap5a Length = 217 1e-07
2ywg_A600 Crystal Structure Of Gtp-Bound Lepa From Aquifex Ae 2e-07
2ywg_A600 Crystal Structure Of Gtp-Bound Lepa From Aquifex Ae 3e-06
2ywe_A600 Crystal Structure Of Lepa From Aquifex Aeolicus Len 3e-07
2ywe_A600 Crystal Structure Of Lepa From Aquifex Aeolicus Len 1e-06
3deg_C545 Complex Of Elongating Escherichia Coli 70s Ribosome 3e-07
3cb4_D599 The Crystal Structure Of Lepa Length = 599 3e-07
3j25_A638 Structural Basis For Tetm-Mediated Tetracycline Res 4e-07
2rgx_A206 Crystal Structure Of Adenylate Kinase From Aquifex 1e-06
2bwj_A199 Structure Of Adenylate Kinase 5 Length = 199 2e-06
1e4v_A214 Mutant G10v Of Adenylate Kinase From E. Coli, Modif 3e-06
1e4y_A214 Mutant P9l Of Adenylate Kinase From E. Coli, Modifi 3e-06
1ake_A214 Structure Of The Complex Between Adenylate Kinase F 3e-06
3hpr_A214 Crystal Structure Of V148g Adenylate Kinase From E. 4e-06
2c9y_A242 Structure Of Human Adenylate Kinase 2 Length = 242 4e-06
2cdn_A201 Crystal Structure Of Mycobacterium Tuberculosis Ade 5e-06
1p4s_A181 Solution Structure Of Mycobacterium Tuberculosis Ad 6e-06
3be4_A217 Crystal Structure Of Cryptosporidium Parvum Adenyla 7e-06
1s3g_A217 Crystal Structure Of Adenylate Kinase From Bacillus 1e-05
1ak2_A233 Adenylate Kinase Isoenzyme-2 Length = 233 2e-05
3dkv_A217 Crystal Structure Of Adenylate Kinase Variant Aklse 6e-05
1aky_A220 High-Resolution Structures Of Adenylate Kinase From 1e-04
3aky_A220 Stability, Activity And Structure Of Adenylate Kina 1e-04
2qaj_A217 Crystal Structure Of A Thermostable Mutant Of Bacil 2e-04
2p3s_A217 Crystal Structure Of A Thermostable Mutant Of Bacil 2e-04
2osb_A216 Crystal Structure Of A Thermostable Mutant Of Bacil 2e-04
2eu8_A216 Crystal Structure Of A Thermostable Mutant Of Bacil 2e-04
1p3j_A217 Adenylate Kinase From Bacillus Subtilis Length = 21 2e-04
3dl0_A216 Crystal Structure Of Adenylate Kinase Variant Aklse 3e-04
2ori_A216 Crystal Structure Of A Thermostable Mutant Of Bacil 3e-04
3fb4_A216 Crystal Structure Of Adenylate Kinase From Mariniba 4e-04
3gmt_A230 Crystal Structure Of Adenylate Kinase From Burkhold 5e-04
1jqs_C68 Fitting Of L11 Protein And Elongation Factor G (Dom 7e-04
2oo7_A217 Crystal Structure Of A Thermostable Mutant Of Bacil 8e-04
>pdb|1N0V|C Chain C, Crystal Structure Of Elongation Factor 2 Length = 842 Back     alignment and structure 
Iteration: 1

 Score =  394 bits (1013), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 196/500 (39%), Positives = 303/500 (60%), Gaps = 19/500 (3%)
Query: 767  KVSYMYTGPGDSDVARDMKACNPEGRLMVHSSKMYPTEECTFFQVLARVMSGTLHAGQEV 826
            +   +Y GP D      +K C+P+  LM++ SKM PT +   F    RV +GT+ +GQ+V
Sbjct: 352  RAEQLYEGPADDANCIAIKNCDPKADLMLYVSKMVPTSDKGRFYAFGRVFAGTVKSGQKV 411
Query: 827  RVLGENYSLMDEEDSRILTVGRLWIYEARYKVEVNRVPAGNWVLIEGIDQPIVKTSTITD 886
            R+ G NY    ++D  I  + R+ +   R+   ++  PAGN + + GIDQ ++KT T+T 
Sbjct: 412  RIQGPNYVPGKKDDLFIKAIQRVVLMMGRFVEPIDDCPAGNIIGLVGIDQFLLKTGTLT- 470
Query: 887  LITNEDMYIFRPLKFNTQSVIKIAVEPVNPSELPKMLDGLRKVNKSYPLLTTKVEESGEH 946
              T+E  +  + +KF+   V+++AVE  N ++LPK+++GL++++KS P + T + ESGEH
Sbjct: 471  --TSETAHNMKVMKFSVSPVVQVAVEVKNANDLPKLVEGLKRLSKSDPCVLTYMSESGEH 528
Query: 947  VVLGTGELYLDCVMHDLRKMYSEIDIKVADPVVAFCETVVETSSLKCFAETPNKRNKITM 1006
            +V GTGEL+L+  + DL   ++ + +K++ PVVA+ ETV   SS    +++PNK N+I +
Sbjct: 529  IVAGTGELHLEICLQDLEHDHAGVPLKISPPVVAYRETVESESSQTALSKSPNKHNRIYL 588
Query: 1007 IAEPLEKGLAEDIENQIVHIAWNKKRLGEFFQSKYDWDLLAARSIWAFGPEVTGPNILVD 1066
             AEP+++ ++  IEN I++   + K         Y WD+  AR IW FGP+  GPN+++D
Sbjct: 589  KAEPIDEEVSLAIENGIINPRDDFKARARIMADDYGWDVTDARKIWCFGPDGNGPNLVID 648
Query: 1067 DTLPSEVDKGLLGSVKDSIVQGFQWGTREGPLCEEPIRNVKFKILDAVIATEPLHRGGGQ 1126
             T   +     L  +KDS+V  FQW T+EGP+  E +R+V+  ILD  +  + +HRGGGQ
Sbjct: 649  QTKAVQ----YLHEIKDSVVAAFQWATKEGPIFGEEMRSVRVNILDVTLHADAIHRGGGQ 704
Query: 1127 IIPTARRVAYSAFLMATPRLMEPYLFVEVQAPADCVSAVYTVLAKRRGHVTQDAPVPGSP 1186
            IIPT RR  Y+ FL+A P++ EP   VE+Q P   V  +Y+VL K+RG V  +   PG+P
Sbjct: 705  IIPTMRRATYAGFLLADPKIQEPVFLVEIQCPEQAVGGIYSVLNKKRGQVVSEEQRPGTP 764
Query: 1187 LYTIKAFIPAIDSFGFETDLRTHTQGQAFCLSVFHHWQIVPGDPLDKSIVIRPLEPQPAT 1246
            L+T+KA++P  +SFGF  +LR  T GQAF   VF HW  +  DPLD             T
Sbjct: 765  LFTVKAYLPVNESFGFTGELRQATGGQAFPQMVFDHWSTLGSDPLD------------PT 812
Query: 1247 HLAREFMIKTRRRKGLSEDV 1266
              A E ++  R+R G+ E+V
Sbjct: 813  SKAGEIVLAARKRHGMKEEV 832
>pdb|1U2R|A Chain A, Crystal Structure Of Adp-Ribosylated Ribosomal Translocase From Saccharomyces Cerevisiae Length = 842 Back     alignment and structure
>pdb|1TEV|A Chain A, Crystal Structure Of The Human UmpCMP KINASE IN OPEN Conformation Length = 196 Back     alignment and structure
>pdb|2BM0|A Chain A, Ribosomal Elongation Factor G (Ef-G) Fusidic Acid Resistant Mutant T84a Length = 691 Back     alignment and structure
>pdb|1EFG|A Chain A, The Crystal Structure Of Elongation Factor G Complexed With Gdp, At 2.7 Angstroms Resolution Length = 691 Back     alignment and structure
>pdb|2J7K|A Chain A, Crystal Structure Of The T84a Mutant Ef-G:gdpcp Complex Length = 691 Back     alignment and structure
>pdb|2BM1|A Chain A, Ribosomal Elongation Factor G (Ef-G) Fusidic Acid Resistant Mutant G16v Length = 691 Back     alignment and structure
>pdb|3IZP|E Chain E, Conformation Of Ef-G During Translocation Length = 688 Back     alignment and structure
>pdb|1FNM|A Chain A, Structure Of Thermus Thermophilus Ef-G H573a Length = 691 Back     alignment and structure
>pdb|1KTV|A Chain A, Crystal Structure Of Elongation Factor G Dimer Without Nucleotide Length = 691 Back     alignment and structure
>pdb|1ZN0|B Chain B, Coordinates Of Rrf And Ef-G Fitted Into Cryo-Em Map Of The 50s Subunit Bound With Both Ef-G (Gdpnp) And Rrf Length = 655 Back     alignment and structure
>pdb|2BV3|A Chain A, Crystal Structure Of A Mutant Elongation Factor G Trapped With A Gtp Analogue Length = 691 Back     alignment and structure
>pdb|1UKY|A Chain A, Substrate Specificity And Assembly Of Catalytic Center Derived From Two Structures Of Ligated Uridylate Kinase Length = 203 Back     alignment and structure
>pdb|3ZZT|A Chain A, Crystal Structure Of Staphylococcus Aureus Elongation Factor G With A Fusidic-Acid-Resistant Mutation F88l Length = 693 Back     alignment and structure
>pdb|2XEX|A Chain A, Crystal Structure Of Staphylococcus Aureus Elongation Factor G Length = 693 Back     alignment and structure
>pdb|3ZZU|A Chain A, Crystal Structure Of Staphylococcus Aureus Elongation Factor G With Mutations M16i And F88l Length = 693 Back     alignment and structure
>pdb|3ZZ0|A Chain A, Crystal Structure Of Ribosomal Elongation Factor (Ef)-G From Staphylococcus Aureus With A Fusidic Acid Hyper-Sensitivity Mutation M16i Length = 693 Back     alignment and structure
>pdb|4FN5|A Chain A, Elongation Factor G 1 (Pseudomonas Aeruginosa) In Complex With Argyrin B Length = 709 Back     alignment and structure
>pdb|3ADK|A Chain A, Refined Structure Of Porcine Cytosolic Adenylate Kinase At 2.1 Angstroms Resolution Length = 195 Back     alignment and structure
>pdb|3J0E|H Chain H, Models For The T. Thermophilus Ribosome Recycling Factor And The E. Coli Elongation Factor G Bound To The E. Coli Post-Termination Complex Length = 702 Back     alignment and structure
>pdb|2RDO|7 Chain 7, 50s Subunit With Ef-G(Gdpnp) And Rrf Bound Length = 704 Back     alignment and structure
>pdb|1Z83|A Chain A, Crystal Structure Of Human Ak1a In Complex With Ap5a Length = 196 Back     alignment and structure
>pdb|1QF9|A Chain A, Ph Influences Fluoride Coordination Number Of The Alfx Phosphoryl Transfer Transition State Analog In UmpCMP Kinase Length = 194 Back     alignment and structure
>pdb|3UMF|A Chain A, Schistosoma Mansoni Adenylate Kinase Length = 217 Back     alignment and structure
>pdb|3CM0|A Chain A, Crystal Structure Of Adenylate Kinase From Thermus Thermophilus Hb8 Length = 186 Back     alignment and structure
>pdb|3TLX|A Chain A, Crystal Structure Of Pf10_0086, Adenylate Kinase From Plasmodium Falciparum Length = 243 Back     alignment and structure
>pdb|1ZIN|A Chain A, Adenylate Kinase With Bound Ap5a Length = 217 Back     alignment and structure
>pdb|2YWG|A Chain A, Crystal Structure Of Gtp-Bound Lepa From Aquifex Aeolicus Length = 600 Back     alignment and structure
>pdb|2YWG|A Chain A, Crystal Structure Of Gtp-Bound Lepa From Aquifex Aeolicus Length = 600 Back     alignment and structure
>pdb|2YWE|A Chain A, Crystal Structure Of Lepa From Aquifex Aeolicus Length = 600 Back     alignment and structure
>pdb|2YWE|A Chain A, Crystal Structure Of Lepa From Aquifex Aeolicus Length = 600 Back     alignment and structure
>pdb|3DEG|C Chain C, Complex Of Elongating Escherichia Coli 70s Ribosome And Ef4(Lepa)- Gmppnp Length = 545 Back     alignment and structure
>pdb|3CB4|D Chain D, The Crystal Structure Of Lepa Length = 599 Back     alignment and structure
>pdb|3J25|A Chain A, Structural Basis For Tetm-Mediated Tetracycline Resistance Length = 638 Back     alignment and structure
>pdb|2RGX|A Chain A, Crystal Structure Of Adenylate Kinase From Aquifex Aeolicus In Complex With Ap5a Length = 206 Back     alignment and structure
>pdb|2BWJ|A Chain A, Structure Of Adenylate Kinase 5 Length = 199 Back     alignment and structure
>pdb|1E4V|A Chain A, Mutant G10v Of Adenylate Kinase From E. Coli, Modified In The Gly-Loop Length = 214 Back     alignment and structure
>pdb|1E4Y|A Chain A, Mutant P9l Of Adenylate Kinase From E. Coli, Modified In The Gly-Loop Length = 214 Back     alignment and structure
>pdb|1AKE|A Chain A, Structure Of The Complex Between Adenylate Kinase From Escherichia Coli And The Inhibitor Ap5a Refined At 1.9 Angstroms Resolution: A Model For A Catalytic Transition State Length = 214 Back     alignment and structure
>pdb|3HPR|A Chain A, Crystal Structure Of V148g Adenylate Kinase From E. Coli, In Complex With Ap5a Length = 214 Back     alignment and structure
>pdb|2C9Y|A Chain A, Structure Of Human Adenylate Kinase 2 Length = 242 Back     alignment and structure
>pdb|2CDN|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis Adenylate Kinase Complexed With Two Molecules Of Adp And Mg Length = 201 Back     alignment and structure
>pdb|1P4S|A Chain A, Solution Structure Of Mycobacterium Tuberculosis Adenylate Kinase Length = 181 Back     alignment and structure
>pdb|3BE4|A Chain A, Crystal Structure Of Cryptosporidium Parvum Adenylate Kinase Cgd5_3360 Length = 217 Back     alignment and structure
>pdb|1S3G|A Chain A, Crystal Structure Of Adenylate Kinase From Bacillus Globisporus Length = 217 Back     alignment and structure
>pdb|1AK2|A Chain A, Adenylate Kinase Isoenzyme-2 Length = 233 Back     alignment and structure
>pdb|3DKV|A Chain A, Crystal Structure Of Adenylate Kinase Variant Aklse1 Length = 217 Back     alignment and structure
>pdb|1AKY|A Chain A, High-Resolution Structures Of Adenylate Kinase From Yeast Ligated With Inhibitor Ap5a, Showing The Pathway Of Phosphoryl Transfer Length = 220 Back     alignment and structure
>pdb|3AKY|A Chain A, Stability, Activity And Structure Of Adenylate Kinase Mutants Length = 220 Back     alignment and structure
>pdb|2QAJ|A Chain A, Crystal Structure Of A Thermostable Mutant Of Bacillus Subtilis Adenylate Kinase (Q199rG213E) Length = 217 Back     alignment and structure
>pdb|2P3S|A Chain A, Crystal Structure Of A Thermostable Mutant Of Bacillus Subtilis Adenylate Kinase (G214rQ199R) Length = 217 Back     alignment and structure
>pdb|2OSB|A Chain A, Crystal Structure Of A Thermostable Mutant Of Bacillus Subtilis Adenylate Kinase (q16l/q199r/) Length = 216 Back     alignment and structure
>pdb|2EU8|A Chain A, Crystal Structure Of A Thermostable Mutant Of Bacillus Subtilis Adenylate Kinase (Q199r) Length = 216 Back     alignment and structure
>pdb|1P3J|A Chain A, Adenylate Kinase From Bacillus Subtilis Length = 217 Back     alignment and structure
>pdb|3DL0|A Chain A, Crystal Structure Of Adenylate Kinase Variant Aklse3 Length = 216 Back     alignment and structure
>pdb|2ORI|A Chain A, Crystal Structure Of A Thermostable Mutant Of Bacillus Subtilis Adenylate Kinase (A193vQ199R) Length = 216 Back     alignment and structure
>pdb|3FB4|A Chain A, Crystal Structure Of Adenylate Kinase From Marinibacillus Marinus Length = 216 Back     alignment and structure
>pdb|3GMT|A Chain A, Crystal Structure Of Adenylate Kinase From Burkholderia Pseu Length = 230 Back     alignment and structure
>pdb|1JQS|C Chain C, Fitting Of L11 Protein And Elongation Factor G (Domain G' And V) In The Cryo-Em Map Of E. Coli 70s Ribosome Bound With Ef-G And Gmppcp, A Nonhydrolysable Gtp Analog Length = 68 Back     alignment and structure
>pdb|2OO7|A Chain A, Crystal Structure Of A Thermostable Mutant Of Bacillus Subtilis Adenylate Kinase (T179iQ199R) Length = 217 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1291
1n0u_A842 EF-2, elongation factor 2; G-protein, CIS-proline, 0.0
1n0u_A842 EF-2, elongation factor 2; G-protein, CIS-proline, 3e-61
1n0u_A842 EF-2, elongation factor 2; G-protein, CIS-proline, 1e-32
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 1e-38
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 2e-38
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 3e-37
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 2e-36
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 8e-36
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 3e-22
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 8e-19
2rgx_A206 Adenylate kinase; transferase(phosphotransferase), 1e-18
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 2e-18
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 2e-18
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 5e-18
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-17
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-07
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
3tlx_A243 Adenylate kinase 2; structural genomics, structura 5e-17
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 6e-17
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 1e-16
1dar_A691 EF-G, elongation factor G; ribosomal translocase, 3e-16
2rdo_7704 EF-G, elongation factor G; elongation factor G, EF 4e-16
2xex_A693 Elongation factor G; GTPase, translation, biosynth 4e-16
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 6e-16
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 1e-15
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 5e-15
3gmt_A230 Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle 4e-13
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 7e-13
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 3e-10
2ywe_A600 GTP-binding protein LEPA; G domain, beta-barrel, f 1e-09
2ywe_A600 GTP-binding protein LEPA; G domain, beta-barrel, f 5e-05
2dy1_A665 Elongation factor G; translocation, GTP complex, s 4e-09
2dy1_A665 Elongation factor G; translocation, GTP complex, s 3e-08
2dy1_A665 Elongation factor G; translocation, GTP complex, s 3e-05
3cb4_D599 GTP-binding protein LEPA; GTPase, OB-fold, membran 6e-09
3cb4_D599 GTP-binding protein LEPA; GTPase, OB-fold, membran 4e-05
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 2e-05
1g7s_A594 Translation initiation factor IF2/EIF5B; translati 4e-05
1zun_B434 Sulfate adenylate transferase, subunit 1/adenylyls 4e-04
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 6e-04
>1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* Length = 842 Back     alignment and structure
 Score =  720 bits (1859), Expect = 0.0
 Identities = 272/932 (29%), Positives = 446/932 (47%), Gaps = 134/932 (14%)

Query: 383  TVYNMEFLADMMDTPHLIRNVALVGHLHHGKTTMIDCLIRQTHPGYRQPAEEKNLRYTDT 442
              + ++ +  +MD    +RN++++ H+ HGK+T+ D L+++        A+    R+TDT
Sbjct: 2    VAFTVDQMRSLMDKVTNVRNMSVIAHVDHGKSTLTDSLVQRAGI--ISAAKAGEARFTDT 59

Query: 443  LFTEQERGVSIKASPVTLLLPDVKGKNYLMNIFDTPASPVTLLLPDVKGKNYLMNIFDTP 502
               EQERG++IK++ ++L               +     V  +     G ++L+N+ D+P
Sbjct: 60   RKDEQERGITIKSTAISL-------------YSEMSDEDVKEIKQKTDGNSFLINLIDSP 106

Query: 503  GMWDIHVRKFSKKAAHASAQRSFVEFVLEPVYKLVAQVVGDVDSSLPAVLDQLG------ 556
            G    HV  FS +   A       +  L     +V   +  V      VL Q        
Sbjct: 107  G----HVD-FSSEVTAAL---RVTDGAL-----VVVDTIEGVCVQTETVLRQALGERIKP 153

Query: 557  -IHMNK-----EESKINIRPL-LRLVYKVE-VNRVPAGNWVLIEGIDQPIVKTSTITDLI 608
             + +NK      E +++   L       VE VN + +     + G  Q      T+    
Sbjct: 154  VVVINKVDRALLELQVSKEDLYQTFARTVESVNVIVSTYADEVLGDVQVYPARGTV---A 210

Query: 609  TNEDITSNKFLIDGFPRNQNNLDGWNKEMADKVELLYVLFFDCPEDVCVRRCLKRGAEGS 668
                +    F I  F           K   DK +++  L+ D   +   ++   +  +  
Sbjct: 211  FGSGLHGWAFTIRQFATRYAK-----KFGVDKAKMMDRLWGDSFFNPKTKKWTNKDTDAE 265

Query: 669  GRA---------------------DDNEESLKKRISVYNTETMPIIKFFEAKNLVKR--- 704
            G+                      +  ++ +   +           K  E K L+K    
Sbjct: 266  GKPLERAFNMFILDPIFRLFTAIMNFKKDEIPVLLEKLEIVLKGDEKDLEGKALLKVVMR 325

Query: 705  --FNAEKSLVEMCVKHIPSPAENAETKVSYMYTGPGDSDVARDMKACNPEGRLMVHSSKK 762
                A  +L+EM V H+PSP      +   +Y GP D      +K C+P+  LM++ SK 
Sbjct: 326  KFLPAADALLEMIVLHLPSPVTAQAYRAEQLYEGPADDANCIAIKNCDPKADLMLYVSK- 384

Query: 763  NAETKVSYMYTGPGDSDVARDMKACNPEGRLMVHSSKMYPTEECTFFQVLARVMSGTLHA 822
                                                 M PT +   F    RV +GT+ +
Sbjct: 385  -------------------------------------MVPTSDKGRFYAFGRVFAGTVKS 407

Query: 823  GQEVRVLGENYSLMDEEDSRILTVGRLWIYEARYKVEVNRVPAGNWVLIEGIDQPIVKTS 882
            GQ+VR+ G NY    ++D  I  + R+ +   R+   ++  PAGN + + GIDQ ++KT 
Sbjct: 408  GQKVRIQGPNYVPGKKDDLFIKAIQRVVLMMGRFVEPIDDCPAGNIIGLVGIDQFLLKTG 467

Query: 883  TITDLITNEDMYIFRPLKFNTQSVIKIAVEPVNPSELPKMLDGLRKVNKSYPLLTTKVEE 942
            T+T    +E  +  + +KF+   V+++AVE  N ++LPK+++GL++++KS P + T + E
Sbjct: 468  TLTT---SETAHNMKVMKFSVSPVVQVAVEVKNANDLPKLVEGLKRLSKSDPCVLTYMSE 524

Query: 943  SGEHVVLGTGELYLDCVMHDLRKMYSEIDIKVADPVVAFCETVVETSSLKCFAETPNKRN 1002
            SGEH+V GTGEL+L+  + DL   ++ + +K++ PVVA+ ETV   SS    +++PNK N
Sbjct: 525  SGEHIVAGTGELHLEICLQDLEHDHAGVPLKISPPVVAYRETVESESSQTALSKSPNKHN 584

Query: 1003 KITMIAEPLEKGLAEDIENQIVHIAWNKKRLGEFFQSKYDWDLLAARSIWAFGPEVTGPN 1062
            +I + AEP+++ ++  IEN I++   + K         Y WD+  AR IW FGP+  GPN
Sbjct: 585  RIYLKAEPIDEEVSLAIENGIINPRDDFKARARIMADDYGWDVTDARKIWCFGPDGNGPN 644

Query: 1063 ILVDDTLPSEVDKGLLGSVKDSIVQGFQWGTREGPLCEEPIRNVKFKILDAVIATEPLHR 1122
            +++D T   +     L  +KDS+V  FQW T+EGP+  E +R+V+  ILD  +  + +HR
Sbjct: 645  LVIDQTKAVQ----YLHEIKDSVVAAFQWATKEGPIFGEEMRSVRVNILDVTLHADAIHR 700

Query: 1123 GGGQIIPTARRVAYSAFLMATPRLMEPYLFVEVQAPADCVSAVYTVLAKRRGHVTQDAPV 1182
            GGGQIIPT RR  Y+ FL+A P++ EP   VE+Q P   V  +Y+VL K+RG V  +   
Sbjct: 701  GGGQIIPTMRRATYAGFLLADPKIQEPVFLVEIQCPEQAVGGIYSVLNKKRGQVVSEEQR 760

Query: 1183 PGSPLYTIKAFIPAIDSFGFETDLRTHTQGQAFCLSVFHHWQIVPGDPLDKSIVIRPLEP 1242
            PG+PL+T+KA++P  +SFGF  +LR  T GQAF   VF HW  +  DPLD          
Sbjct: 761  PGTPLFTVKAYLPVNESFGFTGELRQATGGQAFPQMVFDHWSTLGSDPLDP--------- 811

Query: 1243 QPATHLAREFMIKTRRRKGLSEDV-SINKFFD 1273
               T  A E ++  R+R G+ E+V    +++D
Sbjct: 812  ---TSKAGEIVLAARKRHGMKEEVPGWQEYYD 840
>1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* Length = 842 Back     alignment and structure
>1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* Length = 842 Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Length = 196 Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Length = 194 Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Length = 196 Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Length = 199 Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Length = 203 Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Length = 186 Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Length = 220 Back     alignment and structure
>2rgx_A Adenylate kinase; transferase(phosphotransferase), ATP-binding, nucleo binding, transferase; HET: AP5; 1.90A {Aquifex aeolicus} PDB: 2rh5_A Length = 206 Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Length = 201 Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Length = 216 Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, cytoplasm, metal-binding, nucleotide biosynthesis, nucleotide-binding; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Length = 216 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Length = 243 Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Length = 217 Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Length = 233 Back     alignment and structure
>1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... Length = 691 Back     alignment and structure
>2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H Length = 704 Back     alignment and structure
>2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} Length = 693 Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Length = 222 Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Length = 227 Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Length = 246 Back     alignment and structure
>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Length = 230 Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Length = 214 Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Length = 223 Back     alignment and structure
>2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* Length = 600 Back     alignment and structure
>2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* Length = 600 Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Length = 665 Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Length = 665 Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Length = 665 Back     alignment and structure
>3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* Length = 599 Back     alignment and structure
>3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* Length = 599 Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Length = 189 Back     alignment and structure
>1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* Length = 594 Back     alignment and structure
>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Length = 434 Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Length = 178 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1291
1n0u_A842 EF-2, elongation factor 2; G-protein, CIS-proline, 100.0
4fn5_A709 EF-G 1, elongation factor G 1; translation, transl 100.0
2rdo_7704 EF-G, elongation factor G; elongation factor G, EF 100.0
3j25_A638 Tetracycline resistance protein TETM; antibiotic r 100.0
2xex_A693 Elongation factor G; GTPase, translation, biosynth 100.0
1dar_A691 EF-G, elongation factor G; ribosomal translocase, 100.0
2dy1_A665 Elongation factor G; translocation, GTP complex, s 100.0
3vqt_A548 RF-3, peptide chain release factor 3; translation, 100.0
2ywe_A600 GTP-binding protein LEPA; G domain, beta-barrel, f 100.0
3cb4_D599 GTP-binding protein LEPA; GTPase, OB-fold, membran 100.0
2h5e_A529 Peptide chain release factor RF-3; beta barrel, tr 100.0
3tr5_A528 RF-3, peptide chain release factor 3; protein synt 100.0
1n0u_A842 EF-2, elongation factor 2; G-protein, CIS-proline, 100.0
3e3x_A332 BIPA; MCSG,PSI2, structural genomics, protein stru 100.0
2rdo_7704 EF-G, elongation factor G; elongation factor G, EF 99.91
4fn5_A709 EF-G 1, elongation factor G 1; translation, transl 99.9
2xex_A693 Elongation factor G; GTPase, translation, biosynth 99.9
2hjg_A436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 99.88
1dar_A691 EF-G, elongation factor G; ribosomal translocase, 99.88
1d2e_A397 Elongation factor TU (EF-TU); G-protein, beta-barr 99.88
3j2k_7439 ERF3, eukaryotic polypeptide chain release factor 99.88
1g7s_A594 Translation initiation factor IF2/EIF5B; translati 99.87
2c78_A405 Elongation factor TU-A; hydrolase, GTPase, transla 99.87
4dcu_A456 GTP-binding protein ENGA; GTPase, GDP, protein bin 99.86
3mca_A592 HBS1, elongation factor 1 alpha-like protein; prot 99.86
1jny_A435 EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- 99.85
2dy1_A665 Elongation factor G; translocation, GTP complex, s 99.85
2elf_A370 Protein translation elongation factor 1A; tRNA, py 99.84
3avx_A 1289 Elongation factor TS, elongation factor TU, linke 99.84
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 99.84
1f60_A458 Elongation factor EEF1A; protein-protein complex, 99.82
1zun_B434 Sulfate adenylate transferase, subunit 1/adenylyls 99.82
1r5b_A467 Eukaryotic peptide chain release factor GTP-bindi 99.82
3p26_A483 Elongation factor 1 alpha-like protein; GTP/GDP bi 99.82
1kk1_A410 EIF2gamma; initiation of translation; HET: GNP; 1. 99.81
3izq_1611 HBS1P, elongation factor 1 alpha-like protein; NO- 99.8
3j25_A638 Tetracycline resistance protein TETM; antibiotic r 99.79
1s0u_A408 EIF-2-gamma, translation initiation factor 2 gamma 99.78
1zo1_I501 IF2, translation initiation factor 2; E. coli, rib 99.77
3izy_P537 Translation initiation factor IF-2, mitochondrial; 99.75
1wb1_A482 Translation elongation factor SELB; selenocysteine 99.75
3sjy_A403 Translation initiation factor 2 subunit gamma; zin 99.75
3vqt_A548 RF-3, peptide chain release factor 3; translation, 99.62
3j2k_7439 ERF3, eukaryotic polypeptide chain release factor 99.42
1puj_A282 YLQF, conserved hypothetical protein YLQF; structu 99.33
1r5b_A467 Eukaryotic peptide chain release factor GTP-bindi 99.28
3p26_A483 Elongation factor 1 alpha-like protein; GTP/GDP bi 99.24
1zun_B434 Sulfate adenylate transferase, subunit 1/adenylyls 99.22
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 99.19
1d2e_A397 Elongation factor TU (EF-TU); G-protein, beta-barr 99.17
1f60_A458 Elongation factor EEF1A; protein-protein complex, 99.16
3mca_A592 HBS1, elongation factor 1 alpha-like protein; prot 99.16
1jny_A435 EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- 99.16
2ywe_A600 GTP-binding protein LEPA; G domain, beta-barrel, f 99.15
1wb1_A482 Translation elongation factor SELB; selenocysteine 99.15
2c78_A405 Elongation factor TU-A; hydrolase, GTPase, transla 99.14
3ec1_A369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 99.14
3cb4_D599 GTP-binding protein LEPA; GTPase, OB-fold, membran 99.12
2elf_A370 Protein translation elongation factor 1A; tRNA, py 99.1
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 99.1
3izq_1611 HBS1P, elongation factor 1 alpha-like protein; NO- 99.09
3cnl_A262 YLQF, putative uncharacterized protein; circular p 99.07
3avx_A1289 Elongation factor TS, elongation factor TU, linke 99.06
3gmt_A230 Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle 99.02
3h2y_A368 GTPase family protein; GTP-binding protein YQEH, p 99.0
3tr5_A528 RF-3, peptide chain release factor 3; protein synt 98.98
1kk1_A410 EIF2gamma; initiation of translation; HET: GNP; 1. 98.97
1wf3_A301 GTP-binding protein; GTPase, riken structural geno 98.97
1g7s_A594 Translation initiation factor IF2/EIF5B; translati 98.97
2h5e_A529 Peptide chain release factor RF-3; beta barrel, tr 98.96
3iev_A308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 98.96
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 98.92
3e3x_A332 BIPA; MCSG,PSI2, structural genomics, protein stru 98.9
3sjy_A403 Translation initiation factor 2 subunit gamma; zin 98.89
2xtp_A260 GTPase IMAP family member 2; immune system, G prot 98.83
1s0u_A408 EIF-2-gamma, translation initiation factor 2 gamma 98.82
3i8s_A274 Ferrous iron transport protein B; GTPase, GPCR, ir 98.82
3qq5_A423 Small GTP-binding protein; hydrogenase, H-cluster, 98.8
1zo1_I501 IF2, translation initiation factor 2; E. coli, rib 98.78
3izy_P537 Translation initiation factor IF-2, mitochondrial; 98.75
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 98.72
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 98.7
3iby_A256 Ferrous iron transport protein B; G protein, G dom 98.69
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 98.68
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 98.67
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 98.67
2hjg_A436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 98.63
3lxw_A247 GTPase IMAP family member 1; immunity, structural 98.63
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 98.6
4dcu_A456 GTP-binding protein ENGA; GTPase, GDP, protein bin 98.59
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 98.55
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 98.54
3geh_A462 MNME, tRNA modification GTPase MNME; G protein, U3 98.53
3a1s_A258 Iron(II) transport protein B; FEOB, iron transport 98.52
1xzp_A482 Probable tRNA modification GTPase TRME; GTP-bindin 98.52
3gee_A476 MNME, tRNA modification GTPase MNME; G protein, cy 98.5
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 98.43
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 98.42
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 98.42
1wf3_A301 GTP-binding protein; GTPase, riken structural geno 98.4
1h65_A270 Chloroplast outer envelope protein OEP34; GTPase, 98.4
3tlx_A243 Adenylate kinase 2; structural genomics, structura 98.38
3lxx_A239 GTPase IMAP family member 4; structural genomics c 98.34
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 98.33
2wji_A165 Ferrous iron transport protein B homolog; membrane 98.33
3t5d_A274 Septin-7; GTP-binding protein, cytoskeleton, signa 98.29
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 98.29
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 98.29
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 98.29
3t1o_A198 Gliding protein MGLA; G domain containing protein, 98.28
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 98.27
3iev_A308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 98.26
1jwy_B315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 98.26
3b1v_A272 Ferrous iron uptake transporter protein B; G prote 98.25
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 98.25
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 98.24
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 98.24
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 98.23
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 98.23
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 98.23
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 98.22
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 98.22
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 98.21
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 98.2
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 98.19
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 98.18
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 98.18
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 98.18
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 98.17
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 98.17
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 98.17
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 98.16
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 98.16
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 98.15
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 98.15
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 98.15
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 98.14
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 98.14
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 98.14
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 98.14
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 98.14
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 98.14
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 98.14
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 98.13
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 98.12
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 98.12
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 98.12
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 98.11
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 98.11
2aka_B299 Dynamin-1; fusion protein, GTPase domain, myosin, 98.1
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 98.1
4a9a_A376 Ribosome-interacting GTPase 1; DRG-DFRP complex, r 98.1
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 98.1
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 98.1
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 98.1
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 98.1
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 98.09
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 98.09
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 98.09
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 98.09
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 98.09
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 98.09
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 98.08
2fh5_B214 SR-beta, signal recognition particle receptor beta 98.08
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 98.07
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 98.07
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 98.07
3llu_A196 RAS-related GTP-binding protein C; structural geno 98.07
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 98.05
3t1o_A198 Gliding protein MGLA; G domain containing protein, 98.05
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 98.03
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 98.03
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 98.03
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 98.02
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 98.02
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 98.02
3r7w_A307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 98.02
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 98.01
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 98.01
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 98.01
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 98.0
3qq5_A423 Small GTP-binding protein; hydrogenase, H-cluster, 98.0
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 98.0
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 98.0
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 98.0
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 97.99
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 97.99
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 97.99
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 97.98
2xtp_A260 GTPase IMAP family member 2; immune system, G prot 97.98
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 97.98
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 97.97
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 97.97
3lxw_A247 GTPase IMAP family member 1; immunity, structural 97.96
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 97.96
2qpt_A550 EH domain-containing protein-2; protein-nucleotide 97.96
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 97.96
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 97.96
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 97.95
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 97.95
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 97.95
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 97.94
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 97.94
2j69_A695 Bacterial dynamin-like protein; FZO, FZL, GTPase, 97.93
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 97.91
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 97.91
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 97.91
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 97.91
1jwy_B315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 97.9
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 97.88
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 97.88
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 97.88
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 97.87
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 97.87
1wxq_A397 GTP-binding protein; structural genomics, riken st 97.87
3o47_A329 ADP-ribosylation factor GTPase-activating protein 97.87
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 97.86
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 97.86
2qpt_A550 EH domain-containing protein-2; protein-nucleotide 97.86
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 97.84
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 97.83
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 97.83
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 97.82
2x2e_A353 Dynamin-1; nitration, hydrolase, membrane fission, 97.82
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 97.82
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 97.82
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 97.81
2fh5_B214 SR-beta, signal recognition particle receptor beta 97.81
3t5d_A274 Septin-7; GTP-binding protein, cytoskeleton, signa 97.81
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 97.81
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 97.8
3i8s_A274 Ferrous iron transport protein B; GTPase, GPCR, ir 97.8
1nrj_B218 SR-beta, signal recognition particle receptor beta 97.8
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 97.79
1jal_A363 YCHF protein; nucleotide-binding fold, structural 97.78
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 97.78
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 97.77
3llu_A196 RAS-related GTP-binding protein C; structural geno 97.76
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 97.76
1f5n_A592 Interferon-induced guanylate-binding protein 1; GB 97.75
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 97.75
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 97.75
1xzp_A482 Probable tRNA modification GTPase TRME; GTP-bindin 97.74
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 97.74
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 97.74
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 97.74
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 97.73
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 97.73
3iby_A256 Ferrous iron transport protein B; G protein, G dom 97.72
1nrj_B218 SR-beta, signal recognition particle receptor beta 97.72
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 97.71
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 97.71
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 97.7
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 97.69
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 97.69
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 97.68
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 97.66
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 97.66
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 97.66
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 97.65
3gee_A476 MNME, tRNA modification GTPase MNME; G protein, cy 97.65
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 97.65
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 97.64
3lxx_A239 GTPase IMAP family member 4; structural genomics c 97.64
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 97.63
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 97.63
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 97.63
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 97.63
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 97.62
2ged_A193 SR-beta, signal recognition particle receptor beta 97.62
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 97.62
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 97.62
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 97.62
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 97.62
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 97.62
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 97.62
1lnz_A342 SPO0B-associated GTP-binding protein; GTPase, OBG, 97.62
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 97.61
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 97.6
2aka_B299 Dynamin-1; fusion protein, GTPase domain, myosin, 97.6
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 97.59
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 97.59
3dpu_A535 RAB family protein; roccor, G-domain, COR, GTP-bin 97.58
3geh_A462 MNME, tRNA modification GTPase MNME; G protein, U3 97.57
3th5_A204 RAS-related C3 botulinum toxin substrate 1; rossma 96.72
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 97.56
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 97.55
3th5_A204 RAS-related C3 botulinum toxin substrate 1; rossma 96.71
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 97.55
3r7w_A307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 97.55
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 97.55
2wkq_A332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 97.55
1h65_A270 Chloroplast outer envelope protein OEP34; GTPase, 97.55
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 97.54
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 97.54
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 97.54
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 97.54
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 97.53
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 97.53
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 97.53
3o47_A329 ADP-ribosylation factor GTPase-activating protein 97.52
2ohf_A396 Protein OLA1, GTP-binding protein 9; ATPase, GTPas 97.52
3a1s_A258 Iron(II) transport protein B; FEOB, iron transport 97.52
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 97.52
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 97.5
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 97.5
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 97.49
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 97.49
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 97.49
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 97.48
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 97.48
3t34_A360 Dynamin-related protein 1A, linker, dynamin-relat 97.48
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 97.48
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 97.48
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 97.48
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 97.48
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 97.48
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 97.47
2dby_A368 GTP-binding protein; GDP, structural genomics, NPP 97.46
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 97.46
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 97.45
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 97.44
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 97.44
3zvr_A772 Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito 97.43
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 97.43
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 97.43
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 97.43
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 97.43
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 97.43
2qag_A361 Septin-2, protein NEDD5; cell cycle, cell division 97.42
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 97.42
2wji_A165 Ferrous iron transport protein B homolog; membrane 97.41
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 97.41
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 97.41
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 97.41
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 97.4
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 97.4
2ged_A193 SR-beta, signal recognition particle receptor beta 97.39
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 97.37
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 97.37
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 97.36
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 97.36
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 97.34
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 97.34
2j69_A695 Bacterial dynamin-like protein; FZO, FZL, GTPase, 97.33
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 97.32
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 97.31
3zvr_A772 Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito 97.31
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 97.31
1ni3_A392 YCHF GTPase, YCHF GTP-binding protein; structural 97.3
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 97.29
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 97.29
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 97.28
3t34_A360 Dynamin-related protein 1A, linker, dynamin-relat 97.28
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 97.27
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 97.23
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 97.23
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 97.22
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 97.21
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 97.2
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 97.2
3e1y_E204 Eukaryotic peptide chain release factor GTP-bindi 97.2
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 97.19
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 97.18
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 97.17
3b1v_A272 Ferrous iron uptake transporter protein B; G prote 97.17
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 97.16
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 97.15
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 97.15
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 97.1
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 97.09
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 97.06
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 97.04
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 96.99
2x2e_A353 Dynamin-1; nitration, hydrolase, membrane fission, 96.99
2www_A349 Methylmalonic aciduria type A protein, mitochondri 96.98
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 96.97
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 96.96
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 96.9
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 96.9
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 96.84
2j37_W504 Signal recognition particle 54 kDa protein (SRP54) 96.83
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 96.83
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 96.79
2wkq_A332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 96.79
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 96.77
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 96.76
1lnz_A342 SPO0B-associated GTP-binding protein; GTPase, OBG, 96.73
4dkx_A216 RAS-related protein RAB-6A; GTP binding fold, memb 96.68
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 96.67
3dpu_A535 RAB family protein; roccor, G-domain, COR, GTP-bin 96.63
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 96.61
1wxq_A397 GTP-binding protein; structural genomics, riken st 96.6
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 96.59
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 96.49
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 96.44
2qag_A361 Septin-2, protein NEDD5; cell cycle, cell division 96.43
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 96.42
1udx_A416 The GTP-binding protein OBG; TGS domain, riken str 96.42
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 96.42
3c5h_A255 Glucocorticoid receptor DNA-binding factor 1; RAS, 96.36
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 96.29
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 96.11
2qag_B427 Septin-6, protein NEDD5; cell cycle, cell division 96.11
2j37_W504 Signal recognition particle 54 kDa protein (SRP54) 96.1
4a9a_A376 Ribosome-interacting GTPase 1; DRG-DFRP complex, r 96.02
3r7w_B331 Gtpase2, GTP-binding protein GTR2; RAG gtpases, GT 96.0
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 95.99
2qag_C418 Septin-7; cell cycle, cell division, GTP-binding, 95.97
3q5d_A447 Atlastin-1; G protein, GTPase, GDP/GTP binding, hy 95.87
4dkx_A216 RAS-related protein RAB-6A; GTP binding fold, memb 95.79
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 95.55
1vi7_A217 Hypothetical protein YIGZ; structural genomics, un 95.53
1cip_A353 Protein (guanine nucleotide-binding protein alpha- 95.47
3r7w_B331 Gtpase2, GTP-binding protein GTR2; RAG gtpases, GT 95.47
1tq4_A413 IIGP1, interferon-inducible GTPase; interferon gam 95.4
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 95.38
1zcb_A362 G alpha I/13; GTP-binding, lipoprotein, membrane, 95.18
2xxa_A433 Signal recognition particle protein; protein trans 95.13
4fid_A340 G protein alpha subunit; RAS-like domain, all-heli 95.03
2cve_A191 Hypothetical protein TTHA1053; COG1739, UPF0029, s 95.0
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 94.51
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 94.45
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 94.25
2www_A349 Methylmalonic aciduria type A protein, mitochondri 94.25
1azs_C402 GS-alpha; complex (lyase/hydrolase), hydrolase, si 94.12
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 93.83
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 93.81
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 93.67
2xtz_A354 Guanine nucleotide-binding protein alpha-1 subuni; 93.66
4dzz_A206 Plasmid partitioning protein PARF; deviant walker 93.5
2ph1_A262 Nucleotide-binding protein; alpha-beta protein, st 93.48
3ohm_A327 Guanine nucleotide-binding protein G(Q) subunit A; 93.43
1udx_A416 The GTP-binding protein OBG; TGS domain, riken str 93.31
1xe1_A116 Hypothetical protein PF0907; structural genomics, 93.31
2qag_C418 Septin-7; cell cycle, cell division, GTP-binding, 93.27
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 93.22
3c5h_A255 Glucocorticoid receptor DNA-binding factor 1; RAS, 93.13
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 92.94
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 92.91
2qag_B427 Septin-6, protein NEDD5; cell cycle, cell division 92.87
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 92.77
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 92.5
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 92.28
2dby_A368 GTP-binding protein; GDP, structural genomics, NPP 91.57
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 91.36
3bfv_A271 CAPA1, CAPB2, membrane protein CAPA1, protein tyro 91.26
2xxa_A433 Signal recognition particle protein; protein trans 91.19
1hyq_A263 MIND, cell division inhibitor (MIND-1); MINC, FTSZ 90.98
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 90.64
3cwq_A209 Para family chromosome partitioning protein; alpha 90.42
1g3q_A237 MIND ATPase, cell division inhibitor; alpha-beta-a 89.68
3lh2_S76 4E10_1VI7A_S0_002_N (T88); epitope-scaffold, immun 89.06
3cio_A299 ETK, tyrosine-protein kinase ETK; WZC, escherichia 89.05
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 88.87
2hf9_A226 Probable hydrogenase nickel incorporation protein 88.53
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 88.44
3q9l_A260 Septum site-determining protein MIND; ATPase, bact 88.41
3kjh_A254 CO dehydrogenase/acetyl-COA synthase complex, acce 88.33
3ec1_A369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 88.29
3k9g_A267 PF-32 protein; ssgcid, SBRI, decode biostructures, 88.21
1wcv_1257 SOJ, segregation protein; ATPase, bacterial, chrom 88.19
2oze_A298 ORF delta'; para, walker type atpases, DNA segrega 88.16
1jal_A363 YCHF protein; nucleotide-binding fold, structural 88.05
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 87.62
3la6_A286 Tyrosine-protein kinase WZC; P-loop protein, nucle 87.04
3szr_A608 Interferon-induced GTP-binding protein MX1; interf 86.99
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 86.08
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 85.62
3l2o_B312 F-box only protein 4; small G protein fold, UBL co 85.56
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 85.53
3l82_B227 F-box only protein 4; TRFH domain, helix, GTPase d 85.5
3ea0_A245 ATPase, para family; alpha-beta-alpha sandwich, st 85.47
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 84.96
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 84.87
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, 84.83
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, 84.75
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 84.74
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 84.66
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 84.55
1kag_A173 SKI, shikimate kinase I; transferase, structural g 84.4
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 84.37
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 84.36
4ido_A457 Atlastin-1; GTPase, GTP/GDP binding, hydrolase; HE 84.21
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 84.17
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 84.17
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 84.15
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 84.13
4dzz_A206 Plasmid partitioning protein PARF; deviant walker 84.08
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 84.05
3kjh_A254 CO dehydrogenase/acetyl-COA synthase complex, acce 83.7
3h2y_A368 GTPase family protein; GTP-binding protein YQEH, p 83.57
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 83.21
3end_A307 Light-independent protochlorophyllide reductase ir 83.11
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 82.83
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 82.63
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 82.45
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 82.36
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 82.16
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 82.1
>1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* Back     alignment and structure
Probab=100.00  E-value=3.5e-118  Score=1151.89  Aligned_cols=733  Identities=34%  Similarity=0.600  Sum_probs=595.0

Q ss_pred             ccchHHHhhhcCCccccceEEEEcccCCChhHHHHHHHhhcCCcccCCccccccccccccccccccCceeeeccceeccc
Q psy15088        384 VYNMEFLADMMDTPHLIRNVALVGHLHHGKTTMIDCLIRQTHPGYRQPAEEKNLRYTDTLFTEQERGVSIKASPVTLLLP  463 (1291)
Q Consensus       384 ~~~~~~~~~~~~~~~~irnI~iiG~~~~GKsTl~~~ll~~~~~i~~~~~~~~~~~~~D~~~~E~erGiTi~~~~~~~~~~  463 (1291)
                      .|+.+++.++|..++++|||+|+||+|||||||+++|++.++.+.+..  .++.+++|++++|++||+||+++.+++.|.
T Consensus         3 ~~~~~~~~~~m~~~~~~rnI~IiG~~~~GKTTL~~~Ll~~~g~i~~~~--~~~~~~~D~~~~E~~rgiTI~~~~~~~~~~   80 (842)
T 1n0u_A            3 AFTVDQMRSLMDKVTNVRNMSVIAHVDHGKSTLTDSLVQRAGIISAAK--AGEARFTDTRKDEQERGITIKSTAISLYSE   80 (842)
T ss_dssp             CBCHHHHHHHHHCGGGEEEEEEECCGGGTHHHHHHHHHHHHBCCBC--------------------CCCBCCCEEEEEEE
T ss_pred             ccCHHHHHHHhhCcccccEEEEECCCCCCHHHHHHHHHHhcCCccccc--CCCceeecCchhhhhcceeEeeceeEEEec
Confidence            578899999999999999999999999999999999999988776544  456789999999999999999999988884


Q ss_pred             c-----------cCCCCeEEEEEeCCCccccc--ccccccccceEEEEecCCCccchhhHhhHHHHHhhcCccchhhhhh
Q psy15088        464 D-----------VKGKNYLMNIFDTPASPVTL--LLPDVKGKNYLMNIFDTPGMWDIHVRKFSKKAAHASAQRSFVEFVL  530 (1291)
Q Consensus       464 ~-----------~~~~~~~~~liDTpGh~~~~--~l~~~~~ad~~v~vida~~g~~~qt~~~~~~~~~~~~~~~fv~fil  530 (1291)
                      .           ..++++.++|+|||||.++.  ....+..+|++|+|+|+..|++.|+.++|..+...++|+++  ++|
T Consensus        81 ~~~~~~~~i~~~~~~~~~~i~liDTPG~~df~~~~~~~l~~aD~ailVvDa~~g~~~qt~~~~~~~~~~~~p~il--viN  158 (842)
T 1n0u_A           81 MSDEDVKEIKQKTDGNSFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDTIEGVCVQTETVLRQALGERIKPVV--VIN  158 (842)
T ss_dssp             CCHHHHHHCSSCCCSSEEEEEEECCCCCCSSCHHHHHHHHTCSEEEEEEETTTBSCHHHHHHHHHHHHTTCEEEE--EEE
T ss_pred             ccccccccccccccCCCceEEEEECcCchhhHHHHHHHHHhCCEEEEEEeCCCCCCHHHHHHHHHHHHcCCCeEE--EEE
Confidence            1           23458999999999998765  34455677999999999999999999999998888888876  666


Q ss_pred             hHHHHHHHHhhCC-----------ccCcHH--------------------------------------------------
Q psy15088        531 EPVYKLVAQVVGD-----------VDSSLP--------------------------------------------------  549 (1291)
Q Consensus       531 ~~i~k~~d~~~~~-----------~~~~l~--------------------------------------------------  549 (1291)
                          | +|....+           +...+.                                                  
T Consensus       159 ----K-~D~~~~e~~~~~~e~~~~~~~~~~~i~~~l~~~~~~~~~~~~~~p~~~~v~~~sa~~g~~~~~~~f~~~y~~~~  233 (842)
T 1n0u_A          159 ----K-VDRALLELQVSKEDLYQTFARTVESVNVIVSTYADEVLGDVQVYPARGTVAFGSGLHGWAFTIRQFATRYAKKF  233 (842)
T ss_dssp             ----C-HHHHHHTSCCCHHHHHHHHHHHHHHHHHHHHHHSCGGGCCCCCCGGGTCEEEEETTTTEEEEHHHHHHHHHTTT
T ss_pred             ----C-CCcchhhhccCHHHHHHHHHHHHHHHHHHHhhccccccCceeeceEEeeeEEeecccccccchhhhhhhcchhc
Confidence                3 3433110           000011                                                  


Q ss_pred             -----HHHHHh-C--------CC-----c------Chhhhh---cCc-hHHHHHHHhhccccccCCCccccccccccccc
Q psy15088        550 -----AVLDQL-G--------IH-----M------NKEESK---INI-RPLLRLVYKVEVNRVPAGNWVLIEGIDQPIVK  600 (1291)
Q Consensus       550 -----~i~~~l-g--------~~-----l------~~~~~~---~~~-~~~l~~i~~~~~~~~P~~~~~~~~~~~~~~~~  600 (1291)
                           .+..++ |        -.     +      .++.+.   ..+ ..++.++..                       
T Consensus       234 ~~~~~~l~~~~~~d~~~~~~~~~~~~~~i~~~~~~~~~~f~~~~~~~~~~l~e~~~~-----------------------  290 (842)
T 1n0u_A          234 GVDKAKMMDRLWGDSFFNPKTKKWTNKDTDAEGKPLERAFNMFILDPIFRLFTAIMN-----------------------  290 (842)
T ss_dssp             TSCHHHHHHHTSSSCEEETTTTEEESCSBCTTCCBCCBHHHHHTHHHHHHHHHHHHT-----------------------
T ss_pred             CCCHHHHHHHHhccccccCCCCeEEEecCCchhhhhhHHHHHHHHHHHHHHHHHHHh-----------------------
Confidence                 111111 0        00     0      012221   111 123333322                       


Q ss_pred             cCceEEcccccccccCceeecCCCCccCccchHHHHHHHHHHHHHhhhcCCCchHHHHHHhhc-ccCCCCC-CCCCHHHH
Q psy15088        601 TSTITDLITNEDITSNKFLIDGFPRNQNNLDGWNKEMADKVELLYVLFFDCPEDVCVRRCLKR-GAEGSGR-ADDNEESL  678 (1291)
Q Consensus       601 ~~~liDll~~~~i~~~~~liDGfPr~~~qa~~~~~~l~e~~~l~~v~~ld~~~e~l~~R~l~r-g~~~~~r-~dd~~e~i  678 (1291)
                                                                         .++.+++++++. |.....+ .......|
T Consensus       291 ---------------------------------------------------~d~~~~e~~l~~~g~~l~~~e~~~~~~~l  319 (842)
T 1n0u_A          291 ---------------------------------------------------FKKDEIPVLLEKLEIVLKGDEKDLEGKAL  319 (842)
T ss_dssp             ---------------------------------------------------TCTTHHHHHHHHTTCCCCGGGGGCCHHHH
T ss_pred             ---------------------------------------------------cCHHHHHHHHHHcCCCCCHHHHhhhhHHH
Confidence                                                               001122222221 1000000 00011222


Q ss_pred             HHHHhhccccccceEEeecchhhhhhhchhHHHHHHHHhhCCCCccchhhhhhcccCCCCCchhhhhhhccCCccccccc
Q psy15088        679 KKRISVYNTETMPIIKFFEAKNLVKRFNAEKSLVEMCVKHIPSPAENAETKVSYMYTGPGDSDVARDMKACNPEGRLMVH  758 (1291)
Q Consensus       679 ~~rl~~~~~~~~PVl~~sa~k~~~~~~~g~~~LLD~Iv~~lPsP~~~~~~r~~~~~~g~~~~~~~~~~~~~~~~~~~~~~  758 (1291)
                      ++.+   .+.               +++.++.|||+|++++|||.+++++|...+|.|+.                    
T Consensus       320 ~~~~---~~~---------------~~pv~~~LLd~i~~~lPsP~~~~~~~~~~~~~g~~--------------------  361 (842)
T 1n0u_A          320 LKVV---MRK---------------FLPAADALLEMIVLHLPSPVTAQAYRAEQLYEGPA--------------------  361 (842)
T ss_dssp             HHHH---HHH---------------HSBHHHHHHHHHHHHSCCHHHHHHHHHHHHBSSCT--------------------
T ss_pred             HHHH---Hhh---------------ccchHHHHHHHHHHhCCChhHhcccccccccCCcc--------------------
Confidence            2222   112               23447999999999999999998888888888753                    


Q ss_pred             ccccccccccccccCCCCCchhhhhhhccCCCCCeEEEEEeeccCCCCceeEEEEEEEeeEecCCCEEEEcccCCCCCCc
Q psy15088        759 SSKKNAETKVSYMYTGPGDSDVARDMKACNPEGRLMVHSSKMYPTEECTFFQVLARVMSGTLHAGQEVRVLGENYSLMDE  838 (1291)
Q Consensus       759 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~pl~~~V~K~~~~~~~~~~ia~~RV~sGtL~~G~~v~v~~~~~~~~~~  838 (1291)
                                        +++....+..||+++|++++|||+..+++.|++++|+|||||+|++||+|++++++|++...
T Consensus       362 ------------------~~~~~~~~~~~~~~~p~~a~VfK~~~~~~~G~~l~~~RV~sG~l~~g~~v~v~~~~~n~~~~  423 (842)
T 1n0u_A          362 ------------------DDANCIAIKNCDPKADLMLYVSKMVPTSDKGRFYAFGRVFAGTVKSGQKVRIQGPNYVPGKK  423 (842)
T ss_dssp             ------------------TSHHHHHHHTTCTTSSCEEEEEEEEEBSSTTCEEEEEEEEESEEETTCEEEEECTTCCSSSC
T ss_pred             ------------------cccccceeeccCCCCCeEEEEEeeeecCCCCceEEEEEEEeeeecCCCEEEeccccccCCCC
Confidence                              23334566789999999999999999998887899999999999999999999999876544


Q ss_pred             ccceEEEEceEEEEecCceeeeceeeCCCeEEEccCCCcccccceeeccccCCccccccCCCCCCCceEEEEEEeCCCCC
Q psy15088        839 EDSRILTVGRLWIYEARYKVEVNRVPAGNWVLIEGIDQPIVKTSTITDLITNEDMYIFRPLKFNTQSVIKIAVEPVNPSE  918 (1291)
Q Consensus       839 ~~~~~~~V~~l~~~~g~~~~~v~~a~aGnIv~I~Gl~~~~~k~~Tl~~~~~~~~~~~~~~~~~~~~Pv~~vaIeP~~~~d  918 (1291)
                      .+...++|++|++++|++++++++|+|||||+|.|++++.++++|+++.   ..+.+|.++.++.+|+++++|||+++.|
T Consensus       424 ~~~~~~rv~~l~~~~g~~~~~v~~~~aGdI~ai~gl~~~~~~t~Tl~~~---~~~~~l~~~~~~~~Pv~~~avep~~~~d  500 (842)
T 1n0u_A          424 DDLFIKAIQRVVLMMGRFVEPIDDCPAGNIIGLVGIDQFLLKTGTLTTS---ETAHNMKVMKFSVSPVVQVAVEVKNAND  500 (842)
T ss_dssp             TTEEEEECCEEEEEETTEEEEESEEETTCEEEEESCTTTCCSSEEEESC---TTCCCBCCCCCCCSCCEEEEEEESSGGG
T ss_pred             cccceEEeeeeEeeccCcccccceeCCCCEEEEEccccceecceeecCC---CCccccccCCCCCCceEEEEEEECCHHH
Confidence            3334789999999999999999999999999999999988888899874   2456788888876799999999999999


Q ss_pred             hhHHHHHHHHHHHhCCceeEEECcCCcEEEEecchhHHHHHHHHHHhhhcceeEEEcCceEEEEEeeeecccceeeeecC
Q psy15088        919 LPKMLDGLRKVNKSYPLLTTKVEESGEHVVLGTGELYLDCVMHDLRKMYSEIDIKVADPVVAFCETVVETSSLKCFAETP  998 (1291)
Q Consensus       919 ~~kL~~~L~~L~~~DPsl~v~~~etGe~ii~g~GELHLEi~l~~L~~~f~~i~i~vs~p~V~yrEti~~~~~~~~~~~s~  998 (1291)
                      ++||.+||++|+++||++++..+||||++|+||||||||||++||+++|+|+++++|+|+|+|||||++++...++.+++
T Consensus       501 ~~kl~~~L~kL~~eDp~l~v~~~etge~il~g~GelHLei~~~rL~~~f~~vev~~~~P~V~yrETi~~~~~~~~~~~~~  580 (842)
T 1n0u_A          501 LPKLVEGLKRLSKSDPCVLTYMSESGEHIVAGTGELHLEICLQDLEHDHAGVPLKISPPVVAYRETVESESSQTALSKSP  580 (842)
T ss_dssp             HHHHHHHHHHHHHHCTTCEEEECTTSCEEEEESSHHHHHHHHHHHHHTTSCSCEEEECCCCCCEEEESSCCSSCEEEECT
T ss_pred             HHHHHHHHHHHHHhCCcEEEEEcCCCCEEEEeccHHHHHHHHHHHHHHhcCCceEecCcEEEEEEeeccccccceeeccC
Confidence            99999999999999999999988999999999999999999999999997799999999999999999999888889999


Q ss_pred             CcceEEEEEEeecCcccccccccceeccccchhHHHHHHhhhccccHhhhcceeeeCCCCCCCceeccCCCCchhhhhhh
Q psy15088        999 NKRNKITMIAEPLEKGLAEDIENQIVHIAWNKKRLGEFFQSKYDWDLLAARSIWAFGPEVTGPNILVDDTLPSEVDKGLL 1078 (1291)
Q Consensus       999 nk~~~i~~~~ePl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~w~~~~~~~iw~~gp~~~g~nilvd~~~~~~~~~~~~ 1078 (1291)
                      ++|++++++++|+++++...++.+.+...++.+.+++.|.++|+||.+.+++||+|||+..|+|+|+|.+.+.    .++
T Consensus       581 ~~~~~v~~~~ePl~~~~~~~~~~g~v~~~~~~~~~~~~l~~~~~~d~~~~~~iw~~~p~~~~~~~f~~~~~g~----~~~  656 (842)
T 1n0u_A          581 NKHNRIYLKAEPIDEEVSLAIENGIINPRDDFKARARIMADDYGWDVTDARKIWCFGPDGNGPNLVIDQTKAV----QYL  656 (842)
T ss_dssp             TSSCEEEEEEEECCHHHHHHHHTTSSCTTSCHHHHHHHHHHTTCCCHHHHHTEEEESSTTTSSEEEEECCCCC----TTH
T ss_pred             CcceEEEEEEEECcHHHhhHhhcCeecccccHHHHHHHHHHhcCcchhhhhceeeeccCCCCCcEEEecCCCc----ccc
Confidence            9999999999999998888888887777778888899999999999999999999999999999999987654    378


Q ss_pred             hhHHHHHHHHHHHhhhcCccCCCCceeeEEEEEEeeeecCCCCCCcCcHHHHHHHHHHHHHHhCCCceeccEEEEEEEec
Q psy15088       1079 GSVKDSIVQGFQWGTREGPLCEEPIRNVKFKILDAVIATEPLHRGGGQIIPTARRVAYSAFLMATPRLMEPYLFVEVQAP 1158 (1291)
Q Consensus      1079 ~~i~~si~~Gf~~a~~~GPL~~epv~gv~~~l~d~~~~~~~~~~~~~qii~~~r~~~~~a~l~a~p~LlEPi~~~eI~~p 1158 (1291)
                      ++++++|.+||+||+++||||||||+||+|+|.|+++|.+..|+++||+++|+++||++|+++|+|+||||||.|+|+||
T Consensus       657 ~~~~~~v~~G~~~a~~~G~L~g~pv~~v~v~l~dg~~h~d~~~~~~g~f~~a~~~a~~~a~~~a~p~LLEPi~~veI~vP  736 (842)
T 1n0u_A          657 HEIKDSVVAAFQWATKEGPIFGEEMRSVRVNILDVTLHADAIHRGGGQIIPTMRRATYAGFLLADPKIQEPVFLVEIQCP  736 (842)
T ss_dssp             HHHHHHHHHHHHHHHHSCTTTSCCBCSEEEEEEEEECCSSGGGSSHHHHHHHHHHHHHHHHHHSCEEEEEEEEEEEEEEC
T ss_pred             HHHHHHHHHHHHHHHhcCCcCCceeeeEEEEEEEeeecCCccccchhHHHHHHHHHHHHHHHhCCCeEEeeEEEEEEEcc
Confidence            89999999999999999999999999999999999999888888899999999999999999999999999999999999


Q ss_pred             ccchhHHHHHHhccCcEEeeccccCCCCcEEEEEecccccccCchHHHhhccccceEeeecccceeecCCCCcCcccccC
Q psy15088       1159 ADCVSAVYTVLAKRRGHVTQDAPVPGSPLYTIKAFIPAIDSFGFETDLRTHTQGQAFCLSVFHHWQIVPGDPLDKSIVIR 1238 (1291)
Q Consensus      1159 ~~~lg~V~~~L~~RRG~I~~~~~~~gt~~~~I~a~lPv~esfgf~~~LRs~T~G~a~~~~~f~~~~~v~~dp~~~~~~~~ 1238 (1291)
                      ++++|+||++|++|||+|+++++..|+++++|+|++|++|||||+++||++|+|+|+|+|.|+||+++|+||++.+    
T Consensus       737 ~e~~G~V~~dL~~RRG~i~~~~~~~g~~~~~I~a~vP~aE~fgy~~~LRs~T~G~g~~~~~F~~y~~vp~~~~~~~----  812 (842)
T 1n0u_A          737 EQAVGGIYSVLNKKRGQVVSEEQRPGTPLFTVKAYLPVNESFGFTGELRQATGGQAFPQMVFDHWSTLGSDPLDPT----  812 (842)
T ss_dssp             GGGHHHHHHHHHTTTCEEEEEEC---CCCEEEEEEEEGGGCTTHHHHHHHHTTTCCEEEEEEEEEEECCSCTTCTT----
T ss_pred             HHHHHHHHHHHHhcCcEEeccccCCCCceEEEEEEcChHHhhhhHHHHHhhCCCCceEEEEeccceeCCCCccchh----
Confidence            9999999999999999999988877878999999999999999999999999999999999999999999999753    


Q ss_pred             CCCCCCcccHHHHHHHHHhhccCCCCCC-CccccCCH
Q psy15088       1239 PLEPQPATHLAREFMIKTRRRKGLSEDV-SINKFFDD 1274 (1291)
Q Consensus      1239 ~~~~~~~~~~a~~~~~~iR~rKGl~~~~-~~~~~~d~ 1274 (1291)
                              |+|++||++|||||||++++ ++++|+|+
T Consensus       813 --------~~a~~~~~~~R~rKGl~~~~p~~~~~~d~  841 (842)
T 1n0u_A          813 --------SKAGEIVLAARKRHGMKEEVPGWQEYYDK  841 (842)
T ss_dssp             --------SHHHHHHHHHHHHTTCCSSCCCGGGGCCC
T ss_pred             --------hHHHHHHHHHHHhCCCCCCCCCHHHhccC
Confidence                    99999999999999999999 79999995
>4fn5_A EF-G 1, elongation factor G 1; translation, translation-antibiotic compl; HET: 0UO; 2.90A {Pseudomonas aeruginosa} Back     alignment and structure
>2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H Back     alignment and structure
>3j25_A Tetracycline resistance protein TETM; antibiotic resistance, translation; HET: GCP; 7.20A {Enterococcus faecalis} Back     alignment and structure
>2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} Back     alignment and structure
>1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Back     alignment and structure
>3vqt_A RF-3, peptide chain release factor 3; translation, GTPase; HET: GDP; 1.80A {Desulfovibrio vulgaris} PDB: 3vr1_A* Back     alignment and structure
>2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* Back     alignment and structure
>3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* Back     alignment and structure
>2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* Back     alignment and structure
>3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} Back     alignment and structure
>1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* Back     alignment and structure
>3e3x_A BIPA; MCSG,PSI2, structural genomics, protein struct initiative, midwest center for structural genomics, GTP-BIN nucleotide-binding; HET: MLZ MLY; 1.95A {Vibrio parahaemolyticus} Back     alignment and structure
>2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H Back     alignment and structure
>4fn5_A EF-G 1, elongation factor G 1; translation, translation-antibiotic compl; HET: 0UO; 2.90A {Pseudomonas aeruginosa} Back     alignment and structure
>2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... Back     alignment and structure
>1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* Back     alignment and structure
>3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus} Back     alignment and structure
>1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* Back     alignment and structure
>2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Back     alignment and structure
>1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Back     alignment and structure
>2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} Back     alignment and structure
>3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A Back     alignment and structure
>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A Back     alignment and structure
>3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* Back     alignment and structure
>1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* Back     alignment and structure
>3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3j25_A Tetracycline resistance protein TETM; antibiotic resistance, translation; HET: GCP; 7.20A {Enterococcus faecalis} Back     alignment and structure
>1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} Back     alignment and structure
>3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} Back     alignment and structure
>1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* Back     alignment and structure
>3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* Back     alignment and structure
>3vqt_A RF-3, peptide chain release factor 3; translation, GTPase; HET: GDP; 1.80A {Desulfovibrio vulgaris} PDB: 3vr1_A* Back     alignment and structure
>3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus} Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
>1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A Back     alignment and structure
>3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* Back     alignment and structure
>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* Back     alignment and structure
>1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A Back     alignment and structure
>3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Back     alignment and structure
>1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* Back     alignment and structure
>2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* Back     alignment and structure
>1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* Back     alignment and structure
>2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Back     alignment and structure
>3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* Back     alignment and structure
>2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Back     alignment and structure
>3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B Back     alignment and structure
>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Back     alignment and structure
>3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} Back     alignment and structure
>1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* Back     alignment and structure
>2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>3e3x_A BIPA; MCSG,PSI2, structural genomics, protein struct initiative, midwest center for structural genomics, GTP-BIN nucleotide-binding; HET: MLZ MLY; 1.95A {Vibrio parahaemolyticus} Back     alignment and structure
>3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Back     alignment and structure
>1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} Back     alignment and structure
>3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>4a9a_A Ribosome-interacting GTPase 1; DRG-DFRP complex, ribosome binding GTPase; 2.67A {Saccharomyces cerevisiae} Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure
>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>3e1y_E Eukaryotic peptide chain release factor GTP-bindi ERF3A; translation termination, peptide release, PTC, P biosynthesis, GTP-binding; HET: ATP; 3.80A {Homo sapiens} Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 Back     alignment and structure
>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>4a9a_A Ribosome-interacting GTPase 1; DRG-DFRP complex, ribosome binding GTPase; 2.67A {Saccharomyces cerevisiae} Back     alignment and structure
>3r7w_B Gtpase2, GTP-binding protein GTR2; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_B* Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3q5d_A Atlastin-1; G protein, GTPase, GDP/GTP binding, hydrolase; HET: GDP; 2.70A {Homo sapiens} PDB: 3q5e_A* 3qnu_A* 3qof_A* Back     alignment and structure
>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>1vi7_A Hypothetical protein YIGZ; structural genomics, unknown function; 2.80A {Escherichia coli} SCOP: d.14.1.11 d.58.11.2 Back     alignment and structure
>1cip_A Protein (guanine nucleotide-binding protein alpha-1 subunit); GTPase, hydrolase; HET: GNP; 1.50A {Rattus norvegicus} SCOP: a.66.1.1 c.37.1.8 PDB: 1agr_A* 1bof_A* 1gdd_A* 1gfi_A* 1gia_A* 1gp2_A* 3ffa_A* 3ffb_A* 1gg2_A* 1git_A* 1svs_A* 1svk_A* 2zjz_A* 2zjy_A* 3ums_A* 2pz2_A* 2pz3_A* 1as0_A* 1as2_A* 1as3_A* ... Back     alignment and structure
>3r7w_B Gtpase2, GTP-binding protein GTR2; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_B* Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>4fid_A G protein alpha subunit; RAS-like domain, all-helical domain, GTP binding, nucleotide signaling protein, transducer, lipoprotein; HET: MLY MSE GDP; 2.62A {Entamoeba histolytica} Back     alignment and structure
>2cve_A Hypothetical protein TTHA1053; COG1739, UPF0029, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: TLA; 1.60A {Thermus thermophilus} SCOP: d.14.1.11 d.58.11.2 Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>1azs_C GS-alpha; complex (lyase/hydrolase), hydrolase, signal transducing protein, cyclase, effector enzyme; HET: GSP FKP; 2.30A {Bos taurus} SCOP: a.66.1.1 c.37.1.8 PDB: 1azt_A* 3c14_C* 3c15_C* 3c16_C* 1cjt_C* 1cjk_C* 1cju_C* 1cjv_C* 1tl7_C* 1cs4_C* 1u0h_C* 2gvd_C* 2gvz_C* 3e8a_C* 3g82_C* 3maa_C* 1cul_C* 3sn6_A* Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>2xtz_A Guanine nucleotide-binding protein alpha-1 subuni; hydrolase, G-protein signaling, SELF-activation, RAS-like DO; HET: GSP; 2.34A {Arabidopsis thaliana} Back     alignment and structure
>4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* Back     alignment and structure
>2ph1_A Nucleotide-binding protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Archaeoglobus fulgidus dsm 4304} PDB: 3kb1_A* Back     alignment and structure
>3ohm_A Guanine nucleotide-binding protein G(Q) subunit A; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Mus musculus} PDB: 2bcj_Q* 2rgn_A* 3ah8_A* Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>1xe1_A Hypothetical protein PF0907; structural genomics, unknown function, protein structure INI secsg, conserved hypothetical protein; HET: MSE; 2.00A {Pyrococcus furiosus} SCOP: b.43.3.1 Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>3bfv_A CAPA1, CAPB2, membrane protein CAPA1, protein tyrosine kinase; chimerical protein, P-loop protein, capsule biogenesis/degradation; HET: ADP; 1.80A {Staphylococcus aureus} PDB: 2ved_A* Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>1hyq_A MIND, cell division inhibitor (MIND-1); MINC, FTSZ, bacterial cell division, cell cycle; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.10 Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>3cwq_A Para family chromosome partitioning protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: ADP; 2.47A {Synechocystis SP} Back     alignment and structure
>1g3q_A MIND ATPase, cell division inhibitor; alpha-beta-alpha layered, protein-ADP complex, cell cycle, hydrolase; HET: ADP; 2.00A {Pyrococcus furiosus} SCOP: c.37.1.10 PDB: 1g3r_A* 1ion_A* Back     alignment and structure
>3lh2_S 4E10_1VI7A_S0_002_N (T88); epitope-scaffold, immune system; 2.65A {Artificial gene} Back     alignment and structure
>3cio_A ETK, tyrosine-protein kinase ETK; WZC, escherichia coli tyrosine kinase domain, signaling protein, transferase, inner membrane, membrane; 2.50A {Escherichia coli} Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3q9l_A Septum site-determining protein MIND; ATPase, bacterial cell division inhibitor, MINC, MINE, cell hydrolase; HET: ATP; 2.34A {Escherichia coli} PDB: 3r9i_A* 3r9j_A* Back     alignment and structure
>3kjh_A CO dehydrogenase/acetyl-COA synthase complex, accessory protein COOC; Zn-bound dimer, nickel binding protein, ATPase; 1.90A {Carboxydothermus hydrogenoformans} PDB: 3kjg_A* 3kje_A 3kji_A* Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Back     alignment and structure
>3k9g_A PF-32 protein; ssgcid, SBRI, decode biostructures, UW, NIH, niaid, borellia burgdorferi, plasmid partition protein, iodide; 2.25A {Borrelia burgdorferi} PDB: 3k9h_A Back     alignment and structure
>1wcv_1 SOJ, segregation protein; ATPase, bacterial, chromosome segregation; 1.6A {Thermus thermophilus} PDB: 2bej_A* 2bek_A* Back     alignment and structure
>2oze_A ORF delta'; para, walker type atpases, DNA segregation, PSM19035, plasmid, DNA binding protein; HET: AGS EPE; 1.83A {Streptococcus pyogenes} Back     alignment and structure
>1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>3la6_A Tyrosine-protein kinase WZC; P-loop protein, nucleotide binding domain, walker A motif, B protein kinase, oligomerization; HET: ADP; 3.20A {Escherichia coli} Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>3l82_B F-box only protein 4; TRFH domain, helix, GTPase domain, acetylation, ADP- ribosylation, alternative splicing, cell cycle, cell division; 2.40A {Homo sapiens} Back     alignment and structure
>3ea0_A ATPase, para family; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: ATP; 2.20A {Chlorobium tepidum} Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>4ido_A Atlastin-1; GTPase, GTP/GDP binding, hydrolase; HET: GDP; 2.09A {Homo sapiens} PDB: 4idn_A* 3q5d_A* 3q5e_A* 4idq_A* 4idp_A* 3qnu_A* 3qof_A* Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>3kjh_A CO dehydrogenase/acetyl-COA synthase complex, accessory protein COOC; Zn-bound dimer, nickel binding protein, ATPase; 1.90A {Carboxydothermus hydrogenoformans} PDB: 3kjg_A* 3kje_A 3kji_A* Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1291
d1n0ua3165 d.14.1.1 (A:561-725) Elongation factor 2 (eEF-2), 5e-54
d1n0ua3165 d.14.1.1 (A:561-725) Elongation factor 2 (eEF-2), 3e-37
d1n0ua1138 b.43.3.1 (A:344-481) Elongation factor 2 (eEF-2), 8e-34
d1n0ua1138 b.43.3.1 (A:344-481) Elongation factor 2 (eEF-2), 1e-04
d1n0ua5117 d.58.11.1 (A:726-842) Elongation factor 2 (eEF-2) 4e-31
d2bv3a589 d.58.11.1 (A:600-688) Elongation factor G (EF-G) { 5e-23
d1n0ua479 d.58.11.1 (A:482-560) Elongation factor 2 (eEF-2) 6e-22
d1n0ua479 d.58.11.1 (A:482-560) Elongation factor 2 (eEF-2) 1e-12
d2dy1a596 d.58.11.1 (A:570-665) Elongation factor G (EF-G) { 8e-21
d1n0ua2341 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N- 2e-20
d1n0ua2341 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N- 1e-10
d2dy1a2267 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-t 2e-12
d2bv3a2276 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-t 5e-12
d2bv3a2276 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-t 1e-11
d1teva_194 c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) 1e-11
d2bv3a475 d.58.11.1 (A:404-478) Elongation factor G (EF-G) { 1e-11
d2bv3a475 d.58.11.1 (A:404-478) Elongation factor G (EF-G) { 2e-04
d2c78a3204 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N 2e-10
d2c78a3204 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N 2e-09
d1qf9a_194 c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoi 3e-10
d2dy1a477 d.58.11.1 (A:378-454) Elongation factor G (EF-G) { 2e-09
d1ak2a1190 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Co 5e-09
d3adka_194 c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [ 1e-08
d1jnya3224 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N 2e-08
d1jnya3224 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N 0.001
d1ukza_196 c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Sac 2e-07
d1d2ea3196 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), 6e-07
d1d2ea3196 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), 1e-06
d1akya1180 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Bak 8e-07
d1s3ga1182 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bac 8e-07
d2ak3a1189 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow 1e-06
d2qn6a3205 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma su 1e-06
d1f60a3239 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N 8e-06
d1f60a3239 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N 4e-05
d1r5ba3245 c.37.1.8 (A:215-459) Eukaryotic peptide chain rele 5e-05
d1zina1182 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bac 6e-05
d1wb1a4179 c.37.1.8 (A:1-179) Elongation factor SelB, N-termi 9e-05
d1zunb3222 c.37.1.8 (B:16-237) Sulfate adenylate transferase 1e-04
d1g7sa4227 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N- 4e-04
d1g7sa4227 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N- 7e-04
d1zaka1189 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Mai 6e-04
d1kk1a3195 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma su 0.001
>d1n0ua3 d.14.1.1 (A:561-725) Elongation factor 2 (eEF-2), domain IV {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 165 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ribosomal protein S5 domain 2-like
superfamily: Ribosomal protein S5 domain 2-like
family: Translational machinery components
domain: Elongation factor 2 (eEF-2), domain IV
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score =  183 bits (466), Expect = 5e-54
 Identities = 70/168 (41%), Positives = 104/168 (61%), Gaps = 4/168 (2%)

Query: 979  VAFCETVVETSSLKCFAETPNKRNKITMIAEPLEKGLAEDIENQIVHIAWNKKRLGEFFQ 1038
            VA+ ETV   SS    +++PNK N+I + AEP+++ ++  IEN I++   + K       
Sbjct: 1    VAYRETVESESSQTALSKSPNKHNRIYLKAEPIDEEVSLAIENGIINPRDDFKARARIMA 60

Query: 1039 SKYDWDLLAARSIWAFGPEVTGPNILVDDTLPSEVDKGLLGSVKDSIVQGFQWGTREGPL 1098
              Y WD+  AR IW FGP+  GPN+++D T   +     L  +KDS+V  FQW T+EGP+
Sbjct: 61   DDYGWDVTDARKIWCFGPDGNGPNLVIDQTKAVQY----LHEIKDSVVAAFQWATKEGPI 116

Query: 1099 CEEPIRNVKFKILDAVIATEPLHRGGGQIIPTARRVAYSAFLMATPRL 1146
              E +R+V+  ILD  +  + +HRGGGQIIPT RR  Y+ FL+A P++
Sbjct: 117  FGEEMRSVRVNILDVTLHADAIHRGGGQIIPTMRRATYAGFLLADPKI 164
>d1n0ua3 d.14.1.1 (A:561-725) Elongation factor 2 (eEF-2), domain IV {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 165 Back     information, alignment and structure
>d1n0ua1 b.43.3.1 (A:344-481) Elongation factor 2 (eEF-2), domain II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 138 Back     information, alignment and structure
>d1n0ua1 b.43.3.1 (A:344-481) Elongation factor 2 (eEF-2), domain II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 138 Back     information, alignment and structure
>d1n0ua5 d.58.11.1 (A:726-842) Elongation factor 2 (eEF-2) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 117 Back     information, alignment and structure
>d2bv3a5 d.58.11.1 (A:600-688) Elongation factor G (EF-G) {Thermus thermophilus [TaxId: 274]} Length = 89 Back     information, alignment and structure
>d1n0ua4 d.58.11.1 (A:482-560) Elongation factor 2 (eEF-2) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 79 Back     information, alignment and structure
>d1n0ua4 d.58.11.1 (A:482-560) Elongation factor 2 (eEF-2) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 79 Back     information, alignment and structure
>d2dy1a5 d.58.11.1 (A:570-665) Elongation factor G (EF-G) {Thermus thermophilus, EF-G-2 [TaxId: 274]} Length = 96 Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 341 Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 341 Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Length = 267 Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Length = 276 Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Length = 276 Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 194 Back     information, alignment and structure
>d2bv3a4 d.58.11.1 (A:404-478) Elongation factor G (EF-G) {Thermus thermophilus [TaxId: 274]} Length = 75 Back     information, alignment and structure
>d2bv3a4 d.58.11.1 (A:404-478) Elongation factor G (EF-G) {Thermus thermophilus [TaxId: 274]} Length = 75 Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Length = 204 Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Length = 204 Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Length = 194 Back     information, alignment and structure
>d2dy1a4 d.58.11.1 (A:378-454) Elongation factor G (EF-G) {Thermus thermophilus, EF-G-2 [TaxId: 274]} Length = 77 Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Length = 190 Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Length = 194 Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 224 Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 224 Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 196 Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Length = 196 Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Length = 196 Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 180 Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Length = 182 Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Length = 189 Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Length = 205 Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 239 Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 239 Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 245 Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Length = 182 Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Length = 179 Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Length = 222 Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 227 Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 227 Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Length = 189 Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Length = 195 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1291
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 100.0
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 100.0
d1n0ua3165 Elongation factor 2 (eEF-2), domain IV {Baker's ye 100.0
d1n0ua3165 Elongation factor 2 (eEF-2), domain IV {Baker's ye 99.96
d1n0ua2341 Elongation factor 2 (eEF-2), N-terminal (G) domain 99.96
d1n0ua5117 Elongation factor 2 (eEF-2) {Baker's yeast (Saccha 99.95
d1n0ua1138 Elongation factor 2 (eEF-2), domain II {Baker's ye 99.93
d1n0ua2341 Elongation factor 2 (eEF-2), N-terminal (G) domain 99.92
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 99.9
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 99.87
d2dy1a596 Elongation factor G (EF-G) {Thermus thermophilus, 99.86
d1f60a3239 Elongation factor eEF-1alpha, N-terminal (G) domai 99.85
d1n0ua479 Elongation factor 2 (eEF-2) {Baker's yeast (Saccha 99.84
d2bv3a589 Elongation factor G (EF-G) {Thermus thermophilus [ 99.8
d2dy1a477 Elongation factor G (EF-G) {Thermus thermophilus, 99.76
d1zunb3222 Sulfate adenylate transferase subunit cysN/C, EF-T 99.75
d1jnya3224 Elongation factor eEF-1alpha, N-terminal (G) domai 99.74
d1r5ba3245 Eukaryotic peptide chain release factor ERF2, G do 99.72
d2bv3a475 Elongation factor G (EF-G) {Thermus thermophilus [ 99.71
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 99.69
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 99.67
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 99.67
d1f60a3239 Elongation factor eEF-1alpha, N-terminal (G) domai 99.66
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 99.65
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 99.63
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 99.61
d1zunb3222 Sulfate adenylate transferase subunit cysN/C, EF-T 99.6
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 99.59
d1n0ua479 Elongation factor 2 (eEF-2) {Baker's yeast (Saccha 99.58
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 99.57
d2bv3a1121 Elongation factor G (EF-G), domain II {Thermus the 99.57
d1jnya3224 Elongation factor eEF-1alpha, N-terminal (G) domai 99.49
d1r5ba3245 Eukaryotic peptide chain release factor ERF2, G do 99.49
d2dy1a1103 Elongation factor G (EF-G), domain II {Thermus the 99.47
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 99.46
d2bv3a3121 Elongation factor G (EF-G), domain IV {Thermus the 99.46
d2dy1a477 Elongation factor G (EF-G) {Thermus thermophilus, 99.42
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 99.38
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 99.37
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 99.28
d2bv3a475 Elongation factor G (EF-G) {Thermus thermophilus [ 99.28
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 99.26
d2dy1a3115 Elongation factor G (EF-G), domain IV {Thermus the 99.15
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 98.92
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 98.89
d2bv3a3121 Elongation factor G (EF-G), domain IV {Thermus the 98.81
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 98.72
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 98.72
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 98.7
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 98.68
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 98.65
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 98.49
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 98.47
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 98.47
d1nrjb_209 Signal recognition particle receptor beta-subunit 98.42
d2dy1a3115 Elongation factor G (EF-G), domain IV {Thermus the 98.41
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 98.35
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 98.33
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 98.33
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 98.33
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 98.32
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 98.31
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 98.3
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 98.25
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 98.2
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 98.17
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 98.14
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 98.13
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 98.12
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 98.08
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 98.02
d2fh5b1207 Signal recognition particle receptor beta-subunit 97.98
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 97.95
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 97.93
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 97.93
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 97.88
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 97.87
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 97.86
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 97.86
d1r5ba195 Eukaryotic peptide chain release factor ERF2, post 97.84
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 97.84
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 97.81
d1jnya195 Elongation factor eEF-1alpha, domain 2 {Archaeon S 97.8
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 97.76
d1f60a194 Elongation factor eEF-1alpha, domain 2 {Baker's ye 97.76
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 97.75
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 97.71
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 97.69
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 97.66
d1efca192 Elongation factor Tu (EF-Tu), domain 2 {Escherichi 97.66
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 97.65
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 97.62
d2c78a1100 Elongation factor Tu (EF-Tu), domain 2 {Thermus th 97.62
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 97.54
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 97.53
d1nrjb_209 Signal recognition particle receptor beta-subunit 97.53
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 97.45
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 97.43
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 97.43
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 97.41
d1wxqa1319 GTP-binding protein PH0525 {Pyrococcus horikoshii 97.41
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 97.38
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 97.38
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 97.35
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 97.35
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 97.34
d1d2ea198 Elongation factor Tu (EF-Tu), domain 2 {Cow (Bos t 97.34
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 97.33
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 97.29
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 97.29
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 97.27
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 97.25
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 97.24
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 97.23
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 97.22
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 97.21
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 97.2
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 97.2
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 97.19
d1xe1a_91 Hypothetical protein PF0907 {Pyrococcus furiosus [ 97.18
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 97.18
d1wb1a192 Elongation factor SelB, domains 2 and 4 {Methanoco 97.16
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 97.15
d1ni3a1296 YchF GTP-binding protein N-terminal domain {Fissio 97.14
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 97.13
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 97.1
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 97.07
d1s0ua1118 Initiation factor eIF2 gamma subunit, domain II {A 97.07
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 97.02
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 96.98
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 96.97
d2fh5b1207 Signal recognition particle receptor beta-subunit 96.96
d1zunb192 Sulfate adenylate transferase subunit cysN/C, EF-T 96.96
d1kk1a1121 Initiation factor eIF2 gamma subunit, domain II {A 96.93
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 96.91
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 96.9
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 96.9
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 96.88
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 96.85
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 96.82
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 96.82
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 96.82
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 96.77
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 96.76
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 96.75
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 96.71
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 96.68
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 96.66
d1jala1278 YchF GTP-binding protein N-terminal domain {Haemop 96.62
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 96.62
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 96.61
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 96.6
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 96.59
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 96.58
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 96.57
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 96.56
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 96.53
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 96.47
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 96.46
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 96.42
d2qn6a1114 Initiation factor eIF2 gamma subunit, domain II {S 96.38
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 96.38
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 96.31
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 96.3
d1jwyb_306 Dynamin G domain {Dictyostelium discoideum [TaxId: 96.25
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 96.18
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 96.15
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 96.12
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 96.12
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 96.07
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 96.05
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 96.03
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 95.99
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 95.91
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 95.89
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 95.82
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 95.81
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 95.73
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 95.7
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 95.67
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 95.63
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 95.62
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 95.57
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 95.51
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 95.48
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 95.43
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 95.43
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 95.42
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 95.3
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 95.0
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 94.86
d1g7sa2128 Initiation factor IF2/eIF5b, domains 2 and 4 {Arch 94.84
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 94.79
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 94.76
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 94.72
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 94.64
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 94.58
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 94.43
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 94.43
d1vi7a271 Hypothetical protein YigZ, C-terminal domain {Esch 94.36
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 94.28
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 94.26
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 94.2
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 94.14
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 94.12
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 94.05
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 94.02
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 93.97
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 93.68
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 93.61
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 93.47
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 93.24
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 93.03
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 92.9
d1jwyb_306 Dynamin G domain {Dictyostelium discoideum [TaxId: 91.82
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 91.5
d1g3qa_237 Cell division regulator MinD {Archaeon Pyrococcus 91.38
d1j8yf2211 GTPase domain of the signal sequence recognition p 91.12
d1okkd2207 GTPase domain of the signal recognition particle r 90.52
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 90.48
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 90.44
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 90.42
d1g7sa1101 Initiation factor IF2/eIF5b, domains 2 and 4 {Arch 90.08
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 90.0
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 89.98
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 89.64
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 89.52
d1ls1a2207 GTPase domain of the signal sequence recognition p 89.39
d1vmaa2213 GTPase domain of the signal recognition particle r 88.79
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 88.78
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 88.72
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 88.66
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 87.91
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 87.89
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 87.85
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 87.8
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 87.74
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 87.28
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 86.93
d1t95a373 Hypothetical protein AF0491, C-terminal domain {Ar 86.71
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 85.6
d1d1na_99 Initiation factor IF2/eIF5b, domains 2 and 4 {Baci 85.39
d2qy9a2211 GTPase domain of the signal recognition particle r 84.62
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 84.44
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 84.01
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 83.89
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 83.12
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 82.45
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 82.09
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 81.74
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 81.62
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 80.45
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 80.34
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 80.24
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Elongation factor G (EF-G), N-terminal (G) domain
species: Thermus thermophilus [TaxId: 274]

Probab=100.00  E-value=1.2e-36  Score=337.48  Aligned_cols=264  Identities=19%  Similarity=0.245  Sum_probs=198.8

Q ss_pred             ccccceEEEEcccCCChhHHHHHHHhhcCCcccCCccccccccccccccccccCceeeeccceecccccCCCCeEEEEEe
Q psy15088        397 PHLIRNVALVGHLHHGKTTMIDCLIRQTHPGYRQPAEEKNLRYTDTLFTEQERGVSIKASPVTLLLPDVKGKNYLMNIFD  476 (1291)
Q Consensus       397 ~~~irnI~iiG~~~~GKsTl~~~ll~~~~~i~~~~~~~~~~~~~D~~~~E~erGiTi~~~~~~~~~~~~~~~~~~~~liD  476 (1291)
                      .++||||||+||.|||||||+++|++.++.+.+.+.++++++++|+.++|++||+||+++..+|.|     +++.|||||
T Consensus         3 ~~~iRni~i~gh~~~GKTtL~e~ll~~~g~~~~~g~v~~~~~~~D~~~~E~~r~~si~~~~~~~~~-----~~~~~n~iD   77 (276)
T d2bv3a2           3 LKRLRNIGIAAHIDAGKTTTTERILYYTGRIHKIGEVHEGAATMDFMEQERERGITITAAVTTCFW-----KDHRINIID   77 (276)
T ss_dssp             GGGEEEEEEEECTTSCHHHHHHHHHHHHTSSCC-------------------CCCCCCCSEEEEEE-----TTEEEEEEC
T ss_pred             hhhceEEEEEeCCCCCHHHHHHHHHHhcCccccccceecCceEEeccHHHHhcCCccccceeeecc-----CCeEEEEec
Confidence            468999999999999999999999999999998888999999999999999999999999999999     899999999


Q ss_pred             CCCccccc--ccccccccceEEEEecCCCccchhhHhhHHHHHhhcCccchhhhhhhHHHHHHHHhhCCccCcHHHHHHH
Q psy15088        477 TPASPVTL--LLPDVKGKNYLMNIFDTPGMWDIHVRKFSKKAAHASAQRSFVEFVLEPVYKLVAQVVGDVDSSLPAVLDQ  554 (1291)
Q Consensus       477 TpGh~~~~--~l~~~~~ad~~v~vida~~g~~~qt~~~~~~~~~~~~~~~fv~fil~~i~k~~d~~~~~~~~~l~~i~~~  554 (1291)
                      ||||.+|.  +.+++..+|.||+|||+..|+++||+++|+++...++|+++  |||    | ||+..+++++.+.++..+
T Consensus        78 tPG~~dF~~e~~~~l~~~D~avlVvda~~Gv~~~T~~~w~~a~~~~lP~i~--fIN----K-mDr~~ad~~~~l~ei~~~  150 (276)
T d2bv3a2          78 APGHVDFTIEVERSMRVLDGAIVVFDSSQGVEPQSETVWRQAEKYKVPRIA--FAN----K-MDKTGADLWLVIRTMQER  150 (276)
T ss_dssp             CCSSSSCSTTHHHHHHHCCEEEEEEETTTSSCHHHHHHHHHHHTTTCCEEE--EEE----C-TTSTTCCHHHHHHHHHHT
T ss_pred             CCchhhhHHHHHHHHHhhhheEEeccccCCcchhHHHHHHHHHHcCCCEEE--EEe----c-ccccccccchhHHHHHHH
Confidence            99999876  66677778999999999999999999999999999999998  998    6 899999988888888888


Q ss_pred             hCCCcChhhhhcCchHHHHHHHhhccccccCCCccccccccccccccCceEEcccccccccCc-----eeecCCCCcc-C
Q psy15088        555 LGIHMNKEESKINIRPLLRLVYKVEVNRVPAGNWVLIEGIDQPIVKTSTITDLITNEDITSNK-----FLIDGFPRNQ-N  628 (1291)
Q Consensus       555 lg~~l~~~~~~~~~~~~l~~i~~~~~~~~P~~~~~~~~~~~~~~~~~~~liDll~~~~i~~~~-----~liDGfPr~~-~  628 (1291)
                      ||.++.                   +-|+|++.+..|          .|++|+++++.+.+..     +.....|... .
T Consensus       151 l~~~~v-------------------p~~~Pig~~~~f----------~GvvDl~~~~a~~~~~~~g~~~~~~~ip~~~~~  201 (276)
T d2bv3a2         151 LGARPV-------------------VMQLPIGREDTF----------SGIIDVLRMKAYTYGNDLGTDIREIPIPEEYLD  201 (276)
T ss_dssp             TCCCEE-------------------ECEEEESCGGGC----------CEEEETTTTEEEEESSSSSCCEEEECCCGGGHH
T ss_pred             hCCCeE-------------------EEEecccCCCce----------eEEeeccceEEEEecCCCCccceeccCchHHHH
Confidence            765222                   237899888766          5799999987664321     1222233322 2


Q ss_pred             ccchHHHHHHHHHHHHHhhhcCCCchHHHHHHhhcccCCCCCCCCCHHHHHHHH--hhccccccceEEeecchhhhhhhc
Q psy15088        629 NLDGWNKEMADKVELLYVLFFDCPEDVCVRRCLKRGAEGSGRADDNEESLKKRI--SVYNTETMPIIKFFEAKNLVKRFN  706 (1291)
Q Consensus       629 qa~~~~~~l~e~~~l~~v~~ld~~~e~l~~R~l~rg~~~~~r~dd~~e~i~~rl--~~~~~~~~PVl~~sa~k~~~~~~~  706 (1291)
                      ++..++..+.+.+       .+. ++.+++++++.+       +.+.+++.+.+  ...++.+.||+|||+.+|     .
T Consensus       202 ~~~~~~~~l~e~v-------ae~-Dd~L~e~yle~~-------e~~~eel~~~l~~a~~~g~i~PV~~GSA~~n-----~  261 (276)
T d2bv3a2         202 QAREYHEKLVEVA-------ADF-DENIMLKYLEGE-------EPTEEELVAAIRKGTIDLKITPVFLGSALKN-----K  261 (276)
T ss_dssp             HHHHHHHHHHHHH-------HTT-CHHHHHHHHHTC-------CCCHHHHHHHHHHHHHTTSCEEEEECBTTTT-----B
T ss_pred             HHHHHHHHHhhhh-------hcc-cHHHHHHHhcCC-------CCCHHHHHHHHHHHHhcCcEEEEEEeECCCC-----c
Confidence            3444554444432       333 456778888754       36778888876  446789999999999999     9


Q ss_pred             hhHHHHHHHHhhCCC
Q psy15088        707 AEKSLVEMCVKHIPS  721 (1291)
Q Consensus       707 g~~~LLD~Iv~~lPs  721 (1291)
                      |++.|||++++++||
T Consensus       262 GV~~LLD~i~~~~PS  276 (276)
T d2bv3a2         262 GVQLLLDAVVDYLPS  276 (276)
T ss_dssp             SHHHHHHHHHHHSCC
T ss_pred             CHHHHHHHHHHhCCC
Confidence            999999999999997
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1n0ua3 d.14.1.1 (A:561-725) Elongation factor 2 (eEF-2), domain IV {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1n0ua3 d.14.1.1 (A:561-725) Elongation factor 2 (eEF-2), domain IV {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1n0ua5 d.58.11.1 (A:726-842) Elongation factor 2 (eEF-2) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1n0ua1 b.43.3.1 (A:344-481) Elongation factor 2 (eEF-2), domain II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d2dy1a5 d.58.11.1 (A:570-665) Elongation factor G (EF-G) {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1n0ua4 d.58.11.1 (A:482-560) Elongation factor 2 (eEF-2) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bv3a5 d.58.11.1 (A:600-688) Elongation factor G (EF-G) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2dy1a4 d.58.11.1 (A:378-454) Elongation factor G (EF-G) {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2bv3a4 d.58.11.1 (A:404-478) Elongation factor G (EF-G) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1n0ua4 d.58.11.1 (A:482-560) Elongation factor 2 (eEF-2) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d2bv3a1 b.43.3.1 (A:283-403) Elongation factor G (EF-G), domain II {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2dy1a1 b.43.3.1 (A:275-377) Elongation factor G (EF-G), domain II {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2bv3a3 d.14.1.1 (A:479-599) Elongation factor G (EF-G), domain IV {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2dy1a4 d.58.11.1 (A:378-454) Elongation factor G (EF-G) {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2bv3a4 d.58.11.1 (A:404-478) Elongation factor G (EF-G) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d2dy1a3 d.14.1.1 (A:455-569) Elongation factor G (EF-G), domain IV {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2bv3a3 d.14.1.1 (A:479-599) Elongation factor G (EF-G), domain IV {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dy1a3 d.14.1.1 (A:455-569) Elongation factor G (EF-G), domain IV {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1r5ba1 b.43.3.1 (A:460-554) Eukaryotic peptide chain release factor ERF2, post-G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jnya1 b.43.3.1 (A:228-322) Elongation factor eEF-1alpha, domain 2 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f60a1 b.43.3.1 (A:241-334) Elongation factor eEF-1alpha, domain 2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1efca1 b.43.3.1 (A:205-296) Elongation factor Tu (EF-Tu), domain 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c78a1 b.43.3.1 (A:213-312) Elongation factor Tu (EF-Tu), domain 2 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1d2ea1 b.43.3.1 (A:251-348) Elongation factor Tu (EF-Tu), domain 2 {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xe1a_ b.43.3.1 (A:) Hypothetical protein PF0907 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wb1a1 b.43.3.1 (A:180-271) Elongation factor SelB, domains 2 and 4 {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s0ua1 b.43.3.1 (A:230-347) Initiation factor eIF2 gamma subunit, domain II {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zunb1 b.43.3.1 (B:238-329) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain 2-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1kk1a1 b.43.3.1 (A:201-321) Initiation factor eIF2 gamma subunit, domain II {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2qn6a1 b.43.3.1 (A:207-320) Initiation factor eIF2 gamma subunit, domain II {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g7sa2 b.43.3.1 (A:460-587) Initiation factor IF2/eIF5b, domains 2 and 4 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vi7a2 d.58.11.2 (A:138-208) Hypothetical protein YigZ, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g7sa1 b.43.3.1 (A:228-328) Initiation factor IF2/eIF5b, domains 2 and 4 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1t95a3 d.58.11.3 (A:162-234) Hypothetical protein AF0491, C-terminal domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1d1na_ b.43.3.1 (A:) Initiation factor IF2/eIF5b, domains 2 and 4 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure