Psyllid ID: psy15122
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 927 | ||||||
| 307176412 | 1390 | Protein diaphanous [Camponotus floridanu | 0.466 | 0.310 | 0.592 | 1e-162 | |
| 383865142 | 1090 | PREDICTED: uncharacterized protein LOC10 | 0.487 | 0.414 | 0.570 | 1e-160 | |
| 332025076 | 468 | Protein diaphanous [Acromyrmex echinatio | 0.466 | 0.923 | 0.594 | 1e-159 | |
| 350419329 | 1061 | PREDICTED: hypothetical protein LOC10074 | 0.468 | 0.409 | 0.582 | 1e-158 | |
| 193671635 | 1089 | PREDICTED: hypothetical protein LOC10016 | 0.471 | 0.401 | 0.591 | 1e-157 | |
| 340708834 | 1095 | PREDICTED: hypothetical protein LOC10064 | 0.468 | 0.396 | 0.580 | 1e-157 | |
| 307207075 | 1669 | Protein diaphanous [Harpegnathos saltato | 0.468 | 0.260 | 0.570 | 1e-156 | |
| 242015037 | 1051 | diaphanous, putative [Pediculus humanus | 0.463 | 0.409 | 0.583 | 1e-156 | |
| 328791565 | 1089 | PREDICTED: hypothetical protein LOC41219 | 0.524 | 0.446 | 0.521 | 1e-152 | |
| 345492524 | 1383 | PREDICTED: hypothetical protein LOC10011 | 0.466 | 0.312 | 0.573 | 1e-152 |
| >gi|307176412|gb|EFN65986.1| Protein diaphanous [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
Score = 578 bits (1490), Expect = e-162, Method: Compositional matrix adjust.
Identities = 278/469 (59%), Positives = 360/469 (76%), Gaps = 37/469 (7%)
Query: 67 ENKKQENMLEKLNPEQLNQKFEDMLNDMNLSDEKKEPLRRQPLANKKKMLLMHYKGTVTS 126
E ++Q ++E+++ E +N +FE+ML +MNL++EKKEPLR+Q + KK+ML++HYKG++
Sbjct: 96 EIEQQRCIIERMDEETVNDRFEEMLANMNLTEEKKEPLRQQSESKKKEMLVLHYKGSIQ- 154
Query: 127 YENKSKFDKPIEYIQYLSQPELSVNKMYSCIESLRIALTNHPLSWVNEFVLQDNKNFRKY 186
EN+SKFDKP +YIQYL+QP+LSVNK+Y+CIESLRIALTN+PLSWV EF + K
Sbjct: 155 -ENRSKFDKPADYIQYLAQPDLSVNKIYNCIESLRIALTNNPLSWVQEFGTKGLKQV--- 210
Query: 187 PIAFLYPRFPSRSRNDSRYDRVQYECVRCIRAIMNNTVGLKQMFGQKEALTIVARSLDPN 246
+A L + RND+RY+R+QYEC+RC++AIMNNTVG+K+M EALTIVARSL+P
Sbjct: 211 -LATLNECY----RNDNRYERIQYECIRCLKAIMNNTVGIKEMLAHHEALTIVARSLEPT 265
Query: 247 KPTVMLEAVKVLAAVCLIPPDGHDKVIKAITMSGELKGKERFQPVVQGLMVKGNNEALRT 306
KP+VM EAVK+L AVCLI D H KV+ AITM+GE KG+ERF P+VQGLM K NE LR
Sbjct: 266 KPSVMSEAVKLLGAVCLISSDSHKKVLDAITMNGEFKGRERFLPIVQGLMNK-KNENLRV 324
Query: 307 ACLQLINAIVATPDDLEFRLHLRNEIMRVGLYDLLDALEKDASEDVSVQLKVFIEHKEED 366
CLQLIN+I+++ +DL+FRLHLRNE+MRVGL D+L+ LEKD SED++ LK+F +HKEED
Sbjct: 325 VCLQLINSIISSAEDLDFRLHLRNEVMRVGLADILEMLEKDESEDLATHLKIFNDHKEED 384
Query: 367 YYEFIQRFDNVRMEIDDVNDCFETVRNMVMDSACEPYLLSILQHLLFIRDDQNMVMDSAC 426
Y EF+QRFDNVR+E+DDVNDCFE V+NMVMD+ EPY LSILQHLLF
Sbjct: 385 YEEFVQRFDNVRLELDDVNDCFEVVKNMVMDTTAEPYFLSILQHLLF------------- 431
Query: 427 EPYLLSILQHLLFIRDDQYVRLAYYKLLEECVSQIVLHRGGCDPDFRSSRRFQLDVQPLV 486
IRDD VR AYYKL+EEC+SQ+VLHR GCDPDF +++RFQ+DVQPL+
Sbjct: 432 -------------IRDDALVRTAYYKLIEECISQVVLHRSGCDPDFSATKRFQIDVQPLI 478
Query: 487 EHLAEKSKTEEDRRVEDLSAKLEEAIMLRQEAEAKLVQAQKTLEDLSSG 535
+ L EKS+ EE+RR+ +++ KLEEAI RQEAEAKL A+ +++L G
Sbjct: 479 DTLVEKSRAEEERRLVEVTQKLEEAIASRQEAEAKLQHAENKIKELEQG 527
|
Source: Camponotus floridanus Species: Camponotus floridanus Genus: Camponotus Family: Formicidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|383865142|ref|XP_003708034.1| PREDICTED: uncharacterized protein LOC100883678 [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|332025076|gb|EGI65259.1| Protein diaphanous [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|350419329|ref|XP_003492145.1| PREDICTED: hypothetical protein LOC100741633 [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|193671635|ref|XP_001943564.1| PREDICTED: hypothetical protein LOC100160854 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|340708834|ref|XP_003393024.1| PREDICTED: hypothetical protein LOC100642832 [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|307207075|gb|EFN84884.1| Protein diaphanous [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|242015037|ref|XP_002428185.1| diaphanous, putative [Pediculus humanus corporis] gi|212512728|gb|EEB15447.1| diaphanous, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|328791565|ref|XP_395654.4| PREDICTED: hypothetical protein LOC412191 [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|345492524|ref|XP_003426869.1| PREDICTED: hypothetical protein LOC100115587 isoform 2 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 927 | ||||||
| FB|FBgn0011202 | 1091 | dia "diaphanous" [Drosophila m | 0.362 | 0.307 | 0.430 | 8e-153 | |
| UNIPROTKB|E1BVL7 | 1091 | DIAPH1 "Uncharacterized protei | 0.497 | 0.422 | 0.348 | 4.1e-126 | |
| UNIPROTKB|O60879 | 1101 | DIAPH2 "Protein diaphanous hom | 0.528 | 0.445 | 0.329 | 2e-121 | |
| UNIPROTKB|K4DI95 | 1101 | DIAPH2 "Diaphanous homolog 2 ( | 0.528 | 0.445 | 0.329 | 3.3e-121 | |
| UNIPROTKB|F1Q1Q1 | 1103 | DIAPH2 "Uncharacterized protei | 0.522 | 0.438 | 0.327 | 6.2e-120 | |
| UNIPROTKB|C9J6U3 | 1097 | DIAPH2 "Protein diaphanous hom | 0.510 | 0.431 | 0.325 | 2.7e-119 | |
| MGI|MGI:1858500 | 1098 | Diap2 "diaphanous homolog 2 (D | 0.453 | 0.382 | 0.334 | 1.7e-118 | |
| RGD|1310707 | 1218 | Diaph1 "diaphanous homolog 1 ( | 0.380 | 0.289 | 0.367 | 2.4e-118 | |
| UNIPROTKB|A6NML8 | 1096 | DIAPH2 "Protein diaphanous hom | 0.528 | 0.447 | 0.329 | 2.6e-118 | |
| MGI|MGI:1194490 | 1255 | Diap1 "diaphanous homolog 1 (D | 0.550 | 0.406 | 0.296 | 2.1e-117 |
| FB|FBgn0011202 dia "diaphanous" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 755 (270.8 bits), Expect = 8.0e-153, Sum P(3) = 8.0e-153
Identities = 155/360 (43%), Positives = 235/360 (65%)
Query: 72 ENMLEKLNPEQLNQKFEDMLNDMNLSDEKKEPLRRQPLANKKKMLLMHYKGTVTSYENK- 130
E +++L+ +L+ KF +++ DMN+ +K+EPL + ++KM++ H KG S E
Sbjct: 56 EQYIQQLSVAELDAKFLEIIEDMNIPKDKREPLLAKSKEERQKMIMWHLKGK-NSLERSA 114
Query: 131 -SKFDKPIEYIQYLSQPELSVNKMYSCIESLRIALTNHPLSWVNEFVLQDNKNFRKYPIA 189
S+F+KPI+Y++YL E S +K+Y C+ESLR+ALT++P+SW+ EF + K +A
Sbjct: 115 NSRFEKPIDYVEYLQNGEHSTHKVYQCVESLRVALTSNPISWIKEFGVAGIGTIEKL-LA 173
Query: 190 FLYPRFPSRSRNDSRYDRVQYECVRCIRAIMNNTVGLKQMFG--QKEALTIVARSLDPNK 247
RS+N++ Y+++++E +RC++AIMNNT GL + Q + ++A+SLDP K
Sbjct: 174 --------RSKNNASYEKIEFEAIRCLKAIMNNTWGLNVVLNPDQHSVVLLLAQSLDPRK 225
Query: 248 PTVMLEAVKVLAAVCLI-PPDGHDKVIKAITM--SGELKGKERFQPVVQGLMVKGNNEAL 304
P M EA+K+LA+ C++ +G++KV++AIT + K ERF+P+V L +
Sbjct: 226 PQTMCEALKLLASFCIVYERNGYEKVLRAITTIAATSFKASERFRPIVDALFASDQQDPK 285
Query: 305 RT-ACLQLI--NAIVATPDDLEFRLHLRNEIMRVGLYDLLDALEK--DASEDVSVQ--LK 357
R AC LI N + TP DL FRLHLR EIMR+GLYD LD K +AS + ++Q K
Sbjct: 286 RDLACHSLIFINTLTNTPTDLNFRLHLRCEIMRMGLYDRLDEFTKIVEASNNENLQQHFK 345
Query: 358 VFIEHKEEDYYEFIQRFDNVRMEIDDVNDCFETVRNMVMDSACEPYLLSILQHLLFIRDD 417
+F E +E+D+ EF+QRFDNV +DD DCF+ ++N+V D+ EPY LSILQHLL+IRDD
Sbjct: 346 IFNEIREDDFEEFVQRFDNVTFNMDDATDCFDVLKNLVTDTTSEPYFLSILQHLLYIRDD 405
|
|
| UNIPROTKB|E1BVL7 DIAPH1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O60879 DIAPH2 "Protein diaphanous homolog 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|K4DI95 DIAPH2 "Diaphanous homolog 2 (Drosophila), isoform CRA_a" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1Q1Q1 DIAPH2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|C9J6U3 DIAPH2 "Protein diaphanous homolog 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1858500 Diap2 "diaphanous homolog 2 (Drosophila)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1310707 Diaph1 "diaphanous homolog 1 (Drosophila)" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A6NML8 DIAPH2 "Protein diaphanous homolog 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1194490 Diap1 "diaphanous homolog 1 (Drosophila)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 927 | |||
| pfam02181 | 372 | pfam02181, FH2, Formin Homology 2 Domain | 7e-58 | |
| pfam06367 | 197 | pfam06367, Drf_FH3, Diaphanous FH3 Domain | 3e-55 | |
| smart00498 | 392 | smart00498, FH2, Formin Homology 2 Domain | 9e-49 | |
| pfam06371 | 187 | pfam06371, Drf_GBD, Diaphanous GTPase-binding Doma | 6e-38 | |
| pfam06346 | 160 | pfam06346, Drf_FH1, Formin Homology Region 1 | 5e-11 | |
| pfam06346 | 160 | pfam06346, Drf_FH1, Formin Homology Region 1 | 2e-10 | |
| pfam06346 | 160 | pfam06346, Drf_FH1, Formin Homology Region 1 | 5e-10 | |
| pfam06346 | 160 | pfam06346, Drf_FH1, Formin Homology Region 1 | 9e-10 | |
| pfam06346 | 160 | pfam06346, Drf_FH1, Formin Homology Region 1 | 2e-09 | |
| pfam06346 | 160 | pfam06346, Drf_FH1, Formin Homology Region 1 | 4e-09 | |
| pfam06346 | 160 | pfam06346, Drf_FH1, Formin Homology Region 1 | 4e-09 | |
| pfam06346 | 160 | pfam06346, Drf_FH1, Formin Homology Region 1 | 6e-09 | |
| pfam06346 | 160 | pfam06346, Drf_FH1, Formin Homology Region 1 | 8e-09 | |
| pfam06346 | 160 | pfam06346, Drf_FH1, Formin Homology Region 1 | 8e-08 | |
| pfam06346 | 160 | pfam06346, Drf_FH1, Formin Homology Region 1 | 2e-07 | |
| pfam07174 | 297 | pfam07174, FAP, Fibronectin-attachment protein (FA | 5e-07 | |
| pfam01391 | 60 | pfam01391, Collagen, Collagen triple helix repeat | 2e-06 | |
| pfam01391 | 60 | pfam01391, Collagen, Collagen triple helix repeat | 2e-06 | |
| pfam01391 | 60 | pfam01391, Collagen, Collagen triple helix repeat | 3e-06 | |
| pfam07174 | 297 | pfam07174, FAP, Fibronectin-attachment protein (FA | 5e-06 | |
| pfam12526 | 115 | pfam12526, DUF3729, Protein of unknown function (D | 2e-05 | |
| pfam07174 | 297 | pfam07174, FAP, Fibronectin-attachment protein (FA | 3e-05 | |
| pfam01391 | 60 | pfam01391, Collagen, Collagen triple helix repeat | 4e-05 | |
| pfam07174 | 297 | pfam07174, FAP, Fibronectin-attachment protein (FA | 5e-05 | |
| pfam07174 | 297 | pfam07174, FAP, Fibronectin-attachment protein (FA | 7e-05 | |
| COG5178 | 2365 | COG5178, PRP8, U5 snRNP spliceosome subunit [RNA p | 7e-05 | |
| pfam01391 | 60 | pfam01391, Collagen, Collagen triple helix repeat | 8e-05 | |
| pfam06346 | 160 | pfam06346, Drf_FH1, Formin Homology Region 1 | 2e-04 | |
| PHA01732 | 94 | PHA01732, PHA01732, proline-rich protein | 2e-04 | |
| pfam04554 | 57 | pfam04554, Extensin_2, Extensin-like region | 2e-04 | |
| pfam10349 | 111 | pfam10349, WWbp, WW-domain ligand protein | 2e-04 | |
| pfam07174 | 297 | pfam07174, FAP, Fibronectin-attachment protein (FA | 3e-04 | |
| PRK14965 | 576 | PRK14965, PRK14965, DNA polymerase III subunits ga | 3e-04 | |
| pfam07174 | 297 | pfam07174, FAP, Fibronectin-attachment protein (FA | 4e-04 | |
| pfam04554 | 57 | pfam04554, Extensin_2, Extensin-like region | 4e-04 | |
| pfam10349 | 111 | pfam10349, WWbp, WW-domain ligand protein | 4e-04 | |
| pfam06003 | 264 | pfam06003, SMN, Survival motor neuron protein (SMN | 4e-04 | |
| pfam12446 | 133 | pfam12446, DUF3682, Protein of unknown function (D | 4e-04 | |
| pfam12526 | 115 | pfam12526, DUF3729, Protein of unknown function (D | 5e-04 | |
| pfam04554 | 57 | pfam04554, Extensin_2, Extensin-like region | 5e-04 | |
| pfam05518 | 753 | pfam05518, Totivirus_coat, Totivirus coat protein | 5e-04 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 6e-04 | |
| PHA03282 | 540 | PHA03282, PHA03282, envelope glycoprotein E; Provi | 6e-04 | |
| pfam04554 | 57 | pfam04554, Extensin_2, Extensin-like region | 7e-04 | |
| pfam07777 | 189 | pfam07777, MFMR, G-box binding protein MFMR | 7e-04 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 8e-04 | |
| smart00818 | 165 | smart00818, Amelogenin, Amelogenins, cell adhesion | 8e-04 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 8e-04 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 9e-04 | |
| PHA01732 | 94 | PHA01732, PHA01732, proline-rich protein | 0.001 | |
| pfam04487 | 206 | pfam04487, CITED, CITED | 0.001 | |
| pfam04554 | 57 | pfam04554, Extensin_2, Extensin-like region | 0.002 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 0.002 | |
| smart00818 | 165 | smart00818, Amelogenin, Amelogenins, cell adhesion | 0.002 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 0.002 | |
| pfam04959 | 211 | pfam04959, ARS2, Arsenite-resistance protein 2 | 0.002 | |
| PRK12438 | 991 | PRK12438, PRK12438, hypothetical protein; Provisio | 0.002 | |
| pfam11029 | 136 | pfam11029, DAZAP2, DAZ associated protein 2 (DAZAP | 0.002 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 0.003 | |
| pfam12316 | 202 | pfam12316, Dsh_C, Segment polarity protein disheve | 0.003 | |
| smart00818 | 165 | smart00818, Amelogenin, Amelogenins, cell adhesion | 0.004 | |
| smart00818 | 165 | smart00818, Amelogenin, Amelogenins, cell adhesion | 0.004 | |
| pfam10152 | 147 | pfam10152, DUF2360, Predicted coiled-coil domain-c | 0.004 |
| >gnl|CDD|216919 pfam02181, FH2, Formin Homology 2 Domain | Back alignment and domain information |
|---|
Score = 203 bits (518), Expect = 7e-58
Identities = 77/201 (38%), Positives = 124/201 (61%), Gaps = 2/201 (0%)
Query: 591 PEMYTDCHKNIINGKQACEEVKQSKKLAKILELILLMGNYMNSGSRNGGAFGFEINFLTK 650
E + ++ + A EE+++S+K K+LELIL +GNYMNSG+R G A GF+++ L K
Sbjct: 173 EEEVEELKPSLETLEAASEELRESRKFKKLLELILALGNYMNSGTRRGNAKGFKLSSLLK 232
Query: 651 LSSTKDIENKTTLLHYLVDTIEQKFPECLKFGDELLHVDRAARVSTDVIQNSIRQMENNI 710
LS TK +NKTTLLHYLV I +K P+ L F EL HV++AA+V + ++ ++++E +
Sbjct: 233 LSDTKSTDNKTTLLHYLVKIIREKLPDLLDFSSELSHVEKAAKVDLEQLEKDVKELEKGL 292
Query: 711 KNLETDIQNCKQAPVANENDKFLEIMEPFAKEVRQKITLLSNMSKNMMTLYGDLAEFYTF 770
K LE +++ + +DKF+E M+ F +E +K+ L ++ K M L+ +L E++
Sbjct: 293 KKLERELELSALDE--HPDDKFVEKMKEFLEEAEEKLDKLESLLKEAMELFKELTEYFGE 350
Query: 771 DKNIYTLEEFFTDIKTFKDSF 791
D + EEFF ++ F F
Sbjct: 351 DPKETSPEEFFKILRDFLRMF 371
|
Length = 372 |
| >gnl|CDD|219000 pfam06367, Drf_FH3, Diaphanous FH3 Domain | Back alignment and domain information |
|---|
| >gnl|CDD|214697 smart00498, FH2, Formin Homology 2 Domain | Back alignment and domain information |
|---|
| >gnl|CDD|219001 pfam06371, Drf_GBD, Diaphanous GTPase-binding Domain | Back alignment and domain information |
|---|
| >gnl|CDD|148139 pfam06346, Drf_FH1, Formin Homology Region 1 | Back alignment and domain information |
|---|
| >gnl|CDD|148139 pfam06346, Drf_FH1, Formin Homology Region 1 | Back alignment and domain information |
|---|
| >gnl|CDD|148139 pfam06346, Drf_FH1, Formin Homology Region 1 | Back alignment and domain information |
|---|
| >gnl|CDD|148139 pfam06346, Drf_FH1, Formin Homology Region 1 | Back alignment and domain information |
|---|
| >gnl|CDD|148139 pfam06346, Drf_FH1, Formin Homology Region 1 | Back alignment and domain information |
|---|
| >gnl|CDD|148139 pfam06346, Drf_FH1, Formin Homology Region 1 | Back alignment and domain information |
|---|
| >gnl|CDD|148139 pfam06346, Drf_FH1, Formin Homology Region 1 | Back alignment and domain information |
|---|
| >gnl|CDD|148139 pfam06346, Drf_FH1, Formin Homology Region 1 | Back alignment and domain information |
|---|
| >gnl|CDD|148139 pfam06346, Drf_FH1, Formin Homology Region 1 | Back alignment and domain information |
|---|
| >gnl|CDD|148139 pfam06346, Drf_FH1, Formin Homology Region 1 | Back alignment and domain information |
|---|
| >gnl|CDD|148139 pfam06346, Drf_FH1, Formin Homology Region 1 | Back alignment and domain information |
|---|
| >gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) | Back alignment and domain information |
|---|
| >gnl|CDD|189968 pfam01391, Collagen, Collagen triple helix repeat (20 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|189968 pfam01391, Collagen, Collagen triple helix repeat (20 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|189968 pfam01391, Collagen, Collagen triple helix repeat (20 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) | Back alignment and domain information |
|---|
| >gnl|CDD|152960 pfam12526, DUF3729, Protein of unknown function (DUF3729) | Back alignment and domain information |
|---|
| >gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) | Back alignment and domain information |
|---|
| >gnl|CDD|189968 pfam01391, Collagen, Collagen triple helix repeat (20 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) | Back alignment and domain information |
|---|
| >gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) | Back alignment and domain information |
|---|
| >gnl|CDD|227505 COG5178, PRP8, U5 snRNP spliceosome subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >gnl|CDD|189968 pfam01391, Collagen, Collagen triple helix repeat (20 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|148139 pfam06346, Drf_FH1, Formin Homology Region 1 | Back alignment and domain information |
|---|
| >gnl|CDD|222828 PHA01732, PHA01732, proline-rich protein | Back alignment and domain information |
|---|
| >gnl|CDD|218146 pfam04554, Extensin_2, Extensin-like region | Back alignment and domain information |
|---|
| >gnl|CDD|220708 pfam10349, WWbp, WW-domain ligand protein | Back alignment and domain information |
|---|
| >gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) | Back alignment and domain information |
|---|
| >gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) | Back alignment and domain information |
|---|
| >gnl|CDD|218146 pfam04554, Extensin_2, Extensin-like region | Back alignment and domain information |
|---|
| >gnl|CDD|220708 pfam10349, WWbp, WW-domain ligand protein | Back alignment and domain information |
|---|
| >gnl|CDD|114709 pfam06003, SMN, Survival motor neuron protein (SMN) | Back alignment and domain information |
|---|
| >gnl|CDD|221581 pfam12446, DUF3682, Protein of unknown function (DUF3682) | Back alignment and domain information |
|---|
| >gnl|CDD|152960 pfam12526, DUF3729, Protein of unknown function (DUF3729) | Back alignment and domain information |
|---|
| >gnl|CDD|218146 pfam04554, Extensin_2, Extensin-like region | Back alignment and domain information |
|---|
| >gnl|CDD|218621 pfam05518, Totivirus_coat, Totivirus coat protein | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|165539 PHA03282, PHA03282, envelope glycoprotein E; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218146 pfam04554, Extensin_2, Extensin-like region | Back alignment and domain information |
|---|
| >gnl|CDD|219569 pfam07777, MFMR, G-box binding protein MFMR | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|197891 smart00818, Amelogenin, Amelogenins, cell adhesion proteins, play a role in the biomineralisation of teeth | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222828 PHA01732, PHA01732, proline-rich protein | Back alignment and domain information |
|---|
| >gnl|CDD|218108 pfam04487, CITED, CITED | Back alignment and domain information |
|---|
| >gnl|CDD|218146 pfam04554, Extensin_2, Extensin-like region | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|197891 smart00818, Amelogenin, Amelogenins, cell adhesion proteins, play a role in the biomineralisation of teeth | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218350 pfam04959, ARS2, Arsenite-resistance protein 2 | Back alignment and domain information |
|---|
| >gnl|CDD|171499 PRK12438, PRK12438, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220950 pfam11029, DAZAP2, DAZ associated protein 2 (DAZAP2) | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221526 pfam12316, Dsh_C, Segment polarity protein dishevelled (Dsh) C terminal | Back alignment and domain information |
|---|
| >gnl|CDD|197891 smart00818, Amelogenin, Amelogenins, cell adhesion proteins, play a role in the biomineralisation of teeth | Back alignment and domain information |
|---|
| >gnl|CDD|197891 smart00818, Amelogenin, Amelogenins, cell adhesion proteins, play a role in the biomineralisation of teeth | Back alignment and domain information |
|---|
| >gnl|CDD|220603 pfam10152, DUF2360, Predicted coiled-coil domain-containing protein (DUF2360) | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 927 | |||
| KOG1924|consensus | 1102 | 100.0 | ||
| KOG1923|consensus | 830 | 100.0 | ||
| KOG1924|consensus | 1102 | 100.0 | ||
| smart00498 | 432 | FH2 Formin Homology 2 Domain. FH proteins control | 100.0 | |
| PF02181 | 370 | FH2: Formin Homology 2 Domain; InterPro: IPR015425 | 100.0 | |
| PF06367 | 197 | Drf_FH3: Diaphanous FH3 Domain; InterPro: IPR01047 | 99.97 | |
| PF06371 | 187 | Drf_GBD: Diaphanous GTPase-binding Domain; InterPr | 99.96 | |
| KOG1925|consensus | 817 | 99.92 | ||
| KOG1922|consensus | 833 | 99.91 | ||
| PF06371 | 187 | Drf_GBD: Diaphanous GTPase-binding Domain; InterPr | 98.54 | |
| PF11841 | 160 | DUF3361: Domain of unknown function (DUF3361) | 96.72 | |
| PF06345 | 15 | Drf_DAD: DRF Autoregulatory Domain; InterPro: IPR0 | 96.39 | |
| KOG1923|consensus | 830 | 95.17 | ||
| KOG0212|consensus | 675 | 92.77 | ||
| KOG2391|consensus | 365 | 92.18 | ||
| PHA03247 | 3151 | large tegument protein UL36; Provisional | 91.15 | |
| KOG4849|consensus | 498 | 90.98 | ||
| PRK13729 | 475 | conjugal transfer pilus assembly protein TraB; Pro | 89.47 | |
| KOG3671|consensus | 569 | 89.24 | ||
| PHA03247 | 3151 | large tegument protein UL36; Provisional | 88.76 | |
| KOG1925|consensus | 817 | 84.36 | ||
| smart00498 | 432 | FH2 Formin Homology 2 Domain. FH proteins control | 83.79 | |
| PF05308 | 253 | Mito_fiss_reg: Mitochondrial fission regulator; In | 83.71 | |
| KOG0132|consensus | 894 | 82.75 | ||
| PF05004 | 309 | IFRD: Interferon-related developmental regulator ( | 81.67 |
| >KOG1924|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.3e-168 Score=1406.09 Aligned_cols=807 Identities=43% Similarity=0.728 Sum_probs=713.1
Q ss_pred chhhhhhhhhhccccccccccccc-----hhhhccCCCHHHHHHHHHHHHHhCCCChhhhhhhhCCChHhHHHHHHHHHh
Q psy15122 47 PLANKKKMLLMHYKGTVTSYENKK-----QENMLEKLNPEQLNQKFEDMLNDMNLSDEKKEPLRRQPLANKKKMLLMHYK 121 (927)
Q Consensus 47 ~~~~K~~m~~~~~~~~~~~~~~~~-----~~~~~~~~~~~ei~~~F~~lle~lnl~~~k~~~L~~~p~~~K~~li~~~~~ 121 (927)
...+|.++...|...++.+...-+ +++ ...++++++...|+.++++|||++++|++|++.+...|.+||.||..
T Consensus 48 ~~~~~sk~~~~H~~~ss~sn~d~pt~q~~q~~-~~~ls~~e~~~~F~~~~~dmni~eekr~pll~K~~~ek~kmis~~l~ 126 (1102)
T KOG1924|consen 48 AADFKSKPSPAHLRSSSASNNDYPTAQGLQDI-GFSLSSNEVLELFELMGEDMNINEEKRKPLLDKDLPEKRKMISQYLQ 126 (1102)
T ss_pred hcccccCCCcccCCCccccccCCcccccHHHH-hhhccHHHHHHHHHHHhhhccccHhhhhhhhhcCchHHHHHHHHHHH
Confidence 456777888889866554443322 333 45689999999999999999999999999999999999999999987
Q ss_pred ccccc-cccccCCCChHHHHHHhcCCccchhhhhhhHHHHHHHhccCCchhHHHHhhhhhhhhhhcchhhhcCcC-CCCC
Q psy15122 122 GTVTS-YENKSKFDKPIEYIQYLSQPELSVNKMYSCIESLRIALTNHPLSWVNEFVLQDNKNFRKYPIAFLYPRF-PSRS 199 (927)
Q Consensus 122 ~~~~~-~~~~~~~~~P~~~i~~L~~~~~~~~~~~~~l~~Lrv~L~t~~~sWv~~F~~~Gl~~Ll~~~l~~ll~~l-~~~~ 199 (927)
.+... ...+....++.+||++|+++ ++++++++||.+|||+|++||||||.+|+.+|++.++++ +.+| +++.
T Consensus 127 ~k~~~~~s~ne~~~~s~eyV~~l~~g-l~t~~l~~CleslRVsL~~npVSwvn~Fgvegl~ll~~~-----Lkrl~dsk~ 200 (1102)
T KOG1924|consen 127 MKMMIRKSDNEAKGSSPEYVVELRSG-LSTKKLLECLESLRVSLTSNPVSWVNKFGVEGLGLLLDV-----LKRLRDSKV 200 (1102)
T ss_pred HHHHHhhhhhhhccCChHHHHHHHcc-cccccHHHHHHHHhhhhcCCccHHHHHhhhhhHHHHHHH-----HHHHHhhhh
Confidence 76511 22356778999999999998 888999999999999999999999999999999999885 4555 2222
Q ss_pred CCcchhhHHHHHHHHHHHHHHhcHhhHHHHhcchhHHHHHHHhcCCCChhHHHHHHHHhhhhcccCCC-chHHHHHHHHh
Q psy15122 200 RNDSRYDRVQYECVRCIRAIMNNTVGLKQMFGQKEALTIVARSLDPNKPTVMLEAVKVLAAVCLIPPD-GHDKVIKAITM 278 (927)
Q Consensus 200 ~~~~~~~~~~~e~vkCLkaimN~~~Gl~~vl~~~~~i~~la~sl~~~~~~~~~~vlelLaalc~~~~~-Gh~~VL~Al~~ 278 (927)
....+.+.++|+|+||||+|||++|+..||...+.+..++++++++.+.+|++|+++|+++|++.+. |.++||+||+.
T Consensus 201 -~~~~~~k~~~eiIrClka~mNn~~Gl~~vL~~e~~lllla~aldpr~pnmm~dvvkllsalciV~ee~~~ekvl~aiT~ 279 (1102)
T KOG1924|consen 201 -GSKLDIKNLQEIIRCLKAFMNNKFGLVLVLRRERSLLLLARALDPREPNMMTDVVKLLSALCIVGEENGLEKVLEAITT 279 (1102)
T ss_pred -hhhhHHHHHHHHHHHHHHHhccccceeeeecCCccHHHHHHhcCccCccHHHHHHHHHHHHheeehhhHHHHHHHHHHH
Confidence 2334677899999999999999999999999999999999999999999999999999999999854 99999999999
Q ss_pred hcccccCcChHHHHHHHhccCCCHHHHHHHHHHHHHHHcCchhHHHHHHHHHHHHHhChHHHHHHHhhcCChhHHHHHHH
Q psy15122 279 SGELKGKERFQPVVQGLMVKGNNEALRTACLQLINAIVATPDDLEFRLHLRNEIMRVGLYDLLDALEKDASEDVSVQLKV 358 (927)
Q Consensus 279 ~~~~~e~~RF~~lv~~L~~~~~~~~~~~~~m~lIN~Lv~s~~dl~~Ri~lR~Ef~~~GL~eil~~L~~~~~~~L~~ql~~ 358 (927)
.++.....||+|||++| .+.....+.++||+|||+|+++++||+||+|||+||+++||+++|+.|+.++++.+++|+++
T Consensus 280 ~ae~~~veRF~piv~gl-~~~e~~~l~vacmq~INal~t~p~dldfRlhlR~E~mr~gL~~~l~~l~~i~n~~ldvqlkv 358 (1102)
T KOG1924|consen 280 IAEAKPVERFRPIVEGL-DFLEKQQLQVACMQFINALVTSPSDLDFRLHLRSEFMRDGLHKYLPDLTEINNDILDVQLKV 358 (1102)
T ss_pred HHhhcchhhhhhHHHHH-hccchHHHHHHHHHHHHHhcCCHHHhhHHHHHHHHHHHHhHHHHHHHhhhhccHHHHHHHHH
Confidence 99999999999999999 56679999999999999999999999999999999999999999999999999999999999
Q ss_pred HhhhhHhHHHHHHHhchhcccccCCHHHHHHHHHHHhhcCCCchhhHHHHHhhhhccccchhhhhhhhhhhHHHHHHHhh
Q psy15122 359 FIEHKEEDYYEFIQRFDNVRMEIDDVNDCFETVRNMVMDSACEPYLLSILQHLLFIRDDQNMVMDSACEPYLLSILQHLL 438 (927)
Q Consensus 359 f~~~~~~D~~el~~r~~~~~~d~~~~~~~f~~l~~~v~~t~a~~~f~sil~~ll~~~~~~~~~~~~~~~p~~lSilQhll 438 (927)
|++++++|.++|++|+++++.++||+.+||++|++.|++|.+++|| |||||||+
T Consensus 359 fdE~~e~Dl~el~~rledir~emDd~~~~f~lL~n~vkdT~aE~yf--------------------------LSILQhll 412 (1102)
T KOG1924|consen 359 FDEHKEDDLEELSGRLEDIRAEMDDANEVFELLANTVKDTGAEPYF--------------------------LSILQHLL 412 (1102)
T ss_pred HhhhhhhhHHHHHhHHHhhhhhhccHHHHHHHHHHhhhhccccchH--------------------------HHHHHHHH
Confidence 9999999999999999999999999999999999999999999999 99999999
Q ss_pred hccchhhHHHHHHHHHHHHHHHHHhccCCCCCCccccccccccchHHHHHHHHhhh-hhHhHHHHHHHHHHHHHHHHHHH
Q psy15122 439 FIRDDQYVRLAYYKLLEECVSQIVLHRGGCDPDFRSSRRFQLDVQPLVEHLAEKSK-TEEDRRVEDLSAKLEEAIMLRQE 517 (927)
Q Consensus 439 li~~d~~~~~~~~~Lid~~v~qivl~r~g~d~d~~~~~~~~~dv~~ll~~l~~~~~-~~~~k~~~el~~kle~~~~~~qe 517 (927)
+||+|+.+|++||+|||+||||||+|++|+||||.++.+|++|+..+||.++++++ ++.++++.++.++++++.+++||
T Consensus 413 lirnDy~~rpqYykLIEecISqIvlHr~~~DPdf~yr~~l~id~~~liD~~vdkak~eeseqkA~e~~kk~~ke~ta~qe 492 (1102)
T KOG1924|consen 413 LIRNDYYIRPQYYKLIEECISQIVLHRTGMDPDFKYRFRLDIDLTELIDKMVDKAKAEESEQKAAELEKKFDKELTARQE 492 (1102)
T ss_pred HHhhhhhhhHHHHHHHHHHHHHHHHhcCCCCCCcchhhcccCcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHH
Confidence 99999999999999999999999999999999999999999999999999999998 77778999999999999999999
Q ss_pred HHHHHHHHhhhhhcccCCC---------------CCCCCCCCC---------C--cC-CCCCCCCCCCC------CCCCC
Q psy15122 518 AEAKLVQAQKTLEDLSSGR---------------PVEKNRLDE---------V--KA-QVAAGIPTGPK------GGPPP 564 (927)
Q Consensus 518 ~ea~~~~le~~i~~l~~~~---------------~~~~~~~p~---------~--~~-~~~~~~ppppp------~~ppp 564 (927)
+++++++.+.+|..++++. +++||++|| | || |+++||||||| |+|||
T Consensus 493 ~qael~k~e~Ki~~l~ae~~al~s~~~~~~~~~~iP~PP~~pp~gG~g~pppPppPPlpggag~PPPPpplPg~aG~PPp 572 (1102)
T KOG1924|consen 493 AQAELQKHEEKIKLLEAEKQALSSPSQLLPIDGGIPPPPPLPPTGGTGPPPPPPPPPLPGGAGPPPPPPPLPGIAGGPPP 572 (1102)
T ss_pred HHHHHHHhhhhcccCchhhhhccCcccCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCccCCCCCcccCCCCc
Confidence 9999999999998887651 111111110 0 00 00111111111 12333
Q ss_pred CCCCCC-CCCCCCCCCCC----CCCCCCCC-------CC-----------------------------------------
Q psy15122 565 PPPPPG-GMGPPPPPMPG----MPGPPPPP-------MP----------------------------------------- 591 (927)
Q Consensus 565 ppp~pg-~~~ppppp~pg----~p~pp~p~-------lp----------------------------------------- 591 (927)
|||||| +||||||||+| +||||+|- ||
T Consensus 573 Pppppg~~gppPPPpp~g~~Gg~ppPP~~gm~pmaPvlP~gLkpKK~~k~e~~Mrr~nW~kI~p~d~s~~cFWvkv~Edk 652 (1102)
T KOG1924|consen 573 PPPPPGGGGPPPPPPPGGFLGGPPPPPPPGMFPMAPVLPFGLKPKKVYKPEVPMRRFNWSKIVPRDLSENCFWVKVNEDK 652 (1102)
T ss_pred cCCCCCCCCCCCcCCCCCCCCCCCCCCCCCcccccccCCCCCCccccCCCCCccccCCccccCccccCccceeeecchhh
Confidence 333333 23333333322 22222210 22
Q ss_pred --------------------------------------------------------------------------------
Q psy15122 592 -------------------------------------------------------------------------------- 591 (927)
Q Consensus 592 -------------------------------------------------------------------------------- 591 (927)
T Consensus 653 ~en~dlfakL~~~Fatq~k~~k~~e~~eekkt~~kKk~kel~ilDsKtaQnLsIflgS~rmpyeeik~~ILevne~vLse 732 (1102)
T KOG1924|consen 653 LENDDLFAKLALKFATQPKVKKEQEGGEEKKTGTKKKVKELRILDSKTAQNLSIFLGSFRMPYEEIKNVILEVNEDVLSE 732 (1102)
T ss_pred ccchHHHHHHHHHhhccccccccccccccccchhhhhhhhheecchHHHHHHHHHHhhccCCHHHHHHHHhhccHHHHHH
Confidence
Q ss_pred -----------------------------------------------------------ccccccccccccccccchhhh
Q psy15122 592 -----------------------------------------------------------EMYTDCHKNIINGKQACEEVK 612 (927)
Q Consensus 592 -----------------------------------------------------------e~v~~i~~~i~~v~~A~~el~ 612 (927)
|.|++|+|+|.+|++||+||+
T Consensus 733 ~~iqnLik~lPe~E~l~~L~e~Kaeye~l~e~EQF~vvm~~vkrL~pRL~~ilFKl~fse~vnniKP~i~avt~ACEE~r 812 (1102)
T KOG1924|consen 733 SMIQNLIKHLPEQEQLNKLSELKAEYEDLPEPEQFVVVMSQVKRLRPRLSAILFKLTFSEQVNNIKPDIVAVTAACEELR 812 (1102)
T ss_pred HHHHHHHHhCCCHHHHHHHHHHHHhccCCCCHHHHhHHHhhccccChhHHHHHHHhhHHHHHhhcChHHHHHHHHHHHHH
Confidence 889999999999999999999
Q ss_pred hchhHHHHHHHHHHhcccccCCCCCcccceeeecccccccccccCCCCcchhHHHHHHHHhhCCccCchhhhhhhHHHhh
Q psy15122 613 QSKKLAKILELILLMGNYMNSGSRNGGAFGFEINFLTKLSSTKDIENKTTLLHYLVDTIEQKFPECLKFGDELLHVDRAA 692 (927)
Q Consensus 613 ~S~~f~~lL~~IL~iGNymN~gs~~g~A~GFkLssL~KL~dtKs~d~k~TLLh~l~~~v~~~~p~ll~f~~eL~~v~~As 692 (927)
+|++|.++|++||.+|||||+||++.+||||+|++|+||.||||+|+|+||||||+++|+++||++++|.+||.||++||
T Consensus 813 kSesFs~lLeLvLl~GNyMn~gSrNa~afgF~is~L~kL~dTKsaDqk~TLLHfLae~~e~kypd~l~F~ddl~hv~kaS 892 (1102)
T KOG1924|consen 813 KSESFSKLLELVLLVGNYMNSGSRNAQAFGFNISFLCKLRDTKSADQKTTLLHFLAEICEEKYPDILKFPDDLEHVEKAS 892 (1102)
T ss_pred hhhhHHHHHHHHHHHhcccccccccchhhccchHHHHhhccccccchhhHHHHHHHHHHHHhChhhhcchhhHHHHHhhc
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred ccCHHHHHHHHHHHHHHHHHHHHHHhhhccCCCCCcchhHHHHHhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccCC
Q psy15122 693 RVSTDVIQNSIRQMENNIKNLETDIQNCKQAPVANENDKFLEIMEPFAKEVRQKITLLSNMSKNMMTLYGDLAEFYTFDK 772 (927)
Q Consensus 693 kvs~~~l~~~~~~L~~~l~~l~~~l~~~~~~~~~~~~D~f~~~m~~F~~~a~~~~~~L~~~~~~~~~~~~~l~~yfgEd~ 772 (927)
|||.+.|.+.+.+|...+++++.+++.++.. .+++|.|.++|..|.++|++++..|..++.+|++.|+++.+||.+|+
T Consensus 893 rvnad~ikK~~~~m~~~ik~Le~dlk~~~~~--~~e~dkF~ekM~~F~e~a~eq~~~ls~M~~~M~~lye~L~eYyaFd~ 970 (1102)
T KOG1924|consen 893 RVNADEIKKNLQQMENQIKKLERDLKNFKIA--GNEHDKFVEKMTSFHEKAREQYSKLSSMHGNMEKLYESLGEYYAFDP 970 (1102)
T ss_pred cccHHHHHHHHHHHHHHHHHHHHHHHhcCCC--CcchhhHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHeecCc
Confidence 9999999999999999999999999999887 78999999999999999999999999999999999999999999999
Q ss_pred CCCcccchhccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhccCCCCCCccchHHHHHHHH
Q psy15122 773 NIYTLEEFFTDIKTFKDSFYQAWQENIKLREAEEKSIRVREAREKAENEKKDKAARKKALIDMTTDQTQQGVMDSLLEAL 852 (927)
Q Consensus 773 ~~~~~eefF~~~~~F~~~f~~a~~en~~~~e~eek~rr~~~akekaerek~er~~~kk~~~~~~~~~~~~~v~D~Ll~~L 852 (927)
+++++||||++|.+|.++|..|++||+++|+++|+.||+++|+|++++|++|||+|+++++||++.+|++||||+||++|
T Consensus 971 kkysmEEFFaDi~tFrnaf~ea~~en~krRee~Ek~rr~k~a~eqseqEr~erQqrk~alIdm~a~~de~GVmDslLeaL 1050 (1102)
T KOG1924|consen 971 KKYSMEEFFADIRTFRNAFLEAVAENEKRREEEEKERRAKLAKEQSEQERLERQQRKKALIDMNAEGDETGVMDSLLEAL 1050 (1102)
T ss_pred ccCcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhHHHhccccccchhhhHHHHHHHH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred hcCCCCCCCCCCCCCCCCCCccccccchhhHHHhhhhcCCCCCcHHHHhhhhhcccCCCcccccc
Q psy15122 853 QTGRPKKTGSSIKSVGCPSHSALQTGSAFTREQRRKRQNDRPMGAERRAQLNRSRSRNGIVITRE 917 (927)
Q Consensus 853 rsg~p~~~~~~~~~~~~~~~~~~~~~~af~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 917 (927)
+| |+||+.||+|.+.+++ | ||.+|.|||||+..+.+..
T Consensus 1051 qs-----------------------gaafr~rrk~~prq~~--~--r~g~l~rsrsrh~~a~gql 1088 (1102)
T KOG1924|consen 1051 QS-----------------------GAAFRTRRKRLPRQTR--G--RRGCLDRSRSRHQNALGQL 1088 (1102)
T ss_pred Hh-----------------------hccccCcccccCCCCc--c--cccchhhhhHhhhhhhhHH
Confidence 99 9999988887643322 2 9999999999988776543
|
|
| >KOG1923|consensus | Back alignment and domain information |
|---|
| >KOG1924|consensus | Back alignment and domain information |
|---|
| >smart00498 FH2 Formin Homology 2 Domain | Back alignment and domain information |
|---|
| >PF02181 FH2: Formin Homology 2 Domain; InterPro: IPR015425 Formin homology (FH) proteins play a crucial role in the reorganisation of the actin cytoskeleton, which mediates various functions of the cell cortex including motility, adhesion, and cytokinesis [] | Back alignment and domain information |
|---|
| >PF06367 Drf_FH3: Diaphanous FH3 Domain; InterPro: IPR010472 Formin homology (FH) proteins play a crucial role in the reorganisation of the actin cytoskeleton, which mediates various functions of the cell cortex including motility, adhesion, and cytokinesis [] | Back alignment and domain information |
|---|
| >PF06371 Drf_GBD: Diaphanous GTPase-binding Domain; InterPro: IPR010473 Diaphanous-related formins (Drfs) are a family of formin homology (FH) proteins that act as effectors of Rho small GTPases during growth factor-induced cytoskeletal remodelling, stress fibre formation, and cell division [] | Back alignment and domain information |
|---|
| >KOG1925|consensus | Back alignment and domain information |
|---|
| >KOG1922|consensus | Back alignment and domain information |
|---|
| >PF06371 Drf_GBD: Diaphanous GTPase-binding Domain; InterPro: IPR010473 Diaphanous-related formins (Drfs) are a family of formin homology (FH) proteins that act as effectors of Rho small GTPases during growth factor-induced cytoskeletal remodelling, stress fibre formation, and cell division [] | Back alignment and domain information |
|---|
| >PF11841 DUF3361: Domain of unknown function (DUF3361) | Back alignment and domain information |
|---|
| >PF06345 Drf_DAD: DRF Autoregulatory Domain; InterPro: IPR010465 This domain is found in Diaphanous-related formins (Drfs) | Back alignment and domain information |
|---|
| >KOG1923|consensus | Back alignment and domain information |
|---|
| >KOG0212|consensus | Back alignment and domain information |
|---|
| >KOG2391|consensus | Back alignment and domain information |
|---|
| >PHA03247 large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >KOG4849|consensus | Back alignment and domain information |
|---|
| >PRK13729 conjugal transfer pilus assembly protein TraB; Provisional | Back alignment and domain information |
|---|
| >KOG3671|consensus | Back alignment and domain information |
|---|
| >PHA03247 large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >KOG1925|consensus | Back alignment and domain information |
|---|
| >smart00498 FH2 Formin Homology 2 Domain | Back alignment and domain information |
|---|
| >PF05308 Mito_fiss_reg: Mitochondrial fission regulator; InterPro: IPR007972 This family consists of several uncharacterised eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >KOG0132|consensus | Back alignment and domain information |
|---|
| >PF05004 IFRD: Interferon-related developmental regulator (IFRD); InterPro: IPR007701 Interferon-related developmental regulator (IFRD1) is the human homologue of the Rattus norvegicus early response protein PC4 and its murine homologue TIS7 [] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 927 | ||||
| 3eg5_B | 383 | Crystal Structure Of Mdia1-Tsh Gbd-Fh3 In Complex W | 8e-78 | ||
| 1z2c_B | 383 | Crystal Structure Of Mdia1 Gbd-Fh3 In Complex With | 8e-77 | ||
| 2bnx_A | 386 | Crystal Structure Of The Dimeric Regulatory Domain | 1e-73 | ||
| 3obv_A | 327 | Autoinhibited Formin Mdia1 Structure Length = 327 | 5e-69 | ||
| 3o4x_A | 330 | Crystal Structure Of Complex Between Amino And Carb | 5e-69 | ||
| 2bap_B | 317 | Crystal Structure Of The N-Terminal Mdia1 Armadillo | 1e-67 | ||
| 3obv_E | 457 | Autoinhibited Formin Mdia1 Structure Length = 457 | 1e-52 | ||
| 3o4x_E | 467 | Crystal Structure Of Complex Between Amino And Carb | 2e-52 | ||
| 1v9d_A | 340 | Crystal Structure Of The Core Fh2 Domain Of Mouse M | 8e-46 | ||
| 2f31_A | 233 | Crystal Structure Of The Autoinhibitory Switch In F | 7e-43 | ||
| 2z6e_A | 419 | Crystal Structure Of Human Daam1 Fh2 Length = 419 | 2e-16 | ||
| 2j1d_G | 483 | Crystallization Of Hdaam1 C-Terminal Fragment Lengt | 2e-16 | ||
| 4eah_A | 402 | Crystal Structure Of The Formin Homology 2 Domain O | 8e-11 | ||
| 1y64_B | 443 | Bni1p Formin Homology 2 Domain Complexed With Atp-a | 5e-07 | ||
| 1ux5_A | 411 | Crystal Structures Of A Formin Homology-2 Domain Re | 7e-07 | ||
| 1ux4_A | 410 | Crystal Structures Of A Formin Homology-2 Domain Re | 8e-07 |
| >pdb|3EG5|B Chain B, Crystal Structure Of Mdia1-Tsh Gbd-Fh3 In Complex With Cdc42-Gmppnp Length = 383 | Back alignment and structure |
|
| >pdb|1Z2C|B Chain B, Crystal Structure Of Mdia1 Gbd-Fh3 In Complex With Rhoc- Gmppnp Length = 383 | Back alignment and structure |
| >pdb|2BNX|A Chain A, Crystal Structure Of The Dimeric Regulatory Domain Of Mouse Diaphaneous-Related Formin (Drf), Mdia1 Length = 386 | Back alignment and structure |
| >pdb|3OBV|A Chain A, Autoinhibited Formin Mdia1 Structure Length = 327 | Back alignment and structure |
| >pdb|3O4X|A Chain A, Crystal Structure Of Complex Between Amino And Carboxy Terminal Fragments Of Mdia1 Length = 330 | Back alignment and structure |
| >pdb|2BAP|B Chain B, Crystal Structure Of The N-Terminal Mdia1 Armadillo Repeat Region And Dimerisation Domain In Complex With The Mdia1 Autoregulatory Domain (Dad) Length = 317 | Back alignment and structure |
| >pdb|3OBV|E Chain E, Autoinhibited Formin Mdia1 Structure Length = 457 | Back alignment and structure |
| >pdb|3O4X|E Chain E, Crystal Structure Of Complex Between Amino And Carboxy Terminal Fragments Of Mdia1 Length = 467 | Back alignment and structure |
| >pdb|1V9D|A Chain A, Crystal Structure Of The Core Fh2 Domain Of Mouse Mdia1 Length = 340 | Back alignment and structure |
| >pdb|2F31|A Chain A, Crystal Structure Of The Autoinhibitory Switch In Formin Mdia1; The DidDAD COMPLEX Length = 233 | Back alignment and structure |
| >pdb|2Z6E|A Chain A, Crystal Structure Of Human Daam1 Fh2 Length = 419 | Back alignment and structure |
| >pdb|2J1D|G Chain G, Crystallization Of Hdaam1 C-Terminal Fragment Length = 483 | Back alignment and structure |
| >pdb|4EAH|A Chain A, Crystal Structure Of The Formin Homology 2 Domain Of Fmnl3 Bound To Actin Length = 402 | Back alignment and structure |
| >pdb|1Y64|B Chain B, Bni1p Formin Homology 2 Domain Complexed With Atp-actin Length = 443 | Back alignment and structure |
| >pdb|1UX5|A Chain A, Crystal Structures Of A Formin Homology-2 Domain Reveal A Flexibly Tethered Dimer Architecture Length = 411 | Back alignment and structure |
| >pdb|1UX4|A Chain A, Crystal Structures Of A Formin Homology-2 Domain Reveal A Tethered-Dimer Architecture Length = 410 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 927 | |||
| 3eg5_B | 383 | Protein diaphanous homolog 1; protein-protein comp | 8e-87 | |
| 3eg5_B | 383 | Protein diaphanous homolog 1; protein-protein comp | 2e-09 | |
| 3obv_E | 457 | Protein diaphanous homolog 1; autoinhibition, acti | 3e-79 | |
| 2j1d_G | 483 | DAAM1, disheveled-associated activator of morphoge | 2e-72 | |
| 1v9d_A | 340 | Diaphanous protein homolog 1; helix bundle, protei | 9e-71 | |
| 2bnx_A | 386 | Diaphanous protein homolog 1; autoinhibition, acti | 1e-70 | |
| 1ux5_A | 411 | BNI1 protein; structural protein, FH2 actin cytosk | 7e-61 | |
| 2f31_A | 233 | Diaphanous protein homolog 1; formin,MDIA1, protei | 1e-52 | |
| 3dad_A | 339 | FH1/FH2 domain-containing protein 1; formin, FHOD1 | 3e-23 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 8e-17 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-13 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 7e-12 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 9e-05 | |
| 3pgw_B | 231 | SM B; protein-RNA complex, U1 snRNA, SM fold, SM c | 2e-08 | |
| 3pgw_B | 231 | SM B; protein-RNA complex, U1 snRNA, SM fold, SM c | 2e-08 | |
| 3pgw_B | 231 | SM B; protein-RNA complex, U1 snRNA, SM fold, SM c | 2e-08 | |
| 3pgw_B | 231 | SM B; protein-RNA complex, U1 snRNA, SM fold, SM c | 4e-08 | |
| 3pgw_B | 231 | SM B; protein-RNA complex, U1 snRNA, SM fold, SM c | 5e-08 | |
| 3pgw_B | 231 | SM B; protein-RNA complex, U1 snRNA, SM fold, SM c | 1e-07 | |
| 3pgw_B | 231 | SM B; protein-RNA complex, U1 snRNA, SM fold, SM c | 2e-07 | |
| 3pgw_B | 231 | SM B; protein-RNA complex, U1 snRNA, SM fold, SM c | 2e-07 | |
| 3pgw_B | 231 | SM B; protein-RNA complex, U1 snRNA, SM fold, SM c | 3e-07 | |
| 3pgw_B | 231 | SM B; protein-RNA complex, U1 snRNA, SM fold, SM c | 5e-07 | |
| 3pgw_B | 231 | SM B; protein-RNA complex, U1 snRNA, SM fold, SM c | 6e-07 | |
| 3pgw_B | 231 | SM B; protein-RNA complex, U1 snRNA, SM fold, SM c | 7e-07 | |
| 3pgw_B | 231 | SM B; protein-RNA complex, U1 snRNA, SM fold, SM c | 8e-07 | |
| 3pgw_B | 231 | SM B; protein-RNA complex, U1 snRNA, SM fold, SM c | 3e-06 | |
| 3pgw_B | 231 | SM B; protein-RNA complex, U1 snRNA, SM fold, SM c | 4e-06 | |
| 3pgw_B | 231 | SM B; protein-RNA complex, U1 snRNA, SM fold, SM c | 8e-06 | |
| 3pgw_B | 231 | SM B; protein-RNA complex, U1 snRNA, SM fold, SM c | 8e-06 | |
| 1ei8_A | 29 | Collagen-like peptide (Pro-HYP-Gly)4-PG-(Pro-HYP- | 1e-07 | |
| 1ei8_A | 29 | Collagen-like peptide (Pro-HYP-Gly)4-PG-(Pro-HYP- | 2e-06 | |
| 1ei8_A | 29 | Collagen-like peptide (Pro-HYP-Gly)4-PG-(Pro-HYP- | 3e-04 | |
| 1cag_A | 30 | Collagen-like peptide; 1.85A {} SCOP: k.3.1.1 PDB: | 3e-07 | |
| 1cag_A | 30 | Collagen-like peptide; 1.85A {} SCOP: k.3.1.1 PDB: | 2e-06 | |
| 1cag_A | 30 | Collagen-like peptide; 1.85A {} SCOP: k.3.1.1 PDB: | 1e-04 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 3e-07 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 5e-07 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 9e-07 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 1e-06 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 1e-06 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 1e-06 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 2e-06 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 2e-06 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 2e-06 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 2e-06 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 2e-06 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 2e-06 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 2e-06 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 2e-06 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 2e-06 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 2e-06 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 2e-06 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 2e-06 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 3e-06 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 3e-06 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 3e-06 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 3e-06 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 3e-06 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 4e-06 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 4e-06 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 4e-06 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 4e-06 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 4e-06 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 4e-06 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 4e-06 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 4e-06 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 4e-06 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 4e-06 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 4e-06 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 5e-06 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 5e-06 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 5e-06 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 5e-06 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 5e-06 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 5e-06 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 6e-06 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 6e-06 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 7e-06 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 7e-06 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 7e-06 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 7e-06 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 7e-06 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 8e-06 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 8e-06 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 8e-06 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 8e-06 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 9e-06 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 9e-06 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 1e-05 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 1e-05 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 1e-05 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 1e-05 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 1e-05 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 1e-05 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 1e-05 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 1e-05 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 1e-05 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 1e-05 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 2e-05 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 2e-05 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 2e-05 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 2e-05 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 2e-05 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 2e-05 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 2e-05 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 2e-05 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 2e-05 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 2e-05 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 2e-05 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 2e-05 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 2e-05 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 2e-05 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 2e-05 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 2e-05 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 2e-05 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 3e-05 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 3e-05 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 3e-05 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 3e-05 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 3e-05 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 3e-05 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 3e-05 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 3e-05 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 3e-05 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 3e-05 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 4e-05 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 4e-05 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 4e-05 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 4e-05 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 4e-05 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 4e-05 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 4e-05 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 4e-05 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 4e-05 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 4e-05 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 5e-05 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 5e-05 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 5e-05 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 5e-05 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 5e-05 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 5e-05 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 6e-05 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 7e-05 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 7e-05 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 7e-05 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 1e-04 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 1e-04 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 1e-04 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 1e-04 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 1e-04 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 1e-04 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 1e-04 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 2e-04 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 2e-04 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 2e-04 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 2e-04 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 2e-04 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 2e-04 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 2e-04 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 3e-04 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 3e-04 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 3e-04 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 4e-04 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 7e-04 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 9e-04 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 3e-07 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 4e-07 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 4e-07 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 5e-07 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 8e-07 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 1e-06 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 1e-06 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 1e-06 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 1e-06 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 2e-06 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 2e-06 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 2e-06 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 2e-06 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 2e-06 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 3e-06 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 3e-06 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 3e-06 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 3e-06 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 3e-06 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 3e-06 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 3e-06 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 3e-06 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 3e-06 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 3e-06 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 4e-06 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 4e-06 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 5e-06 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 5e-06 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 5e-06 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 5e-06 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 5e-06 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 6e-06 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 6e-06 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 6e-06 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 6e-06 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 6e-06 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 6e-06 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 7e-06 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 8e-06 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 8e-06 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 8e-06 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 9e-06 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 9e-06 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 9e-06 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 9e-06 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 9e-06 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 9e-06 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 1e-05 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 1e-05 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 1e-05 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 1e-05 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 1e-05 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 1e-05 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 1e-05 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 1e-05 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 1e-05 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 1e-05 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 1e-05 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 1e-05 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 1e-05 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 1e-05 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 1e-05 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 2e-05 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 2e-05 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 2e-05 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 2e-05 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 2e-05 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 2e-05 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 2e-05 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 2e-05 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 2e-05 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 2e-05 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 2e-05 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 2e-05 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 2e-05 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 3e-05 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 3e-05 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 3e-05 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 3e-05 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 3e-05 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 3e-05 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 3e-05 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 3e-05 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 3e-05 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 3e-05 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 3e-05 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 3e-05 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 3e-05 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 4e-05 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 4e-05 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 4e-05 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 4e-05 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 4e-05 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 5e-05 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 5e-05 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 5e-05 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 5e-05 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 6e-05 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 6e-05 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 6e-05 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 6e-05 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 6e-05 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 6e-05 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 6e-05 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 6e-05 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 6e-05 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 7e-05 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 7e-05 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 7e-05 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 8e-05 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 8e-05 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 8e-05 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 9e-05 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 1e-04 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 1e-04 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 1e-04 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 1e-04 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 1e-04 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 1e-04 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 1e-04 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 2e-04 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 2e-04 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 2e-04 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 2e-04 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 2e-04 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 2e-04 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 2e-04 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 2e-04 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 4e-04 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 4e-04 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 5e-04 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 5e-04 | |
| 3q2s_C | 229 | Cleavage and polyadenylation specificity factor S; | 7e-07 | |
| 3q2s_C | 229 | Cleavage and polyadenylation specificity factor S; | 1e-04 | |
| 3q2s_C | 229 | Cleavage and polyadenylation specificity factor S; | 2e-04 | |
| 3pod_A | 26 | MBL collagen-like peptide; collagen peptide, compl | 7e-07 | |
| 3pon_A | 29 | MBL collagen-like peptide; collagen peptide, MBL c | 8e-07 | |
| 3pon_A | 29 | MBL collagen-like peptide; collagen peptide, MBL c | 3e-05 | |
| 2kpy_A | 108 | Major pollen allergen ART V 1; defensin-like, poly | 8e-07 | |
| 2kpy_A | 108 | Major pollen allergen ART V 1; defensin-like, poly | 2e-05 | |
| 3a0m_A | 27 | Collagen-like peptide; triple-helix, model peptide | 3e-06 | |
| 3a0m_A | 27 | Collagen-like peptide; triple-helix, model peptide | 2e-05 | |
| 3a0m_A | 27 | Collagen-like peptide; triple-helix, model peptide | 2e-04 | |
| 3a1h_A | 27 | Collagen-like peptide; collagen helix, HOST-guest | 5e-06 | |
| 3a1h_A | 27 | Collagen-like peptide; collagen helix, HOST-guest | 1e-05 | |
| 3a1h_A | 27 | Collagen-like peptide; collagen helix, HOST-guest | 2e-04 | |
| 1dx0_A | 219 | Prion protein; brain, repeat; NMR {Bos taurus} SCO | 5e-06 | |
| 1dx0_A | 219 | Prion protein; brain, repeat; NMR {Bos taurus} SCO | 3e-05 | |
| 1dx0_A | 219 | Prion protein; brain, repeat; NMR {Bos taurus} SCO | 3e-05 | |
| 1dx0_A | 219 | Prion protein; brain, repeat; NMR {Bos taurus} SCO | 4e-05 | |
| 1dx0_A | 219 | Prion protein; brain, repeat; NMR {Bos taurus} SCO | 9e-05 | |
| 1dx0_A | 219 | Prion protein; brain, repeat; NMR {Bos taurus} SCO | 9e-05 | |
| 1dx0_A | 219 | Prion protein; brain, repeat; NMR {Bos taurus} SCO | 2e-04 | |
| 1dx0_A | 219 | Prion protein; brain, repeat; NMR {Bos taurus} SCO | 4e-04 | |
| 1dx0_A | 219 | Prion protein; brain, repeat; NMR {Bos taurus} SCO | 5e-04 | |
| 1dx0_A | 219 | Prion protein; brain, repeat; NMR {Bos taurus} SCO | 6e-04 | |
| 1dx0_A | 219 | Prion protein; brain, repeat; NMR {Bos taurus} SCO | 7e-04 | |
| 1dx0_A | 219 | Prion protein; brain, repeat; NMR {Bos taurus} SCO | 8e-04 | |
| 4dmu_A | 87 | Collagen III derived triple-helical peptide; dinuc | 6e-06 | |
| 4dmu_A | 87 | Collagen III derived triple-helical peptide; dinuc | 6e-06 | |
| 4dmu_A | 87 | Collagen III derived triple-helical peptide; dinuc | 1e-05 | |
| 4dmu_A | 87 | Collagen III derived triple-helical peptide; dinuc | 1e-04 | |
| 4dmu_A | 87 | Collagen III derived triple-helical peptide; dinuc | 7e-04 | |
| 3adm_A | 27 | Collagen-like peptide; triple helix, model peptide | 7e-06 | |
| 3adm_A | 27 | Collagen-like peptide; triple helix, model peptide | 1e-05 | |
| 3adm_A | 27 | Collagen-like peptide; triple helix, model peptide | 2e-04 | |
| 1qsu_A | 30 | Protein ((Pro-HYP-Gly)4- Glu-Lys-Gly(Pro-HYP- Gly) | 8e-06 | |
| 3ah9_A | 27 | Collagen-like peptide; triple helix, model peptide | 1e-05 | |
| 3dmw_A | 42 | Collagen alpha-1(III) chain; collagen III, cystine | 1e-05 | |
| 3dmw_A | 42 | Collagen alpha-1(III) chain; collagen III, cystine | 3e-04 | |
| 3abn_A | 27 | Collagen-like peptide; collagen-helix, structural | 1e-05 | |
| 3abn_A | 27 | Collagen-like peptide; collagen-helix, structural | 2e-05 | |
| 3abn_A | 27 | Collagen-like peptide; collagen-helix, structural | 2e-04 | |
| 4auo_C | 40 | Triple-helical collagen peptide; hydrolase-peptide | 2e-05 | |
| 4auo_C | 40 | Triple-helical collagen peptide; hydrolase-peptide | 8e-05 | |
| 2pne_A | 81 | 6.5 kDa glycine-rich antifreeze protein; chemical | 2e-05 | |
| 2pne_A | 81 | 6.5 kDa glycine-rich antifreeze protein; chemical | 6e-04 | |
| 2pne_A | 81 | 6.5 kDa glycine-rich antifreeze protein; chemical | 7e-04 | |
| 2pne_A | 81 | 6.5 kDa glycine-rich antifreeze protein; chemical | 9e-04 | |
| 2f6a_E | 30 | Collagen; CNA, mscramm, adhesion, ECM, cell adhesi | 2e-05 | |
| 2f6a_E | 30 | Collagen; CNA, mscramm, adhesion, ECM, cell adhesi | 3e-05 | |
| 2y5t_F | 38 | C1; immune system, antibody, rheumatoid arthritis; | 3e-05 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 6e-05 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 8e-05 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 2e-04 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 4e-04 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 4e-04 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 4e-04 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 5e-04 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 5e-04 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 5e-04 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 5e-04 | |
| 2v8f_C | 26 | MDIA1, profilin IIA; alternative splicing, protein | 1e-04 | |
| 2v8f_C | 26 | MDIA1, profilin IIA; alternative splicing, protein | 4e-04 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 1e-04 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 1e-04 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 2e-04 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 2e-04 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 2e-04 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 3e-04 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 4e-04 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 8e-04 | |
| 4dmt_A | 32 | Collagen III derived peptide; collagen triple heli | 1e-04 | |
| 3b0s_A | 27 | Collagen-like peptide; triple helix, structural pr | 1e-04 | |
| 2y5t_E | 34 | C1; immune system, antibody, rheumatoid arthritis; | 2e-04 | |
| 1nay_A | 56 | CCP4, collagen-like peptide; collagen assembly, st | 3e-04 | |
| 3u29_A | 26 | Triple helical peptide; triple helix, biosynthetic | 3e-04 | |
| 3t4f_A | 26 | Collagen mimetic peptide; triple helix, biosynthet | 3e-04 | |
| 1x1k_F | 30 | HOST-guest peptide (Pro-Pro-Gly)4-(Pro-allohyp- Gl | 4e-04 | |
| 1bkv_A | 30 | T3-785; collagen, hydroxyproline, hydrogen bonding | 5e-04 | |
| 2g66_A | 31 | Collagen; 3(S)hydroxyproline, 4(R)hydroxyproline, | 7e-04 |
| >3eg5_B Protein diaphanous homolog 1; protein-protein complex, RHO proteins, formins, armadillo repeat, G-protein, GTPase, alternative splicing; HET: GNP; 2.70A {Mus musculus} PDB: 1z2c_B* Length = 383 | Back alignment and structure |
|---|
Score = 282 bits (721), Expect = 8e-87
Identities = 155/412 (37%), Positives = 244/412 (59%), Gaps = 34/412 (8%)
Query: 72 ENMLEKLNPEQLNQKFEDMLNDMNLSDEKKEPLRRQPLANKKKMLLMHYKGTVTSYENKS 131
L+ ++ EQ+ FE ML DMNL++EK++PLR + + K++M+ + + K
Sbjct: 4 AQSLQDISDEQVLVLFEQMLVDMNLNEEKQQPLREKDIVIKREMVSQYLHTSKAGMNQKE 63
Query: 132 KFDKPIEYIQYLSQPELSVNKMYSCIESLRIALTNHPLSWVNEFVLQDNKNFRKYPIAFL 191
+ YIQ L + L + SC+ESLR++LT+HP+SWV F + +
Sbjct: 64 SSRSAMMYIQEL-RSGLRDMHLLSCLESLRVSLTSHPVSWVQTFGAEGLASLLDILKRLH 122
Query: 192 YPRFPSRSRNDSRYDRVQYECVRCIRAIMNNTVGLKQMFGQKEALTIVARSLDPNKPTVM 251
+ + DSR Q+E +RC++A MNN G+K M +E + ++ R++DP P +M
Sbjct: 123 DEKEETSGNYDSR---NQHEIIRCLKAFMNNKFGIKTMLETEEGILLLVRAMDPAVPNMM 179
Query: 252 LEAVKVLAAVCLI--PPDGHDKVIKAITMSGELKGKERFQPVVQGLMVKGNNEALRTACL 309
++A K+L+A+C++ P D +++V++A+T E+ ERFQP++ GL G + AL+ CL
Sbjct: 180 IDAAKLLSALCILPQPEDMNERVLEAMTERAEMDEVERFQPLLDGLK-SGTSIALKVGCL 238
Query: 310 QLINAIVATPDDLEFRLHLRNEIMRVGLYDLLDALEKDASEDVSVQLKVFIEHKEEDYYE 369
QLINA++ ++L+FR+H+R+E+MR+GL+ +L L + +ED+ VQL VF E +ED+++
Sbjct: 239 QLINALITPAEELDFRVHIRSELMRLGLHQVLQELREIENEDMKVQLCVFDEQGDEDFFD 298
Query: 370 FIQRFDNVRMEIDDVNDCFETVRNMVMDSACEPYLLSILQHLLFIRDDQNMVMDSACEPY 429
R D++RME+DD + F+ + N V DS EP+ LSILQHLL +R+D
Sbjct: 299 LKGRLDDIRMEMDDFGEVFQIILNTVKDSKAEPHFLSILQHLLLVRNDYEA--------- 349
Query: 430 LLSILQHLLFIRDDQYVRLAYYKLLEECVSQIVLHRGGCDPDFRSSRRFQLD 481
R YYKL+EECVSQIVLH+ G DPDF+ R Q+D
Sbjct: 350 -----------------RPQYYKLIEECVSQIVLHKNGTDPDFK-CRHLQID 383
|
| >3eg5_B Protein diaphanous homolog 1; protein-protein complex, RHO proteins, formins, armadillo repeat, G-protein, GTPase, alternative splicing; HET: GNP; 2.70A {Mus musculus} PDB: 1z2c_B* Length = 383 | Back alignment and structure |
|---|
| >3obv_E Protein diaphanous homolog 1; autoinhibition, actin, nucleation, cytoskeleton, structural; HET: SUC; 2.75A {Mus musculus} PDB: 3o4x_E 2bap_D Length = 457 | Back alignment and structure |
|---|
| >2j1d_G DAAM1, disheveled-associated activator of morphogenesis; actin assembly, protein binding; 2.55A {Homo sapiens} PDB: 2z6e_A Length = 483 | Back alignment and structure |
|---|
| >1v9d_A Diaphanous protein homolog 1; helix bundle, protein binding; 2.60A {Mus musculus} SCOP: a.207.1.1 Length = 340 | Back alignment and structure |
|---|
| >2bnx_A Diaphanous protein homolog 1; autoinhibition, actin, nucleation, cytoskeleton, structural; 2.4A {Mus musculus} SCOP: a.118.1.23 PDB: 3o4x_A 3obv_A* 2bap_B Length = 386 | Back alignment and structure |
|---|
| >1ux5_A BNI1 protein; structural protein, FH2 actin cytoskeleton; 2.5A {Saccharomyces cerevisiae} SCOP: a.207.1.1 PDB: 1y64_B* 1ux4_A Length = 411 | Back alignment and structure |
|---|
| >2f31_A Diaphanous protein homolog 1; formin,MDIA1, protein-protein complex, armadillo repeats, structural protein; 2.10A {Mus musculus} Length = 233 | Back alignment and structure |
|---|
| >3dad_A FH1/FH2 domain-containing protein 1; formin, FHOD1, GTPase-binding domain, ubiquitin-superfold, armadillo repeats, actin-binding, coiled coil; 2.30A {Homo sapiens} Length = 339 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 | Back alignment and structure |
|---|
| >3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 | Back alignment and structure |
|---|
| >3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 | Back alignment and structure |
|---|
| >3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 | Back alignment and structure |
|---|
| >3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 | Back alignment and structure |
|---|
| >3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 | Back alignment and structure |
|---|
| >3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 | Back alignment and structure |
|---|
| >3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 | Back alignment and structure |
|---|
| >3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 | Back alignment and structure |
|---|
| >3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 | Back alignment and structure |
|---|
| >3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 | Back alignment and structure |
|---|
| >3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 | Back alignment and structure |
|---|
| >3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 | Back alignment and structure |
|---|
| >3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 | Back alignment and structure |
|---|
| >3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 | Back alignment and structure |
|---|
| >3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 | Back alignment and structure |
|---|
| >3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 | Back alignment and structure |
|---|
| >1ei8_A Collagen-like peptide (Pro-HYP-Gly)4-PG-(Pro-HYP- Gly)5; triple helix, contractIle protein; 2.00A {Synthetic} SCOP: k.3.1.1 Length = 29 | Back alignment and structure |
|---|
| >1ei8_A Collagen-like peptide (Pro-HYP-Gly)4-PG-(Pro-HYP- Gly)5; triple helix, contractIle protein; 2.00A {Synthetic} SCOP: k.3.1.1 Length = 29 | Back alignment and structure |
|---|
| >1ei8_A Collagen-like peptide (Pro-HYP-Gly)4-PG-(Pro-HYP- Gly)5; triple helix, contractIle protein; 2.00A {Synthetic} SCOP: k.3.1.1 Length = 29 | Back alignment and structure |
|---|
| >1cag_A Collagen-like peptide; 1.85A {} SCOP: k.3.1.1 PDB: 1cgd_A Length = 30 | Back alignment and structure |
|---|
| >1cag_A Collagen-like peptide; 1.85A {} SCOP: k.3.1.1 PDB: 1cgd_A Length = 30 | Back alignment and structure |
|---|
| >1cag_A Collagen-like peptide; 1.85A {} SCOP: k.3.1.1 PDB: 1cgd_A Length = 30 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 | Back alignment and structure |
|---|
| >3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 | Back alignment and structure |
|---|
| >3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 | Back alignment and structure |
|---|
| >3pod_A MBL collagen-like peptide; collagen peptide, complement proteins, lectin pathway of COM MAsp-1 CUB1 and CUB2 domains, bloodstream, unknown function; 1.50A {Synthetic} Length = 26 | Back alignment and structure |
|---|
| >3pon_A MBL collagen-like peptide; collagen peptide, MBL collagen-like region, complement prote lectin pathway of complement; 1.50A {Synthetic} PDB: 3pob_B Length = 29 | Back alignment and structure |
|---|
| >3pon_A MBL collagen-like peptide; collagen peptide, MBL collagen-like region, complement prote lectin pathway of complement; 1.50A {Synthetic} PDB: 3pob_B Length = 29 | Back alignment and structure |
|---|
| >2kpy_A Major pollen allergen ART V 1; defensin-like, poly-proline; NMR {Artemisia vulgaris} Length = 108 | Back alignment and structure |
|---|
| >2kpy_A Major pollen allergen ART V 1; defensin-like, poly-proline; NMR {Artemisia vulgaris} Length = 108 | Back alignment and structure |
|---|
| >3a0m_A Collagen-like peptide; triple-helix, model peptide, twinned crystal, STRU protein; 1.02A {Synthetic} Length = 27 | Back alignment and structure |
|---|
| >3a0m_A Collagen-like peptide; triple-helix, model peptide, twinned crystal, STRU protein; 1.02A {Synthetic} Length = 27 | Back alignment and structure |
|---|
| >3a0m_A Collagen-like peptide; triple-helix, model peptide, twinned crystal, STRU protein; 1.02A {Synthetic} Length = 27 | Back alignment and structure |
|---|
| >3a1h_A Collagen-like peptide; collagen helix, HOST-guest peptide, twinned crystal, structu protein; 1.08A {Synthetic} Length = 27 | Back alignment and structure |
|---|
| >3a1h_A Collagen-like peptide; collagen helix, HOST-guest peptide, twinned crystal, structu protein; 1.08A {Synthetic} Length = 27 | Back alignment and structure |
|---|
| >3a1h_A Collagen-like peptide; collagen helix, HOST-guest peptide, twinned crystal, structu protein; 1.08A {Synthetic} Length = 27 | Back alignment and structure |
|---|
| >1dx0_A Prion protein; brain, repeat; NMR {Bos taurus} SCOP: d.6.1.1 PDB: 1dx1_A 1qlx_A 1qlz_A Length = 219 | Back alignment and structure |
|---|
| >1dx0_A Prion protein; brain, repeat; NMR {Bos taurus} SCOP: d.6.1.1 PDB: 1dx1_A 1qlx_A 1qlz_A Length = 219 | Back alignment and structure |
|---|
| >1dx0_A Prion protein; brain, repeat; NMR {Bos taurus} SCOP: d.6.1.1 PDB: 1dx1_A 1qlx_A 1qlz_A Length = 219 | Back alignment and structure |
|---|
| >1dx0_A Prion protein; brain, repeat; NMR {Bos taurus} SCOP: d.6.1.1 PDB: 1dx1_A 1qlx_A 1qlz_A Length = 219 | Back alignment and structure |
|---|
| >1dx0_A Prion protein; brain, repeat; NMR {Bos taurus} SCOP: d.6.1.1 PDB: 1dx1_A 1qlx_A 1qlz_A Length = 219 | Back alignment and structure |
|---|
| >1dx0_A Prion protein; brain, repeat; NMR {Bos taurus} SCOP: d.6.1.1 PDB: 1dx1_A 1qlx_A 1qlz_A Length = 219 | Back alignment and structure |
|---|
| >1dx0_A Prion protein; brain, repeat; NMR {Bos taurus} SCOP: d.6.1.1 PDB: 1dx1_A 1qlx_A 1qlz_A Length = 219 | Back alignment and structure |
|---|
| >1dx0_A Prion protein; brain, repeat; NMR {Bos taurus} SCOP: d.6.1.1 PDB: 1dx1_A 1qlx_A 1qlz_A Length = 219 | Back alignment and structure |
|---|
| >1dx0_A Prion protein; brain, repeat; NMR {Bos taurus} SCOP: d.6.1.1 PDB: 1dx1_A 1qlx_A 1qlz_A Length = 219 | Back alignment and structure |
|---|
| >1dx0_A Prion protein; brain, repeat; NMR {Bos taurus} SCOP: d.6.1.1 PDB: 1dx1_A 1qlx_A 1qlz_A Length = 219 | Back alignment and structure |
|---|
| >1dx0_A Prion protein; brain, repeat; NMR {Bos taurus} SCOP: d.6.1.1 PDB: 1dx1_A 1qlx_A 1qlz_A Length = 219 | Back alignment and structure |
|---|
| >1dx0_A Prion protein; brain, repeat; NMR {Bos taurus} SCOP: d.6.1.1 PDB: 1dx1_A 1qlx_A 1qlz_A Length = 219 | Back alignment and structure |
|---|
| >4dmu_A Collagen III derived triple-helical peptide; dinucleotide binding fold, collagen binding, platelet activa hemostasis, plasma, structural protein-protein binding COMP; 2.80A {Synthetic} Length = 87 | Back alignment and structure |
|---|
| >4dmu_A Collagen III derived triple-helical peptide; dinucleotide binding fold, collagen binding, platelet activa hemostasis, plasma, structural protein-protein binding COMP; 2.80A {Synthetic} Length = 87 | Back alignment and structure |
|---|
| >4dmu_A Collagen III derived triple-helical peptide; dinucleotide binding fold, collagen binding, platelet activa hemostasis, plasma, structural protein-protein binding COMP; 2.80A {Synthetic} Length = 87 | Back alignment and structure |
|---|
| >4dmu_A Collagen III derived triple-helical peptide; dinucleotide binding fold, collagen binding, platelet activa hemostasis, plasma, structural protein-protein binding COMP; 2.80A {Synthetic} Length = 87 | Back alignment and structure |
|---|
| >4dmu_A Collagen III derived triple-helical peptide; dinucleotide binding fold, collagen binding, platelet activa hemostasis, plasma, structural protein-protein binding COMP; 2.80A {Synthetic} Length = 87 | Back alignment and structure |
|---|
| >3adm_A Collagen-like peptide; triple helix, model peptide, structural protein; HET: HYP; 1.18A {Synthetic} Length = 27 | Back alignment and structure |
|---|
| >3adm_A Collagen-like peptide; triple helix, model peptide, structural protein; HET: HYP; 1.18A {Synthetic} Length = 27 | Back alignment and structure |
|---|
| >3adm_A Collagen-like peptide; triple helix, model peptide, structural protein; HET: HYP; 1.18A {Synthetic} Length = 27 | Back alignment and structure |
|---|
| >1qsu_A Protein ((Pro-HYP-Gly)4- Glu-Lys-Gly(Pro-HYP- Gly)5); triple helix, structural protein; 1.75A {Synthetic} SCOP: k.3.1.1 Length = 30 | Back alignment and structure |
|---|
| >3ah9_A Collagen-like peptide; triple helix, model peptide, structural protein; 1.08A {Synthetic} PDB: 2cuo_A 2d3f_A 2d3h_A 3a19_A 1x1k_A 3ai6_A* Length = 27 | Back alignment and structure |
|---|
| >3dmw_A Collagen alpha-1(III) chain; collagen III, cystine knot, triple helix, glycine, MAD phasing, alternative splicing, disease mutation; 2.30A {Synthetic} Length = 42 | Back alignment and structure |
|---|
| >3dmw_A Collagen alpha-1(III) chain; collagen III, cystine knot, triple helix, glycine, MAD phasing, alternative splicing, disease mutation; 2.30A {Synthetic} Length = 42 | Back alignment and structure |
|---|
| >3abn_A Collagen-like peptide; collagen-helix, structural protein; HET: HYP; 1.02A {Synthetic} Length = 27 | Back alignment and structure |
|---|
| >3abn_A Collagen-like peptide; collagen-helix, structural protein; HET: HYP; 1.02A {Synthetic} Length = 27 | Back alignment and structure |
|---|
| >3abn_A Collagen-like peptide; collagen-helix, structural protein; HET: HYP; 1.02A {Synthetic} Length = 27 | Back alignment and structure |
|---|
| >4auo_C Triple-helical collagen peptide; hydrolase-peptide complex; 3.00A {Synthetic construct} Length = 40 | Back alignment and structure |
|---|
| >4auo_C Triple-helical collagen peptide; hydrolase-peptide complex; 3.00A {Synthetic construct} Length = 40 | Back alignment and structure |
|---|
| >2pne_A 6.5 kDa glycine-rich antifreeze protein; chemical protein synthesis, native chemical ligation; 0.98A {Synthetic} PDB: 3boi_A 3bog_A* 3bog_C* Length = 81 | Back alignment and structure |
|---|
| >2pne_A 6.5 kDa glycine-rich antifreeze protein; chemical protein synthesis, native chemical ligation; 0.98A {Synthetic} PDB: 3boi_A 3bog_A* 3bog_C* Length = 81 | Back alignment and structure |
|---|
| >2pne_A 6.5 kDa glycine-rich antifreeze protein; chemical protein synthesis, native chemical ligation; 0.98A {Synthetic} PDB: 3boi_A 3bog_A* 3bog_C* Length = 81 | Back alignment and structure |
|---|
| >2pne_A 6.5 kDa glycine-rich antifreeze protein; chemical protein synthesis, native chemical ligation; 0.98A {Synthetic} PDB: 3boi_A 3bog_A* 3bog_C* Length = 81 | Back alignment and structure |
|---|
| >2f6a_E Collagen; CNA, mscramm, adhesion, ECM, cell adhesion/structural protein complex; 3.29A {Staphylococcus aureus} Length = 30 | Back alignment and structure |
|---|
| >2f6a_E Collagen; CNA, mscramm, adhesion, ECM, cell adhesion/structural protein complex; 3.29A {Staphylococcus aureus} Length = 30 | Back alignment and structure |
|---|
| >2y5t_F C1; immune system, antibody, rheumatoid arthritis; 2.20A {Mus musculus} Length = 38 | Back alignment and structure |
|---|
| >2v8f_C MDIA1, profilin IIA; alternative splicing, protein-binding, cytoplasm, acetylation, cytoskeleton, actin-binding; 1.1A {Mus musculus} Length = 26 | Back alignment and structure |
|---|
| >2v8f_C MDIA1, profilin IIA; alternative splicing, protein-binding, cytoplasm, acetylation, cytoskeleton, actin-binding; 1.1A {Mus musculus} Length = 26 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >4dmt_A Collagen III derived peptide; collagen triple helix, VON willebrand factor, structural Pro; 1.39A {Synthetic} Length = 32 | Back alignment and structure |
|---|
| >3b0s_A Collagen-like peptide; triple helix, structural protein; HET: HYP; 1.45A {Synthetic} PDB: 1ym8_A* Length = 27 | Back alignment and structure |
|---|
| >2y5t_E C1; immune system, antibody, rheumatoid arthritis; 2.20A {Mus musculus} Length = 34 | Back alignment and structure |
|---|
| >1nay_A CCP4, collagen-like peptide; collagen assembly, structural protein; 2.60A {Synthetic} SCOP: k.3.1.1 Length = 56 | Back alignment and structure |
|---|
| >3u29_A Triple helical peptide; triple helix, biosynthetic protein; 2.00A {Synthetic construct} Length = 26 | Back alignment and structure |
|---|
| >3t4f_A Collagen mimetic peptide; triple helix, biosynthetic protein; 1.68A {Synthetic construct} Length = 26 | Back alignment and structure |
|---|
| >1x1k_F HOST-guest peptide (Pro-Pro-Gly)4-(Pro-allohyp- Gly)-(Pro-Pro-Gly)4; non-natural amino acid, collagen model peptide, puckering, triple-helix stability; 1.10A {Synthetic} PDB: 1wzb_A 1k6f_A 2klw_C* Length = 30 | Back alignment and structure |
|---|
| >1bkv_A T3-785; collagen, hydroxyproline, hydrogen bonding; 2.00A {} SCOP: k.3.1.1 Length = 30 | Back alignment and structure |
|---|
| >2g66_A Collagen; 3(S)hydroxyproline, 4(R)hydroxyproline, UP pucker, DOWN pucker, structural protein; 1.80A {Synthetic} Length = 31 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 927 | |||
| 3eg5_B | 383 | Protein diaphanous homolog 1; protein-protein comp | 100.0 | |
| 2bnx_A | 386 | Diaphanous protein homolog 1; autoinhibition, acti | 100.0 | |
| 3obv_E | 457 | Protein diaphanous homolog 1; autoinhibition, acti | 100.0 | |
| 2j1d_G | 483 | DAAM1, disheveled-associated activator of morphoge | 100.0 | |
| 1v9d_A | 340 | Diaphanous protein homolog 1; helix bundle, protei | 100.0 | |
| 2f31_A | 233 | Diaphanous protein homolog 1; formin,MDIA1, protei | 100.0 | |
| 1ux5_A | 411 | BNI1 protein; structural protein, FH2 actin cytosk | 100.0 | |
| 4eah_A | 402 | Formin-like protein 3, actin, alpha skeletal muscl | 100.0 | |
| 3eg5_B | 383 | Protein diaphanous homolog 1; protein-protein comp | 99.73 | |
| 3dad_A | 339 | FH1/FH2 domain-containing protein 1; formin, FHOD1 | 99.56 | |
| 4dvg_B | 353 | Diaphanous protein; cytoskeleton, armadillo repeat | 99.16 | |
| 2bnx_A | 386 | Diaphanous protein homolog 1; autoinhibition, acti | 98.35 | |
| 2f31_A | 233 | Diaphanous protein homolog 1; formin,MDIA1, protei | 97.46 | |
| 2v8f_C | 26 | MDIA1, profilin IIA; alternative splicing, protein | 94.93 | |
| 3iot_A | 449 | Maltose-binding protein, huntingtin fusion protei; | 93.91 | |
| 4db8_A | 252 | Armadillo-repeat protein; solenoid repeat, de novo | 93.88 | |
| 4db6_A | 210 | Armadillo repeat protein; solenoid repeat, armadil | 93.77 | |
| 4hxt_A | 252 | De novo protein OR329; structural genomics, PSI-bi | 93.61 | |
| 3grl_A | 651 | General vesicular transport factor P115; vesicle t | 92.45 | |
| 3iot_A | 449 | Maltose-binding protein, huntingtin fusion protei; | 91.38 | |
| 4hxt_A | 252 | De novo protein OR329; structural genomics, PSI-bi | 90.88 | |
| 3tpo_A | 529 | Importin subunit alpha-2; nuclear import, protein | 90.73 | |
| 4db8_A | 252 | Armadillo-repeat protein; solenoid repeat, de novo | 89.86 | |
| 3ul1_B | 510 | Importin subunit alpha-2; arm repeat, armadillo re | 89.69 | |
| 4b8j_A | 528 | Importin subunit alpha-1A; transport protein, nucl | 85.76 | |
| 3grl_A | 651 | General vesicular transport factor P115; vesicle t | 85.16 | |
| 3tpo_A | 529 | Importin subunit alpha-2; nuclear import, protein | 84.63 | |
| 1xqr_A | 296 | HSPBP1 protein; armadillo repeat, superhelical twi | 84.57 | |
| 4b8j_A | 528 | Importin subunit alpha-1A; transport protein, nucl | 81.23 | |
| 3ul1_B | 510 | Importin subunit alpha-2; arm repeat, armadillo re | 81.05 | |
| 4db6_A | 210 | Armadillo repeat protein; solenoid repeat, armadil | 80.83 |
| >3eg5_B Protein diaphanous homolog 1; protein-protein complex, RHO proteins, formins, armadillo repeat, G-protein, GTPase, alternative splicing; HET: GNP; 2.70A {Mus musculus} SCOP: a.118.1.23 PDB: 1z2c_B* | Back alignment and structure |
|---|
Probab=100.00 E-value=3.7e-72 Score=634.88 Aligned_cols=374 Identities=41% Similarity=0.727 Sum_probs=314.9
Q ss_pred hhccCCCHHHHHHHHHHHHHhCCCChhhhhhhhCCChHhHHHHHHHHHhccc-cccccccCCCChHHHHHHhcCCccchh
Q psy15122 73 NMLEKLNPEQLNQKFEDMLNDMNLSDEKKEPLRRQPLANKKKMLLMHYKGTV-TSYENKSKFDKPIEYIQYLSQPELSVN 151 (927)
Q Consensus 73 ~~~~~~~~~ei~~~F~~lle~lnl~~~k~~~L~~~p~~~K~~li~~~~~~~~-~~~~~~~~~~~P~~~i~~L~~~~~~~~ 151 (927)
..+..|++++|+++|++||++||++++||++|+++|.++||+||+||.+... ++.+ .+...+|+|||++|+++ .+..
T Consensus 5 ~~~~~~se~ev~~~F~~mL~~mnl~~ek~~~l~~~~~e~Kw~mi~~~~~~~~~~~~~-~~~~~sP~~yi~~L~~~-~~~~ 82 (383)
T 3eg5_B 5 QSLQDISDEQVLVLFEQMLVDMNLNEEKQQPLREKDIVIKREMVSQYLHTSKAGMNQ-KESSRSAMMYIQELRSG-LRDM 82 (383)
T ss_dssp ----------CCHHHHHHHHHTTCCHHHHHHHHSSCHHHHHHHHHHHHHHC----------CCCHHHHHHHHTTT-CCHH
T ss_pred hhcccCCHHHHHHHHHHHHHHcCCCHHHHHHHHhCCHHHHHHHHHHHHHHhhhcccc-ccCCCCHHHHHHHHHhc-ccch
Confidence 4466789999999999999999999999999999999999999999986532 1222 34578999999999987 4566
Q ss_pred hhhhhHHHHHHHhccCCchhHHHHhhhhhhhhhhcchhhhcCcCCCCCC--CcchhhHHHHHHHHHHHHHHhcHhhHHHH
Q psy15122 152 KMYSCIESLRIALTNHPLSWVNEFVLQDNKNFRKYPIAFLYPRFPSRSR--NDSRYDRVQYECVRCIRAIMNNTVGLKQM 229 (927)
Q Consensus 152 ~~~~~l~~Lrv~L~t~~~sWv~~F~~~Gl~~Ll~~~l~~ll~~l~~~~~--~~~~~~~~~~e~vkCLkaimN~~~Gl~~v 229 (927)
+++++|.+|||+|||+|++||++|+.+|+.+|+++ |..+.. +.. ....+...||+||+|||||||+++|++.|
T Consensus 83 kl~~~L~sL~v~Lrt~~~sWV~~F~~~Gl~~Ll~i-L~~~~~----~~~~~~~~~d~~~q~~~l~CLkalmN~~~G~~~v 157 (383)
T 3eg5_B 83 HLLSCLESLRVSLTSHPVSWVQTFGAEGLASLLDI-LKRLHD----EKEETSGNYDSRNQHEIIRCLKAFMNNKFGIKTM 157 (383)
T ss_dssp HHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHHHHH-HHHHHT----CC-------CHHHHHHHHHHHHHHTSSHHHHHHH
T ss_pred hHHHHHHHHHHHHhhCccHHHHHHHHccHHHHHHH-HHHHhh----ccccccchhhHHHHHHHHHHHHHHhcchhhHHHH
Confidence 78899999999999999999999999999999995 332221 111 12445688999999999999999999999
Q ss_pred hcchhHHHHHHHhcCCCChhHHHHHHHHhhhhcccCC-C-chHHHHHHHHhhcccccCcChHHHHHHHhccCCCHHHHHH
Q psy15122 230 FGQKEALTIVARSLDPNKPTVMLEAVKVLAAVCLIPP-D-GHDKVIKAITMSGELKGKERFQPVVQGLMVKGNNEALRTA 307 (927)
Q Consensus 230 l~~~~~i~~la~sl~~~~~~~~~~vlelLaalc~~~~-~-Gh~~VL~Al~~~~~~~e~~RF~~lv~~L~~~~~~~~~~~~ 307 (927)
+.|+++|..|+.|+++.+++++++|+|||+++|+++. . ||++||+||++++..++..||++||..| ....+++|+++
T Consensus 158 l~~~~~i~~l~~~L~s~~~~~~~~aleLL~~lc~~~~~~gG~~~VL~Al~~~~~~~e~~RF~~lv~~L-~~~~~~e~~~~ 236 (383)
T 3eg5_B 158 LETEEGILLLVRAMDPAVPNMMIDAAKLLSALCILPQPEDMNERVLEAMTERAEMDEVERFQPLLDGL-KSGTSIALKVG 236 (383)
T ss_dssp HTCSSHHHHHHHTCCTTSHHHHHHHHHHHHHHHTCCSSTTHHHHHHHHHHHHHHHHTSCTTHHHHHTT-STTSCHHHHHH
T ss_pred HcChHHHHHHHHHhCCCchHHHHHHHHHHHHHHhCcCcCCcHHHHHHHHHHHHHhCCCCcHHHHHHHH-HccCcHHHHHH
Confidence 9999999999999999999999999999999999985 3 6999999999999888999999999999 45589999999
Q ss_pred HHHHHHHHHcCchhHHHHHHHHHHHHHhChHHHHHHHhhcCChhHHHHHHHHhhhhHhHHHHHHHhchhcccccCCHHHH
Q psy15122 308 CLQLINAIVATPDDLEFRLHLRNEIMRVGLYDLLDALEKDASEDVSVQLKVFIEHKEEDYYEFIQRFDNVRMEIDDVNDC 387 (927)
Q Consensus 308 ~m~lIN~Lv~s~~dl~~Ri~lR~Ef~~~GL~eil~~L~~~~~~~L~~ql~~f~~~~~~D~~el~~r~~~~~~d~~~~~~~ 387 (927)
||.|||+||++++|+++|+|||+||.++||.+++++|+..++++|.+||++|++.+++|++|+.+|++++++|++|+.+|
T Consensus 237 ~m~lIN~li~~~~dl~~R~~lR~ef~~~Gl~~il~~lr~~~~~~L~~Qi~~fe~~~~eD~~el~~r~~~~~~d~~d~~~~ 316 (383)
T 3eg5_B 237 CLQLINALITPAEELDFRVHIRSELMRLGLHQVLQELREIENEDMKVQLCVFDEQGDEDFFDLKGRLDDIRMEMDDFGEV 316 (383)
T ss_dssp HHHHHHHHHTTCCCHHHHHHHHHHHHHTTHHHHHHHHTTSCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCSHHHH
T ss_pred HHHHHHHHHcCCCCHHHHHHHHHHHHHCChHHHHHHHhcCCChhHHHHHHHHHHHHHHhHHHHHhhccccCcCcCCHHHH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHhhcCCCchhhHHHHHhhhhccccchhhhhhhhhhhHHHHHHHhhhccchhhHHHHHHHHHHHHHHHHHhccCC
Q psy15122 388 FETVRNMVMDSACEPYLLSILQHLLFIRDDQNMVMDSACEPYLLSILQHLLFIRDDQYVRLAYYKLLEECVSQIVLHRGG 467 (927)
Q Consensus 388 f~~l~~~v~~t~a~~~f~sil~~ll~~~~~~~~~~~~~~~p~~lSilQhllli~~d~~~~~~~~~Lid~~v~qivl~r~g 467 (927)
|++|++++++|++++|| +||||||++|++|...+.+||+|||+||+|||+|++|
T Consensus 317 ~~~l~~~~~~t~a~~~f--------------------------lSiLQhLlli~~d~~~~~~~~~Lid~~v~qivl~~~g 370 (383)
T 3eg5_B 317 FQIILNTVKDSKAEPHF--------------------------LSILQHLLLVRNDYEARPQYYKLIEECVSQIVLHKNG 370 (383)
T ss_dssp HHHHHHHTTTSTTHHHH--------------------------HHHHHHTTCSCSSCTTHHHHHHHHHHHHHHHHCC---
T ss_pred HHHHHHHhcCCcchHHH--------------------------HHHHHHHHhccCCchhHHHHHHHHHHHHHHHHhccCC
Confidence 99999999999999999 9999999999999888999999999999999999999
Q ss_pred CCCCcccccccccc
Q psy15122 468 CDPDFRSSRRFQLD 481 (927)
Q Consensus 468 ~d~d~~~~~~~~~d 481 (927)
.||||+++ +|++|
T Consensus 371 ~dpd~~~~-~~~~~ 383 (383)
T 3eg5_B 371 TDPDFKCR-HLQID 383 (383)
T ss_dssp --------------
T ss_pred CCCCCCcc-CCCCC
Confidence 99999877 67665
|
| >2bnx_A Diaphanous protein homolog 1; autoinhibition, actin, nucleation, cytoskeleton, structural; 2.4A {Mus musculus} SCOP: a.118.1.23 PDB: 3o4x_A 3obv_A* 2bap_B | Back alignment and structure |
|---|
| >3obv_E Protein diaphanous homolog 1; autoinhibition, actin, nucleation, cytoskeleton, structural; HET: SUC; 2.75A {Mus musculus} PDB: 3o4x_E 2bap_D | Back alignment and structure |
|---|
| >2j1d_G DAAM1, disheveled-associated activator of morphogenesis; actin assembly, protein binding; 2.55A {Homo sapiens} PDB: 2z6e_A | Back alignment and structure |
|---|
| >1v9d_A Diaphanous protein homolog 1; helix bundle, protein binding; 2.60A {Mus musculus} SCOP: a.207.1.1 | Back alignment and structure |
|---|
| >2f31_A Diaphanous protein homolog 1; formin,MDIA1, protein-protein complex, armadillo repeats, structural protein; 2.10A {Mus musculus} | Back alignment and structure |
|---|
| >1ux5_A BNI1 protein; structural protein, FH2 actin cytoskeleton; 2.5A {Saccharomyces cerevisiae} SCOP: a.207.1.1 PDB: 1y64_B* 1ux4_A | Back alignment and structure |
|---|
| >4eah_A Formin-like protein 3, actin, alpha skeletal muscle; ATP binding, cytoskeleton, FMNL3, protein BIN; HET: ATP; 3.40A {Mus musculus} | Back alignment and structure |
|---|
| >3eg5_B Protein diaphanous homolog 1; protein-protein complex, RHO proteins, formins, armadillo repeat, G-protein, GTPase, alternative splicing; HET: GNP; 2.70A {Mus musculus} SCOP: a.118.1.23 PDB: 1z2c_B* | Back alignment and structure |
|---|
| >3dad_A FH1/FH2 domain-containing protein 1; formin, FHOD1, GTPase-binding domain, ubiquitin-superfold, armadillo repeats, actin-binding, coiled coil; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >4dvg_B Diaphanous protein; cytoskeleton, armadillo repeat, GTPase-binding domain, nucle binding, signaling protein, lipoprotein; HET: GSP; 2.60A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >2bnx_A Diaphanous protein homolog 1; autoinhibition, actin, nucleation, cytoskeleton, structural; 2.4A {Mus musculus} SCOP: a.118.1.23 PDB: 3o4x_A 3obv_A* 2bap_B | Back alignment and structure |
|---|
| >2f31_A Diaphanous protein homolog 1; formin,MDIA1, protein-protein complex, armadillo repeats, structural protein; 2.10A {Mus musculus} | Back alignment and structure |
|---|
| >2v8f_C MDIA1, profilin IIA; alternative splicing, protein-binding, cytoplasm, acetylation, cytoskeleton, actin-binding; 1.1A {Mus musculus} | Back alignment and structure |
|---|
| >3iot_A Maltose-binding protein, huntingtin fusion protei; HTT-EX1, HD, sugar transport, transport, apoptos disease mutation, nucleus; 3.50A {Escherichia coli k-12} PDB: 3io6_A 3io4_A 3ior_A 3iou_A 3iov_A 3iow_A | Back alignment and structure |
|---|
| >4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} | Back alignment and structure |
|---|
| >4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A | Back alignment and structure |
|---|
| >4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} | Back alignment and structure |
|---|
| >3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A | Back alignment and structure |
|---|
| >3iot_A Maltose-binding protein, huntingtin fusion protei; HTT-EX1, HD, sugar transport, transport, apoptos disease mutation, nucleus; 3.50A {Escherichia coli k-12} PDB: 3io6_A 3io4_A 3ior_A 3iou_A 3iov_A 3iow_A | Back alignment and structure |
|---|
| >4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} | Back alignment and structure |
|---|
| >3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B | Back alignment and structure |
|---|
| >4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} | Back alignment and structure |
|---|
| >3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... | Back alignment and structure |
|---|
| >4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A | Back alignment and structure |
|---|
| >3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A | Back alignment and structure |
|---|
| >3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B | Back alignment and structure |
|---|
| >1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* | Back alignment and structure |
|---|
| >4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A | Back alignment and structure |
|---|
| >3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... | Back alignment and structure |
|---|
| >4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 927 | ||||
| d2bnxa1 | 343 | a.118.1.23 (A:133-475) Diaphanous protein homolog | 4e-88 | |
| d1v9da_ | 332 | a.207.1.1 (A:) Diaphanous protein homolog 1, dia1 | 4e-57 | |
| d1ux5a_ | 411 | a.207.1.1 (A:) Bni1 {Baker's yeast (Saccharomyces | 3e-49 | |
| d1jvra_ | 137 | a.61.1.2 (A:) HTLV-II matrix protein {Human T-cell | 0.003 | |
| d1jvra_ | 137 | a.61.1.2 (A:) HTLV-II matrix protein {Human T-cell | 0.004 |
| >d2bnxa1 a.118.1.23 (A:133-475) Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 343 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: alpha-alpha superhelix superfamily: ARM repeat family: Diap1 N-terninal region-like domain: Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) species: Mouse (Mus musculus) [TaxId: 10090]
Score = 282 bits (724), Expect = 4e-88
Identities = 140/372 (37%), Positives = 225/372 (60%), Gaps = 35/372 (9%)
Query: 136 PIEYIQYLSQPELSVNKMYSCIESLRIALTNHPLSWVNEFVLQDNKNFRKYPIAFLYPRF 195
+ YIQ L + L + SC+ESLR++L N+P+SWV F + + + L+
Sbjct: 4 AMMYIQEL-RSGLRDMHLLSCLESLRVSLNNNPVSWVQTFGAEGLASLLDI-LKRLHDE- 60
Query: 196 PSRSRNDSRYDRVQYECVRCIRAIMNNTVGLKQMFGQKEALTIVARSLDPNKPTVMLEAV 255
+ + R Q+E +RC++A MNN G+K M +E + ++ R++DP P +M++A
Sbjct: 61 -KEETSGNYDSRNQHEIIRCLKAFMNNKFGIKTMLETEEGILLLVRAMDPAVPNMMIDAA 119
Query: 256 KVLAAVCLI--PPDGHDKVIKAITMSGELKGKERFQPVVQGLMVKGNNEALRTACLQLIN 313
K+L+A+C++ P D +++V++A+T E+ ERFQP++ GL G + AL+ CLQLIN
Sbjct: 120 KLLSALCILPQPEDMNERVLEAMTERAEMDEVERFQPLLDGLK-SGTSIALKVGCLQLIN 178
Query: 314 AIVATPDDLEFRLHLRNEIMRVGLYDLLDALEKDASEDVSVQLKVFIEHKEEDYYEFIQR 373
A++ ++L+FR+H+R+E+MR+GL+ +L L + +ED+ VQL VF E +ED+++ R
Sbjct: 179 ALITPAEELDFRVHIRSELMRLGLHQVLQELREIENEDMKVQLCVFDEQGDEDFFDLKGR 238
Query: 374 FDNVRMEIDDVNDCFETVRNMVMDSACEPYLLSILQHLLFIRDDQNMVMDSACEPYLLSI 433
D++RME+DD + F+ + N V DS EP+ LSI
Sbjct: 239 LDDIRMEMDDFGEVFQIILNTVKDSKAEPHFLSI-------------------------- 272
Query: 434 LQHLLFIRDDQYVRLAYYKLLEECVSQIVLHRGGCDPDFRSSRRFQLDVQPLVEHLAEKS 493
LQHLL +R+D R YYKL+EECVSQIVLH+ G DPDF+ R Q+D++ LV+ + +K+
Sbjct: 273 LQHLLLVRNDYEARPQYYKLIEECVSQIVLHKNGTDPDFK-CRHLQIDIERLVDQMIDKT 331
Query: 494 KTEEDR-RVEDL 504
K E+ + +L
Sbjct: 332 KVEKSEAKATEL 343
|
| >d1v9da_ a.207.1.1 (A:) Diaphanous protein homolog 1, dia1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 332 | Back information, alignment and structure |
|---|
| >d1ux5a_ a.207.1.1 (A:) Bni1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 411 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 927 | |||
| d2bnxa1 | 343 | Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) { | 100.0 | |
| d1v9da_ | 332 | Diaphanous protein homolog 1, dia1 {Mouse (Mus mus | 100.0 | |
| d1ux5a_ | 411 | Bni1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 100.0 | |
| d2bnxa1 | 343 | Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) { | 97.38 | |
| d1q1sc_ | 434 | Importin alpha {Mouse (Mus musculus) [TaxId: 10090 | 94.37 | |
| d1wa5b_ | 503 | Karyopherin alpha {Baker's yeast (Saccharomyces ce | 86.97 | |
| d1xqra1 | 264 | Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi | 83.03 | |
| d1wa5b_ | 503 | Karyopherin alpha {Baker's yeast (Saccharomyces ce | 82.28 | |
| d1q1sc_ | 434 | Importin alpha {Mouse (Mus musculus) [TaxId: 10090 | 80.42 |
| >d2bnxa1 a.118.1.23 (A:133-475) Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: alpha-alpha superhelix superfamily: ARM repeat family: Diap1 N-terninal region-like domain: Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) species: Mouse (Mus musculus) [TaxId: 10090]
Probab=100.00 E-value=1.1e-59 Score=523.97 Aligned_cols=328 Identities=42% Similarity=0.774 Sum_probs=297.6
Q ss_pred CChHHHHHHhcCCccchhhhhhhHHHHHHHhccCCchhHHHHhhhhhhhhhhcchhhhcCcCCCCCCCcchhhHHHHHHH
Q psy15122 134 DKPIEYIQYLSQPELSVNKMYSCIESLRIALTNHPLSWVNEFVLQDNKNFRKYPIAFLYPRFPSRSRNDSRYDRVQYECV 213 (927)
Q Consensus 134 ~~P~~~i~~L~~~~~~~~~~~~~l~~Lrv~L~t~~~sWv~~F~~~Gl~~Ll~~~l~~ll~~l~~~~~~~~~~~~~~~e~v 213 (927)
.+|.|||++|+++ ...+++++||++|||+|||+|++||++|..+|+.+|+++ |..+... +.......+...||+||
T Consensus 2 ~s~~~yv~~l~~~-~~~~~~~~~L~sL~v~Lrt~~~sWv~~F~~~G~~~L~~~-L~~l~~~--~~~~~~~~d~~~e~e~l 77 (343)
T d2bnxa1 2 RSAMMYIQELRSG-LRDMHLLSCLESLRVSLNNNPVSWVQTFGAEGLASLLDI-LKRLHDE--KEETSGNYDSRNQHEII 77 (343)
T ss_dssp CCHHHHHHHHTSC-CCHHHHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHHHHH-HHHHHTC--CTTTCCTTHHHHHHHHH
T ss_pred CCHHHHHHHHHhc-CCccHHHHHHHHHHHHHhcCCchHHHHHHhccHHHHHHH-HHHHHhh--cccccccccHHHHHHHH
Confidence 4899999999886 567788999999999999999999999988999999985 4333221 11112345677899999
Q ss_pred HHHHHHHhcHhhHHHHhcchhHHHHHHHhcCCCChhHHHHHHHHhhhhcccCC--CchHHHHHHHHhhcccccCcChHHH
Q psy15122 214 RCIRAIMNNTVGLKQMFGQKEALTIVARSLDPNKPTVMLEAVKVLAAVCLIPP--DGHDKVIKAITMSGELKGKERFQPV 291 (927)
Q Consensus 214 kCLkaimN~~~Gl~~vl~~~~~i~~la~sl~~~~~~~~~~vlelLaalc~~~~--~Gh~~VL~Al~~~~~~~e~~RF~~l 291 (927)
+|||||||++.|++.|+.++.+|+.|+.|+.+++++++++|+|+|+++|+++. +||.+||+||+++++.++..||++|
T Consensus 78 ~CLkalmn~~~G~~~vl~~~~~i~~l~~~L~s~~~~tr~~a~elL~~lc~~~~~~~g~~~vL~Al~~~~~~~e~~RF~~l 157 (343)
T d2bnxa1 78 RCLKAFMNNKFGIKTMLETEEGILLLVRAMDPAVPNMMIDAAKLLSALCILPQPEDMNERVLEAMTERAEMDEVERFQPL 157 (343)
T ss_dssp HHHHHHTSSHHHHHHHHHSSSHHHHHHHTCCTTSHHHHHHHHHHHHHHHTCCSSTTHHHHHHHHHHHHHHHHTSCTTHHH
T ss_pred HHHHHHhccHHHHHHHHcChHHHHHHHHccCCCchHHHHHHHHHHHHHHhccCCCchHHHHHHHHHHHHHhcCCCcHHHH
Confidence 99999999999999999999999999999999999999999999999999974 5999999999999988999999999
Q ss_pred HHHHhccCCCHHHHHHHHHHHHHHHcCchhHHHHHHHHHHHHHhChHHHHHHHhhcCChhHHHHHHHHhhhhHhHHHHHH
Q psy15122 292 VQGLMVKGNNEALRTACLQLINAIVATPDDLEFRLHLRNEIMRVGLYDLLDALEKDASEDVSVQLKVFIEHKEEDYYEFI 371 (927)
Q Consensus 292 v~~L~~~~~~~~~~~~~m~lIN~Lv~s~~dl~~Ri~lR~Ef~~~GL~eil~~L~~~~~~~L~~ql~~f~~~~~~D~~el~ 371 (927)
|+.| ....+.+|+++||.|||+||++++|+++|+|||+||.++||.+++++|+..+++.|.+||++|++.+++|++++.
T Consensus 158 v~~l-~~~~~~ey~~a~m~lIN~li~~~~dl~~R~~lR~E~~~~Gl~~il~~l~~~~~~~L~~Qi~~f~~~~~~D~~el~ 236 (343)
T d2bnxa1 158 LDGL-KSGTSIALKVGCLQLINALITPAEELDFRVHIRSELMRLGLHQVLQELREIENEDMKVQLCVFDEQGDEDFFDLK 236 (343)
T ss_dssp HHHT-STTSCHHHHHHHHHHHHHHHTTCSCHHHHHHHHHHHHHTTHHHHHHHHTTCCCHHHHHHHHHHHHHHHHHHHHHH
T ss_pred HHHH-hccccHHHHHHHHHHHHHHHcCcccHHHHHHHHHHHHHCChHHHHHHHHccCChHHHHHHHHHHHHHHhHHHHHH
Confidence 9999 567789999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HhchhcccccCCHHHHHHHHHHHhhcCCCchhhHHHHHhhhhccccchhhhhhhhhhhHHHHHHHhhhccchhhHHHHHH
Q psy15122 372 QRFDNVRMEIDDVNDCFETVRNMVMDSACEPYLLSILQHLLFIRDDQNMVMDSACEPYLLSILQHLLFIRDDQYVRLAYY 451 (927)
Q Consensus 372 ~r~~~~~~d~~~~~~~f~~l~~~v~~t~a~~~f~sil~~ll~~~~~~~~~~~~~~~p~~lSilQhllli~~d~~~~~~~~ 451 (927)
++++++.+|++|+.++|+.|++++++|++++|| +||+|||+++++|...+.+||
T Consensus 237 ~~~~~~~~d~~~~~~~~~~l~~~~~~t~~e~~f--------------------------lSilQhLll~~~~~~~~~~~~ 290 (343)
T d2bnxa1 237 GRLDDIRMEMDDFGEVFQIILNTVKDSKAEPHF--------------------------LSILQHLLLVRNDYEARPQYY 290 (343)
T ss_dssp HHHHHHHHHCCCHHHHHHHHHHHHTTSTHHHHH--------------------------HHHHHHHTTSCCCTTTHHHHH
T ss_pred hcccccccccCCHHHHHHHHHHHhcCCccHHHH--------------------------HHHHHHHHcCCcCcchHHHHH
Confidence 999999999999999999999999999999999 999999999999988899999
Q ss_pred HHHHHHHHHHHhccCCCCCCccccccccccchHHHHHHHHhh
Q psy15122 452 KLLEECVSQIVLHRGGCDPDFRSSRRFQLDVQPLVEHLAEKS 493 (927)
Q Consensus 452 ~Lid~~v~qivl~r~g~d~d~~~~~~~~~dv~~ll~~l~~~~ 493 (927)
+|||+||+||+++++|.||||.. ++|+++|+++++.+.+..
T Consensus 291 ~Lid~~v~~i~l~~~~~d~d~~~-~~l~~~i~~l~d~l~~~~ 331 (343)
T d2bnxa1 291 KLIEECVSQIVLHKNGTDPDFKC-RHLQIDIERLVDQMIDKT 331 (343)
T ss_dssp HHHHHHHHHHHTCGGGCCCCTTC-SCCCCCCTTTC-----CT
T ss_pred HHHHHHHHHHHHhhcCCCCCchh-hhhhhhHHHHHHHHhhHH
Confidence 99999999999999999999964 489999999999888764
|
| >d1v9da_ a.207.1.1 (A:) Diaphanous protein homolog 1, dia1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ux5a_ a.207.1.1 (A:) Bni1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2bnxa1 a.118.1.23 (A:133-475) Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|