Psyllid ID: psy15122


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------
MDLQDILEEQENMLEKLNPEQLNQKFEDMLNDMNLSDEKKEPLRRQPLANKKKMLLMHYKGTVTSYENKKQENMLEKLNPEQLNQKFEDMLNDMNLSDEKKEPLRRQPLANKKKMLLMHYKGTVTSYENKSKFDKPIEYIQYLSQPELSVNKMYSCIESLRIALTNHPLSWVNEFVLQDNKNFRKYPIAFLYPRFPSRSRNDSRYDRVQYECVRCIRAIMNNTVGLKQMFGQKEALTIVARSLDPNKPTVMLEAVKVLAAVCLIPPDGHDKVIKAITMSGELKGKERFQPVVQGLMVKGNNEALRTACLQLINAIVATPDDLEFRLHLRNEIMRVGLYDLLDALEKDASEDVSVQLKVFIEHKEEDYYEFIQRFDNVRMEIDDVNDCFETVRNMVMDSACEPYLLSILQHLLFIRDDQNMVMDSACEPYLLSILQHLLFIRDDQYVRLAYYKLLEECVSQIVLHRGGCDPDFRSSRRFQLDVQPLVEHLAEKSKTEEDRRVEDLSAKLEEAIMLRQEAEAKLVQAQKTLEDLSSGRPVEKNRLDEVKAQVAAGIPTGPKGGPPPPPPPPGGMGPPPPPMPGMPGPPPPPMPEMYTDCHKNIINGKQACEEVKQSKKLAKILELILLMGNYMNSGSRNGGAFGFEINFLTKLSSTKDIENKTTLLHYLVDTIEQKFPECLKFGDELLHVDRAARVSTDVIQNSIRQMENNIKNLETDIQNCKQAPVANENDKFLEIMEPFAKEVRQKITLLSNMSKNMMTLYGDLAEFYTFDKNIYTLEEFFTDIKTFKDSFYQAWQENIKLREAEEKSIRVREAREKAENEKKDKAARKKALIDMTTDQTQQGVMDSLLEALQTGRPKKTGSSIKSVGCPSHSALQTGSAFTREQRRKRQNDRPMGAERRAQLNRSRSRNGIVITRELSNEVLIGNA
ccHHHHHHHHHHccccccHHHHHHHHHHHHHcccccccccccccccccccHHHHHccccccccccccccHHHHHcccccHHHHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHHHcccccccccccccccHHHHHHHHcccccccHHHHHHHHHHHHHccccccHHHHHHHHccccccHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHccHHHHHHHHccHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHccccccccHHHHHHHHHcccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcccccccccccHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHcccccccccccccccEEccccccHHHcccccccccHHHHHHHHHHHHccccccHHHHHHcHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHcccccccHHHHHcccccccccccHHHHHcHHHHHHccc
cccHHHHHHHHcccccccHHHHHHHHHHHHHHccccccccccccccccccccHHcccccccccccccccHHHHccccccHHHHHHHHHHHHHHccccHHHHHHHHHccHHHHHHHHHHHHcccccccccccccccHHHHHHHHHcccccHHHHHHHHHHHHHHHcccccHHHHHHcccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHcHHHHHHHHccHHHHHHHHHHccccccHHHHHHHHHHHHHHEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHccHHHccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHccccccHHHHHHHccccccccHEEEEEEccccccHHHHHHHHHHHHHHHHccccccccccccccccEcHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHcccccccccccEEHHHHHHHHccccccHHHHHHHHHHHHHHHHccHHHccHHHHHcHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHcccccccccccccccccccHHHccccccccccHHHccccccccccccccccccccccccHHHHHHHHHHHHccc
MDLQDILEEQENMLEKLNPEQLNQKFEDMLndmnlsdekkeplrrqplanKKKMLLMHYKGTVTSYENKKQENMLEKLNPEQLNQKFEDMLndmnlsdekkeplrrqplanKKKMLLMHYKGTVTSyenkskfdkpieYIQYLSQPELSVNKMYSCIESLRIAltnhplswvnefvlqdnknfrkypiaflyprfpsrsrndsrydrVQYECVRCIRAIMNNTVGLKQMFGQKEALTIVARsldpnkptVMLEAVKVLAAVclippdghdKVIKAITMSgelkgkerfQPVVQGLMVKGNNEALRTACLQLINAIVATPDDLEFRLHLRNEIMRVGLYDLLDALEKDASEDVSVQLKVFIEHKEEDYYEFIQRFDNVRMEIDDVNDCFETVRNMVMDSACEPYLLSILQHLLFirddqnmvmdsaCEPYLLSILQHLLFIRDDQYVRLAYYKLLEECVSQIVlhrggcdpdfrssrrfqldvQPLVEHLAEKSKTEEDRRVEDLSAKLEEAIMLRQEAEAKLVQAQKTLedlssgrpveknRLDEVKAQVAagiptgpkggppppppppggmgpppppmpgmpgpppppmpemytdchkNIINGKQACEEVKQSKKLAKILELILLMGNymnsgsrnggafgFEINFLtklsstkdienKTTLLHYLVDTIEQKFPECLKFGDELLHVDRAARVSTDVIQNSIRQMENNIKNLETDIqnckqapvanendkFLEIMEPFAKEVRQKITLLSNMSKNMMTLYGDLAEFYTFDKNIYTLEEFFTDIKTFKDSFYQAWQENIKLREAEEKSIRVREAREKAENEKKDKAARKKALIDMTTDQTQQGVMDSLLEALqtgrpkktgssiksvgcpshsalqtgsaFTREQRRkrqndrpmgaERRAQLNRSRSRNGIVITRELSNEVLIGNA
MDLQDILEEQENMLEKLNPEQLNQKFEDMLNDMnlsdekkeplrrqplankkkMLLMHYKGTVTSYENKKQENMLEKLNPEQLNQKFEDMLNDMnlsdekkeplrrqplankkkMLLMHYKGTVtsyenkskfDKPIEYIQYLSQPELSVNKMYSCIESLRIALTNHPLSWVNEFVLQDNKNFRKYPIAflyprfpsrsrndsrydRVQYECVRCIRAIMNNTVGLKQMFGQKEALTIVARSLDPNKPTVMLEAVKVLAAVCLIPPDGHDKVIKAITMSGELKGKERFQPVVQGLMVKGNNEALRTACLQLINAIVATPDDLEFRLHLRNEIMRVGLYDLLDALEKDASEDVSVQLKVFIEHKEEDYYEFIQRFDNVRMEIDDVNDCFETVRNMVMDSACEPYLLSILQHLLFIRDDQNMVMDSACEPYLLSILQHLLFIRDDQYVRLAYYKLLEECVSQIVLHRGGCDPDFRSSRRFQLDVQPLVehlaekskteedrrvEDLSAKLEEAIMLRQEAEAKLVQAQKtledlssgrpveknRLDEVKAQVAagiptgpkggPPPPPPPPGGMGPPPPPMPGMPGPPPPPMPEMYTDCHKNIINGKQACEEVKQSKKLAKILELILLMGNYMNSGSRNGGAFGFEINFLTKLSSTKDIENKTTLLHYLVDTIEQKFPECLKFGDELLHVDRAARVSTDVIQNSIRQMENNIKNLETDIQNCKQAPVANENDKFLEIMEPFAKEVRQKITLLSNMSKNMMTLYGDLAEFYTFDKNIYTLEEFFTDIKTFKDSFYQAWQENIklreaeeksirvrearekaenekkdkaarKKALidmttdqtqqgVMDSLLEALQTGRPKKTgssiksvgcpshsalqtgsaftreqrrkrqndrpmgaerraqlnrsrsrngivitrelsnevligna
MDLQDILEEQENMLEKLNPEQLNQKFEDMLNDMNLSDEKKEPLRRQPLANKKKMLLMHYKGTVTSYENKKQENMLEKLNPEQLNQKFEDMLNDMNLSDEKKEPLRRQPLANKKKMLLMHYKGTVTSYENKSKFDKPIEYIQYLSQPELSVNKMYSCIESLRIALTNHPLSWVNEFVLQDNKNFRKYPIAFLYPRFPSRSRNDSRYDRVQYECVRCIRAIMNNTVGLKQMFGQKEALTIVARSLDPNKPTVMLEAVKVLAAVCLIPPDGHDKVIKAITMSGELKGKERFQPVVQGLMVKGNNEALRTACLQLINAIVATPDDLEFRLHLRNEIMRVGLYDLLDALEKDASEDVSVQLKVFIEHKEEDYYEFIQRFDNVRMEIDDVNDCFETVRNMVMDSACEPYLLSILQHLLFIRDDQNMVMDSACEPYLLSILQHLLFIRDDQYVRLAYYKLLEECVSQIVLHRGGCDPDFRSSRRFQLDVQPLVEHLAEKSKTEEDRRVEDLSAKLEEAIMLRQEAEAKLVQAQKTLEDLSSGRPVEKNRLDEVKAQVAAGIPTgpkggppppppppggmgpppppmpgmpgpppppmpEMYTDCHKNIINGKQACEEVKQSkklakilelillMGNYMNSGSRNGGAFGFEINFLTKLSSTKDIENKTTLLHYLVDTIEQKFPECLKFGDELLHVDRAARVSTDVIQNSIRQMENNIKNLETDIQNCKQAPVANENDKFLEIMEPFAKEVRQKITLLSNMSKNMMTLYGDLAEFYTFDKNIYTLEEFFTDIKTFKDSFYQAWQENIKLREAEEKSIrvrearekaenekkdkaarkkaLIDMTTDQTQQGVMDSLLEALQTGRPKKTGSSIKSVGCPSHSALQTGSAFTREQRRKRQNDRPMGAERRAQLNRSRSRNGIVITRELSNEVLIGNA
********************************************************MHY*******************************************************MLLMHYKGTVTSYENKSKFDKPIEYIQYLSQPELSVNKMYSCIESLRIALTNHPLSWVNEFVLQDNKNFRKYPIAFLYPRFPSR**NDSRYDRVQYECVRCIRAIMNNTVGLKQMFGQKEALTIVARSLDPNKPTVMLEAVKVLAAVCLIPPDGHDKVIKAITMSGELKGKERFQPVVQGLMVKGNNEALRTACLQLINAIVATPDDLEFRLHLRNEIMRVGLYDLLDALEKDASEDVSVQLKVFIEHKEEDYYEFIQRFDNVRMEIDDVNDCFETVRNMVMDSACEPYLLSILQHLLFIRDDQNMVMDSACEPYLLSILQHLLFIRDDQYVRLAYYKLLEECVSQIVLHRGGCDPDFRSSRRFQLDV*****************************************************************************************************************DCHKNIINGKQACEEVKQSKKLAKILELILLMGNYMNSGSRNGGAFGFEINFLTKLSSTKDIENKTTLLHYLVDTIEQKFPECLKFGDELLHVDRAARVSTDVIQNSIRQMENNIKNLETDIQNCKQAPVANENDKFLEIMEPFAKEVRQKITLLSNMSKNMMTLYGDLAEFYTFDKNIYTLEEFFTDIKTFKDSFYQAWQENIKL******************************************************************************************************************************
********************QLNQKFEDM*******************************************************QKFEDMLNDM******************KKMLLMH*******************YIQYLSQ*********************************DNKNFRKYPIAFL****************VQYECVRCIRAIMNNTVGLKQMFGQKEALTIVARSLDPNKPTVMLEAVKVLAAVCLIPPDGHDKVIKAITMSGELKGKERFQPVVQGLMVKGNNEALRTACLQLINAIVATPDDLEFRLHLRNEIMRVGLYDLLDALEKDASEDVSVQLKVFIEHKEEDYYEFIQRFDNVRMEIDDVNDCFETVRNMVMDSACEPYLLSILQHLLFIRDDQNMVMDSACEPYLLSILQHLLFIRDDQYVRLAYYKLLEECV**********************DVQP***************************************************************************************MGPPPPPMPGMPGPPPPPMPEMYTDCHKNIINGKQACEEVKQSKKLAKILELILLMGNYMNSGSRNGGAFGFEINFLTKLSSTKDIENKTTLLHYLVDTIEQKFPECLKFGDELLHVDRAARVSTDVIQNSIRQMENNIKNL******************FLEIMEPFAKEVRQKITLLSNMSKNMMTLYGDLAEFYTFDKNIYTLEEFFTDIKTFKDSFYQAWQENI*************************************************************************************************************************E*LIG**
MDLQDILEEQENMLEKLNPEQLNQKFEDMLNDMNLSDEKKEPLRRQPLANKKKMLLMHYKGTVTSYENKKQENMLEKLNPEQLNQKFEDMLNDMNLSDEKKEPLRRQPLANKKKMLLMHYKGTVTSYENKSKFDKPIEYIQYLSQPELSVNKMYSCIESLRIALTNHPLSWVNEFVLQDNKNFRKYPIAFLYPRFPSRSRNDSRYDRVQYECVRCIRAIMNNTVGLKQMFGQKEALTIVARSLDPNKPTVMLEAVKVLAAVCLIPPDGHDKVIKAITMSGELKGKERFQPVVQGLMVKGNNEALRTACLQLINAIVATPDDLEFRLHLRNEIMRVGLYDLLDALEKDASEDVSVQLKVFIEHKEEDYYEFIQRFDNVRMEIDDVNDCFETVRNMVMDSACEPYLLSILQHLLFIRDDQNMVMDSACEPYLLSILQHLLFIRDDQYVRLAYYKLLEECVSQIVLHRGGCDPDFRSSRRFQLDVQPLVEHLAE**********EDLSAKLEEAIMLRQEAEAKLVQAQKTLEDLSSGRPVEKNRLDEVKAQVAAGIPTGPKGGPPPPPPPPGGMGPPPPPMPGMPGPPPPPMPEMYTDCHKNIINGKQACEEVKQSKKLAKILELILLMGNYMNSGSRNGGAFGFEINFLTKLSSTKDIENKTTLLHYLVDTIEQKFPECLKFGDELLHVDRAARVSTDVIQNSIRQMENNIKNLETDIQNCKQAPVANENDKFLEIMEPFAKEVRQKITLLSNMSKNMMTLYGDLAEFYTFDKNIYTLEEFFTDIKTFKDSFYQAWQENIKLREAEEKSIRV******************KALIDMTTDQTQQGVMDSLLEALQT**************************************************RSRSRNGIVITRELSNEVLIGNA
****DILEEQENMLEKLNPEQLNQKFEDMLNDMNLSD*************************VTSYENKKQENMLEKLNPEQLNQKFEDMLNDMNLSDEKKEPLRRQPLANKKKMLLMHYKGT*********FDKPIEYIQYLSQPELSVNKMYSCIESLRIALTNHPLSWVNEFVLQDNKNFRKYPIAFLYPRFPSRSRNDSRYDRVQYECVRCIRAIMNNTVGLKQMFGQKEALTIVARSLDPNKPTVMLEAVKVLAAVCLIPPDGHDKVIKAITMSGELKGKERFQPVVQGLMVKGNNEALRTACLQLINAIVATPDDLEFRLHLRNEIMRVGLYDLLDALEKDASEDVSVQLKVFIEHKEEDYYEFIQRFDNVRMEIDDVNDCFETVRNMVMDSACEPYLLSILQHLLFIRDDQNMVMDSACEPYLLSILQHLLFIRDDQYVRLAYYKLLEECVSQIVLHRGGCDPDFRSSRRFQLDVQPLVEHLAEKSKTEEDRRVEDLSAKLEEAIMLRQEAEAKLVQAQKTLEDLSSGRPVEKNRLDEVKAQVAAGIPTGPK************MGPPPPPMPGMPGPPPPPMPEMYTDCHKNIINGKQACEEVKQSKKLAKILELILLMGNYMNSGSRNGGAFGFEINFLTKLSSTKDIENKTTLLHYLVDTIEQKFPECLKFGDELLHVDRAARVSTDVIQNSIRQMENNIKNLETDIQNCKQAPVANENDKFLEIMEPFAKEVRQKITLLSNMSKNMMTLYGDLAEFYTFDKNIYTLEEFFTDIKTFKDSFYQAWQENIKLREAEE****************************************S********************************************************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDLQDILEEQENMLEKLNPEQLNQKFEDMLNDMNLSDEKKEPLRRQPLANKKKMLLMHYKGTVTSYENKKQENMLEKLNPEQLNQKFEDMLNDMNLSDEKKEPLRRQPLANKKKMLLMHYKGTVTSYENKSKFDKPIEYIQYLSQPELSVNKMYSCIESLRIALTNHPLSWVNEFVLQDNKNFRKYPIAFLYPRFPSRSRNDSRYDRVQYECVRCIRAIMNNTVGLKQMFGQKEALTIVARSLDPNKPTVMLEAVKVLAAVCLIPPDGHDKVIKAITMSGELKGKERFQPVVQGLMVKGNNEALRTACLQLINAIVATPDDLEFRLHLRNEIMRVGLYDLLDALEKDASEDVSVQLKVFIEHKEEDYYEFIQRFDNVRMEIDDVNDCFETVRNMVMDSACEPYLLSILQHLLFIRDDQNMVMDSACEPYLLSILQHLLFIRDDQYVRLAYYKLLEECVSQIVLHRGGCDPDFRSSRRFQLDVQPLVEHLAEKSKTEEDRRxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxRPVEKNRLDEVKAQVAAGIPTGPKGGPPPPPPPPGGMGPPPPPMPGMPGPPPPPMPEMYTDCHKNIINGKQACEEVKQSKKLAKILELILLMGNYMNSGSRNGGAFGFEINFLTKLSSTKDIENKTTLLHYLVDTIEQKFPECLKFGDELLHVDRAARVSxxxxxxxxxxxxxxxxxxxxxxxxxxxxPVANENDKFLEIMEPFAKEVRQKITLLSNMSKNMMTLYGDLAEFYTFDKNIYTLEEFFTDIKTFKDSFYQAWQENIKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxTTDQTQQGVMDSLLEALQTGRPKKTGSSIKSVGCPSHSALQTGSAFTREQRRKRQNDRPMGAERRAQLNRSRSRNGIVITRELSNEVLIGNA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query927 2.2.26 [Sep-21-2011]
P48608 1091 Protein diaphanous OS=Dro yes N/A 0.433 0.368 0.403 1e-94
O70566 1098 Protein diaphanous homolo yes N/A 0.453 0.382 0.359 1e-84
O08808 1255 Protein diaphanous homolo no N/A 0.497 0.367 0.351 3e-84
O60610 1272 Protein diaphanous homolo yes N/A 0.497 0.362 0.347 1e-82
O60879 1101 Protein diaphanous homolo no N/A 0.446 0.376 0.364 4e-82
Q9NSV4 1193 Protein diaphanous homolo no N/A 0.539 0.419 0.331 6e-78
Q9Z207 1171 Protein diaphanous homolo no N/A 0.462 0.366 0.335 1e-73
Q80U19 1115 Disheveled-associated act no N/A 0.468 0.389 0.261 2e-30
Q9Y4D1 1078 Disheveled-associated act no N/A 0.463 0.398 0.254 5e-28
Q54WH21218 Formin-A OS=Dictyostelium yes N/A 0.276 0.210 0.308 5e-28
>sp|P48608|DIA_DROME Protein diaphanous OS=Drosophila melanogaster GN=dia PE=2 SV=2 Back     alignment and function desciption
 Score =  348 bits (894), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 183/453 (40%), Positives = 279/453 (61%), Gaps = 51/453 (11%)

Query: 72  ENMLEKLNPEQLNQKFEDMLNDMNLSDEKKEPLRRQPLANKKKMLLMHYKGTVTSYENK- 130
           E  +++L+  +L+ KF +++ DMN+  +K+EPL  +    ++KM++ H KG   S E   
Sbjct: 56  EQYIQQLSVAELDAKFLEIIEDMNIPKDKREPLLAKSKEERQKMIMWHLKGK-NSLERSA 114

Query: 131 -SKFDKPIEYIQYLSQPELSVNKMYSCIESLRIALTNHPLSWVNEFVLQDNKNFRKYPIA 189
            S+F+KPI+Y++YL   E S +K+Y C+ESLR+ALT++P+SW+ EF +       K    
Sbjct: 115 NSRFEKPIDYVEYLQNGEHSTHKVYQCVESLRVALTSNPISWIKEFGVAGIGTIEK---- 170

Query: 190 FLYPRFPSRSRNDSRYDRVQYECVRCIRAIMNNTVGLKQMFG--QKEALTIVARSLDPNK 247
                  +RS+N++ Y+++++E +RC++AIMNNT GL  +    Q   + ++A+SLDP K
Sbjct: 171 -----LLARSKNNASYEKIEFEAIRCLKAIMNNTWGLNVVLNPDQHSVVLLLAQSLDPRK 225

Query: 248 PTVMLEAVKVLAAVCLI-PPDGHDKVIKAITM--SGELKGKERFQPVVQGLMVKGNNEAL 304
           P  M EA+K+LA+ C++   +G++KV++AIT   +   K  ERF+P+V  L      +  
Sbjct: 226 PQTMCEALKLLASFCIVYERNGYEKVLRAITTIAATSFKASERFRPIVDALFASDQQDPK 285

Query: 305 R-TAC--LQLINAIVATPDDLEFRLHLRNEIMRVGLYDLLD----ALEKDASEDVSVQLK 357
           R  AC  L  IN +  TP DL FRLHLR EIMR+GLYD LD     +E   +E++    K
Sbjct: 286 RDLACHSLIFINTLTNTPTDLNFRLHLRCEIMRMGLYDRLDEFTKIVEASNNENLQQHFK 345

Query: 358 VFIEHKEEDYYEFIQRFDNVRMEIDDVNDCFETVRNMVMDSACEPYLLSILQHLLFIRDD 417
           +F E +E+D+ EF+QRFDNV   +DD  DCF+ ++N+V D+  EPY LSILQHLL     
Sbjct: 346 IFNEIREDDFEEFVQRFDNVTFNMDDATDCFDVLKNLVTDTTSEPYFLSILQHLL----- 400

Query: 418 QNMVMDSACEPYLLSILQHLLFIRDDQYVRLAYYKLLEECVSQIVLHRGGCDPDFRSSRR 477
                                +IRDD Y R AYY+L+EEC+SQIV H+G CDP+F  +R 
Sbjct: 401 ---------------------YIRDDFYFRPAYYQLIEECISQIVFHKGYCDPNFE-NRN 438

Query: 478 FQLDVQPLVEHLAEKSKTEEDRRVEDLSAKLEE 510
           F +D   L++ + EK+K +E +R E+   K+E+
Sbjct: 439 FNIDTSLLLDDIVEKAKAKESKRSEEYEKKIEQ 471




Required for cytokinesis in both mitosis and meiosis. Has a role in actin cytoskeleton organization and is essential for many, if not all, actin-mediated events involving membrane invagination. May serve as a mediator between signaling molecules and actin organizers at specific phases of the cell cycle. Possible component of the contractile ring or may control its function.
Drosophila melanogaster (taxid: 7227)
>sp|O70566|DIAP2_MOUSE Protein diaphanous homolog 2 OS=Mus musculus GN=Diaph2 PE=1 SV=2 Back     alignment and function description
>sp|O08808|DIAP1_MOUSE Protein diaphanous homolog 1 OS=Mus musculus GN=Diaph1 PE=1 SV=1 Back     alignment and function description
>sp|O60610|DIAP1_HUMAN Protein diaphanous homolog 1 OS=Homo sapiens GN=DIAPH1 PE=1 SV=2 Back     alignment and function description
>sp|O60879|DIAP2_HUMAN Protein diaphanous homolog 2 OS=Homo sapiens GN=DIAPH2 PE=1 SV=1 Back     alignment and function description
>sp|Q9NSV4|DIAP3_HUMAN Protein diaphanous homolog 3 OS=Homo sapiens GN=DIAPH3 PE=1 SV=4 Back     alignment and function description
>sp|Q9Z207|DIAP3_MOUSE Protein diaphanous homolog 3 OS=Mus musculus GN=Diaph3 PE=1 SV=1 Back     alignment and function description
>sp|Q80U19|DAAM2_MOUSE Disheveled-associated activator of morphogenesis 2 OS=Mus musculus GN=Daam2 PE=2 SV=4 Back     alignment and function description
>sp|Q9Y4D1|DAAM1_HUMAN Disheveled-associated activator of morphogenesis 1 OS=Homo sapiens GN=DAAM1 PE=1 SV=2 Back     alignment and function description
>sp|Q54WH2|FORA_DICDI Formin-A OS=Dictyostelium discoideum GN=forA PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query927
307176412 1390 Protein diaphanous [Camponotus floridanu 0.466 0.310 0.592 1e-162
383865142 1090 PREDICTED: uncharacterized protein LOC10 0.487 0.414 0.570 1e-160
332025076468 Protein diaphanous [Acromyrmex echinatio 0.466 0.923 0.594 1e-159
350419329 1061 PREDICTED: hypothetical protein LOC10074 0.468 0.409 0.582 1e-158
193671635 1089 PREDICTED: hypothetical protein LOC10016 0.471 0.401 0.591 1e-157
340708834 1095 PREDICTED: hypothetical protein LOC10064 0.468 0.396 0.580 1e-157
307207075 1669 Protein diaphanous [Harpegnathos saltato 0.468 0.260 0.570 1e-156
242015037 1051 diaphanous, putative [Pediculus humanus 0.463 0.409 0.583 1e-156
328791565 1089 PREDICTED: hypothetical protein LOC41219 0.524 0.446 0.521 1e-152
345492524 1383 PREDICTED: hypothetical protein LOC10011 0.466 0.312 0.573 1e-152
>gi|307176412|gb|EFN65986.1| Protein diaphanous [Camponotus floridanus] Back     alignment and taxonomy information
 Score =  578 bits (1490), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 278/469 (59%), Positives = 360/469 (76%), Gaps = 37/469 (7%)

Query: 67  ENKKQENMLEKLNPEQLNQKFEDMLNDMNLSDEKKEPLRRQPLANKKKMLLMHYKGTVTS 126
           E ++Q  ++E+++ E +N +FE+ML +MNL++EKKEPLR+Q  + KK+ML++HYKG++  
Sbjct: 96  EIEQQRCIIERMDEETVNDRFEEMLANMNLTEEKKEPLRQQSESKKKEMLVLHYKGSIQ- 154

Query: 127 YENKSKFDKPIEYIQYLSQPELSVNKMYSCIESLRIALTNHPLSWVNEFVLQDNKNFRKY 186
            EN+SKFDKP +YIQYL+QP+LSVNK+Y+CIESLRIALTN+PLSWV EF  +  K     
Sbjct: 155 -ENRSKFDKPADYIQYLAQPDLSVNKIYNCIESLRIALTNNPLSWVQEFGTKGLKQV--- 210

Query: 187 PIAFLYPRFPSRSRNDSRYDRVQYECVRCIRAIMNNTVGLKQMFGQKEALTIVARSLDPN 246
            +A L   +    RND+RY+R+QYEC+RC++AIMNNTVG+K+M    EALTIVARSL+P 
Sbjct: 211 -LATLNECY----RNDNRYERIQYECIRCLKAIMNNTVGIKEMLAHHEALTIVARSLEPT 265

Query: 247 KPTVMLEAVKVLAAVCLIPPDGHDKVIKAITMSGELKGKERFQPVVQGLMVKGNNEALRT 306
           KP+VM EAVK+L AVCLI  D H KV+ AITM+GE KG+ERF P+VQGLM K  NE LR 
Sbjct: 266 KPSVMSEAVKLLGAVCLISSDSHKKVLDAITMNGEFKGRERFLPIVQGLMNK-KNENLRV 324

Query: 307 ACLQLINAIVATPDDLEFRLHLRNEIMRVGLYDLLDALEKDASEDVSVQLKVFIEHKEED 366
            CLQLIN+I+++ +DL+FRLHLRNE+MRVGL D+L+ LEKD SED++  LK+F +HKEED
Sbjct: 325 VCLQLINSIISSAEDLDFRLHLRNEVMRVGLADILEMLEKDESEDLATHLKIFNDHKEED 384

Query: 367 YYEFIQRFDNVRMEIDDVNDCFETVRNMVMDSACEPYLLSILQHLLFIRDDQNMVMDSAC 426
           Y EF+QRFDNVR+E+DDVNDCFE V+NMVMD+  EPY LSILQHLLF             
Sbjct: 385 YEEFVQRFDNVRLELDDVNDCFEVVKNMVMDTTAEPYFLSILQHLLF------------- 431

Query: 427 EPYLLSILQHLLFIRDDQYVRLAYYKLLEECVSQIVLHRGGCDPDFRSSRRFQLDVQPLV 486
                        IRDD  VR AYYKL+EEC+SQ+VLHR GCDPDF +++RFQ+DVQPL+
Sbjct: 432 -------------IRDDALVRTAYYKLIEECISQVVLHRSGCDPDFSATKRFQIDVQPLI 478

Query: 487 EHLAEKSKTEEDRRVEDLSAKLEEAIMLRQEAEAKLVQAQKTLEDLSSG 535
           + L EKS+ EE+RR+ +++ KLEEAI  RQEAEAKL  A+  +++L  G
Sbjct: 479 DTLVEKSRAEEERRLVEVTQKLEEAIASRQEAEAKLQHAENKIKELEQG 527




Source: Camponotus floridanus

Species: Camponotus floridanus

Genus: Camponotus

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|383865142|ref|XP_003708034.1| PREDICTED: uncharacterized protein LOC100883678 [Megachile rotundata] Back     alignment and taxonomy information
>gi|332025076|gb|EGI65259.1| Protein diaphanous [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|350419329|ref|XP_003492145.1| PREDICTED: hypothetical protein LOC100741633 [Bombus impatiens] Back     alignment and taxonomy information
>gi|193671635|ref|XP_001943564.1| PREDICTED: hypothetical protein LOC100160854 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|340708834|ref|XP_003393024.1| PREDICTED: hypothetical protein LOC100642832 [Bombus terrestris] Back     alignment and taxonomy information
>gi|307207075|gb|EFN84884.1| Protein diaphanous [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|242015037|ref|XP_002428185.1| diaphanous, putative [Pediculus humanus corporis] gi|212512728|gb|EEB15447.1| diaphanous, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|328791565|ref|XP_395654.4| PREDICTED: hypothetical protein LOC412191 [Apis mellifera] Back     alignment and taxonomy information
>gi|345492524|ref|XP_003426869.1| PREDICTED: hypothetical protein LOC100115587 isoform 2 [Nasonia vitripennis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query927
FB|FBgn0011202 1091 dia "diaphanous" [Drosophila m 0.362 0.307 0.430 8e-153
UNIPROTKB|E1BVL7 1091 DIAPH1 "Uncharacterized protei 0.497 0.422 0.348 4.1e-126
UNIPROTKB|O60879 1101 DIAPH2 "Protein diaphanous hom 0.528 0.445 0.329 2e-121
UNIPROTKB|K4DI95 1101 DIAPH2 "Diaphanous homolog 2 ( 0.528 0.445 0.329 3.3e-121
UNIPROTKB|F1Q1Q1 1103 DIAPH2 "Uncharacterized protei 0.522 0.438 0.327 6.2e-120
UNIPROTKB|C9J6U3 1097 DIAPH2 "Protein diaphanous hom 0.510 0.431 0.325 2.7e-119
MGI|MGI:1858500 1098 Diap2 "diaphanous homolog 2 (D 0.453 0.382 0.334 1.7e-118
RGD|1310707 1218 Diaph1 "diaphanous homolog 1 ( 0.380 0.289 0.367 2.4e-118
UNIPROTKB|A6NML8 1096 DIAPH2 "Protein diaphanous hom 0.528 0.447 0.329 2.6e-118
MGI|MGI:1194490 1255 Diap1 "diaphanous homolog 1 (D 0.550 0.406 0.296 2.1e-117
FB|FBgn0011202 dia "diaphanous" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 755 (270.8 bits), Expect = 8.0e-153, Sum P(3) = 8.0e-153
 Identities = 155/360 (43%), Positives = 235/360 (65%)

Query:    72 ENMLEKLNPEQLNQKFEDMLNDMNLSDEKKEPLRRQPLANKKKMLLMHYKGTVTSYENK- 130
             E  +++L+  +L+ KF +++ DMN+  +K+EPL  +    ++KM++ H KG   S E   
Sbjct:    56 EQYIQQLSVAELDAKFLEIIEDMNIPKDKREPLLAKSKEERQKMIMWHLKGK-NSLERSA 114

Query:   131 -SKFDKPIEYIQYLSQPELSVNKMYSCIESLRIALTNHPLSWVNEFVLQDNKNFRKYPIA 189
              S+F+KPI+Y++YL   E S +K+Y C+ESLR+ALT++P+SW+ EF +       K  +A
Sbjct:   115 NSRFEKPIDYVEYLQNGEHSTHKVYQCVESLRVALTSNPISWIKEFGVAGIGTIEKL-LA 173

Query:   190 FLYPRFPSRSRNDSRYDRVQYECVRCIRAIMNNTVGLKQMFG--QKEALTIVARSLDPNK 247
                     RS+N++ Y+++++E +RC++AIMNNT GL  +    Q   + ++A+SLDP K
Sbjct:   174 --------RSKNNASYEKIEFEAIRCLKAIMNNTWGLNVVLNPDQHSVVLLLAQSLDPRK 225

Query:   248 PTVMLEAVKVLAAVCLI-PPDGHDKVIKAITM--SGELKGKERFQPVVQGLMVKGNNEAL 304
             P  M EA+K+LA+ C++   +G++KV++AIT   +   K  ERF+P+V  L      +  
Sbjct:   226 PQTMCEALKLLASFCIVYERNGYEKVLRAITTIAATSFKASERFRPIVDALFASDQQDPK 285

Query:   305 RT-ACLQLI--NAIVATPDDLEFRLHLRNEIMRVGLYDLLDALEK--DASEDVSVQ--LK 357
             R  AC  LI  N +  TP DL FRLHLR EIMR+GLYD LD   K  +AS + ++Q   K
Sbjct:   286 RDLACHSLIFINTLTNTPTDLNFRLHLRCEIMRMGLYDRLDEFTKIVEASNNENLQQHFK 345

Query:   358 VFIEHKEEDYYEFIQRFDNVRMEIDDVNDCFETVRNMVMDSACEPYLLSILQHLLFIRDD 417
             +F E +E+D+ EF+QRFDNV   +DD  DCF+ ++N+V D+  EPY LSILQHLL+IRDD
Sbjct:   346 IFNEIREDDFEEFVQRFDNVTFNMDDATDCFDVLKNLVTDTTSEPYFLSILQHLLYIRDD 405


GO:0007283 "spermatogenesis" evidence=IMP
GO:0000910 "cytokinesis" evidence=IMP;NAS;TAS
GO:0005826 "actomyosin contractile ring" evidence=NAS
GO:0007279 "pole cell formation" evidence=IMP
GO:0008104 "protein localization" evidence=NAS;IMP;TAS
GO:0007015 "actin filament organization" evidence=IMP
GO:0045448 "mitotic cell cycle, embryonic" evidence=IMP
GO:0007349 "cellularization" evidence=IMP;TAS
GO:0003779 "actin binding" evidence=IEA;ISS
GO:0000915 "cytokinesis, actomyosin contractile ring assembly" evidence=IMP;NAS
GO:0030029 "actin filament-based process" evidence=TAS
GO:0017048 "Rho GTPase binding" evidence=IEA
GO:0007110 "cytokinesis after meiosis I" evidence=IMP
GO:0051225 "spindle assembly" evidence=IMP
GO:0007111 "cytokinesis after meiosis II" evidence=IMP
GO:0007424 "open tracheal system development" evidence=IMP
GO:0032507 "maintenance of protein location in cell" evidence=IMP
GO:0045177 "apical part of cell" evidence=IDA
GO:0005938 "cell cortex" evidence=IDA
GO:0016476 "regulation of embryonic cell shape" evidence=IMP
GO:0032154 "cleavage furrow" evidence=IDA
GO:0005912 "adherens junction" evidence=IDA
GO:0007605 "sensory perception of sound" evidence=IMP
GO:0030589 "pseudocleavage involved in syncytial blastoderm formation" evidence=IMP
GO:0005884 "actin filament" evidence=IDA
GO:0043234 "protein complex" evidence=IPI
GO:0005515 "protein binding" evidence=IPI
GO:0009306 "protein secretion" evidence=IMP
GO:0003383 "apical constriction" evidence=IMP
GO:0051489 "regulation of filopodium assembly" evidence=IMP
GO:0022008 "neurogenesis" evidence=IMP
GO:0035011 "melanotic encapsulation of foreign target" evidence=IMP
UNIPROTKB|E1BVL7 DIAPH1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|O60879 DIAPH2 "Protein diaphanous homolog 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|K4DI95 DIAPH2 "Diaphanous homolog 2 (Drosophila), isoform CRA_a" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1Q1Q1 DIAPH2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|C9J6U3 DIAPH2 "Protein diaphanous homolog 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1858500 Diap2 "diaphanous homolog 2 (Drosophila)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1310707 Diaph1 "diaphanous homolog 1 (Drosophila)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|A6NML8 DIAPH2 "Protein diaphanous homolog 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1194490 Diap1 "diaphanous homolog 1 (Drosophila)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query927
pfam02181372 pfam02181, FH2, Formin Homology 2 Domain 7e-58
pfam06367197 pfam06367, Drf_FH3, Diaphanous FH3 Domain 3e-55
smart00498392 smart00498, FH2, Formin Homology 2 Domain 9e-49
pfam06371187 pfam06371, Drf_GBD, Diaphanous GTPase-binding Doma 6e-38
pfam06346160 pfam06346, Drf_FH1, Formin Homology Region 1 5e-11
pfam06346160 pfam06346, Drf_FH1, Formin Homology Region 1 2e-10
pfam06346160 pfam06346, Drf_FH1, Formin Homology Region 1 5e-10
pfam06346160 pfam06346, Drf_FH1, Formin Homology Region 1 9e-10
pfam06346160 pfam06346, Drf_FH1, Formin Homology Region 1 2e-09
pfam06346160 pfam06346, Drf_FH1, Formin Homology Region 1 4e-09
pfam06346160 pfam06346, Drf_FH1, Formin Homology Region 1 4e-09
pfam06346160 pfam06346, Drf_FH1, Formin Homology Region 1 6e-09
pfam06346160 pfam06346, Drf_FH1, Formin Homology Region 1 8e-09
pfam06346160 pfam06346, Drf_FH1, Formin Homology Region 1 8e-08
pfam06346160 pfam06346, Drf_FH1, Formin Homology Region 1 2e-07
pfam07174297 pfam07174, FAP, Fibronectin-attachment protein (FA 5e-07
pfam0139160 pfam01391, Collagen, Collagen triple helix repeat 2e-06
pfam0139160 pfam01391, Collagen, Collagen triple helix repeat 2e-06
pfam0139160 pfam01391, Collagen, Collagen triple helix repeat 3e-06
pfam07174297 pfam07174, FAP, Fibronectin-attachment protein (FA 5e-06
pfam12526115 pfam12526, DUF3729, Protein of unknown function (D 2e-05
pfam07174297 pfam07174, FAP, Fibronectin-attachment protein (FA 3e-05
pfam0139160 pfam01391, Collagen, Collagen triple helix repeat 4e-05
pfam07174297 pfam07174, FAP, Fibronectin-attachment protein (FA 5e-05
pfam07174297 pfam07174, FAP, Fibronectin-attachment protein (FA 7e-05
COG5178 2365 COG5178, PRP8, U5 snRNP spliceosome subunit [RNA p 7e-05
pfam0139160 pfam01391, Collagen, Collagen triple helix repeat 8e-05
pfam06346160 pfam06346, Drf_FH1, Formin Homology Region 1 2e-04
PHA0173294 PHA01732, PHA01732, proline-rich protein 2e-04
pfam0455457 pfam04554, Extensin_2, Extensin-like region 2e-04
pfam10349111 pfam10349, WWbp, WW-domain ligand protein 2e-04
pfam07174297 pfam07174, FAP, Fibronectin-attachment protein (FA 3e-04
PRK14965576 PRK14965, PRK14965, DNA polymerase III subunits ga 3e-04
pfam07174297 pfam07174, FAP, Fibronectin-attachment protein (FA 4e-04
pfam0455457 pfam04554, Extensin_2, Extensin-like region 4e-04
pfam10349111 pfam10349, WWbp, WW-domain ligand protein 4e-04
pfam06003264 pfam06003, SMN, Survival motor neuron protein (SMN 4e-04
pfam12446133 pfam12446, DUF3682, Protein of unknown function (D 4e-04
pfam12526115 pfam12526, DUF3729, Protein of unknown function (D 5e-04
pfam0455457 pfam04554, Extensin_2, Extensin-like region 5e-04
pfam05518753 pfam05518, Totivirus_coat, Totivirus coat protein 5e-04
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 6e-04
PHA03282540 PHA03282, PHA03282, envelope glycoprotein E; Provi 6e-04
pfam0455457 pfam04554, Extensin_2, Extensin-like region 7e-04
pfam07777189 pfam07777, MFMR, G-box binding protein MFMR 7e-04
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 8e-04
smart00818165 smart00818, Amelogenin, Amelogenins, cell adhesion 8e-04
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 8e-04
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 9e-04
PHA0173294 PHA01732, PHA01732, proline-rich protein 0.001
pfam04487206 pfam04487, CITED, CITED 0.001
pfam0455457 pfam04554, Extensin_2, Extensin-like region 0.002
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 0.002
smart00818165 smart00818, Amelogenin, Amelogenins, cell adhesion 0.002
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 0.002
pfam04959211 pfam04959, ARS2, Arsenite-resistance protein 2 0.002
PRK12438991 PRK12438, PRK12438, hypothetical protein; Provisio 0.002
pfam11029136 pfam11029, DAZAP2, DAZ associated protein 2 (DAZAP 0.002
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 0.003
pfam12316202 pfam12316, Dsh_C, Segment polarity protein disheve 0.003
smart00818165 smart00818, Amelogenin, Amelogenins, cell adhesion 0.004
smart00818165 smart00818, Amelogenin, Amelogenins, cell adhesion 0.004
pfam10152147 pfam10152, DUF2360, Predicted coiled-coil domain-c 0.004
>gnl|CDD|216919 pfam02181, FH2, Formin Homology 2 Domain Back     alignment and domain information
 Score =  203 bits (518), Expect = 7e-58
 Identities = 77/201 (38%), Positives = 124/201 (61%), Gaps = 2/201 (0%)

Query: 591 PEMYTDCHKNIINGKQACEEVKQSKKLAKILELILLMGNYMNSGSRNGGAFGFEINFLTK 650
            E   +   ++   + A EE+++S+K  K+LELIL +GNYMNSG+R G A GF+++ L K
Sbjct: 173 EEEVEELKPSLETLEAASEELRESRKFKKLLELILALGNYMNSGTRRGNAKGFKLSSLLK 232

Query: 651 LSSTKDIENKTTLLHYLVDTIEQKFPECLKFGDELLHVDRAARVSTDVIQNSIRQMENNI 710
           LS TK  +NKTTLLHYLV  I +K P+ L F  EL HV++AA+V  + ++  ++++E  +
Sbjct: 233 LSDTKSTDNKTTLLHYLVKIIREKLPDLLDFSSELSHVEKAAKVDLEQLEKDVKELEKGL 292

Query: 711 KNLETDIQNCKQAPVANENDKFLEIMEPFAKEVRQKITLLSNMSKNMMTLYGDLAEFYTF 770
           K LE +++        + +DKF+E M+ F +E  +K+  L ++ K  M L+ +L E++  
Sbjct: 293 KKLERELELSALDE--HPDDKFVEKMKEFLEEAEEKLDKLESLLKEAMELFKELTEYFGE 350

Query: 771 DKNIYTLEEFFTDIKTFKDSF 791
           D    + EEFF  ++ F   F
Sbjct: 351 DPKETSPEEFFKILRDFLRMF 371


Length = 372

>gnl|CDD|219000 pfam06367, Drf_FH3, Diaphanous FH3 Domain Back     alignment and domain information
>gnl|CDD|214697 smart00498, FH2, Formin Homology 2 Domain Back     alignment and domain information
>gnl|CDD|219001 pfam06371, Drf_GBD, Diaphanous GTPase-binding Domain Back     alignment and domain information
>gnl|CDD|148139 pfam06346, Drf_FH1, Formin Homology Region 1 Back     alignment and domain information
>gnl|CDD|148139 pfam06346, Drf_FH1, Formin Homology Region 1 Back     alignment and domain information
>gnl|CDD|148139 pfam06346, Drf_FH1, Formin Homology Region 1 Back     alignment and domain information
>gnl|CDD|148139 pfam06346, Drf_FH1, Formin Homology Region 1 Back     alignment and domain information
>gnl|CDD|148139 pfam06346, Drf_FH1, Formin Homology Region 1 Back     alignment and domain information
>gnl|CDD|148139 pfam06346, Drf_FH1, Formin Homology Region 1 Back     alignment and domain information
>gnl|CDD|148139 pfam06346, Drf_FH1, Formin Homology Region 1 Back     alignment and domain information
>gnl|CDD|148139 pfam06346, Drf_FH1, Formin Homology Region 1 Back     alignment and domain information
>gnl|CDD|148139 pfam06346, Drf_FH1, Formin Homology Region 1 Back     alignment and domain information
>gnl|CDD|148139 pfam06346, Drf_FH1, Formin Homology Region 1 Back     alignment and domain information
>gnl|CDD|148139 pfam06346, Drf_FH1, Formin Homology Region 1 Back     alignment and domain information
>gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) Back     alignment and domain information
>gnl|CDD|189968 pfam01391, Collagen, Collagen triple helix repeat (20 copies) Back     alignment and domain information
>gnl|CDD|189968 pfam01391, Collagen, Collagen triple helix repeat (20 copies) Back     alignment and domain information
>gnl|CDD|189968 pfam01391, Collagen, Collagen triple helix repeat (20 copies) Back     alignment and domain information
>gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) Back     alignment and domain information
>gnl|CDD|152960 pfam12526, DUF3729, Protein of unknown function (DUF3729) Back     alignment and domain information
>gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) Back     alignment and domain information
>gnl|CDD|189968 pfam01391, Collagen, Collagen triple helix repeat (20 copies) Back     alignment and domain information
>gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) Back     alignment and domain information
>gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) Back     alignment and domain information
>gnl|CDD|227505 COG5178, PRP8, U5 snRNP spliceosome subunit [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|189968 pfam01391, Collagen, Collagen triple helix repeat (20 copies) Back     alignment and domain information
>gnl|CDD|148139 pfam06346, Drf_FH1, Formin Homology Region 1 Back     alignment and domain information
>gnl|CDD|222828 PHA01732, PHA01732, proline-rich protein Back     alignment and domain information
>gnl|CDD|218146 pfam04554, Extensin_2, Extensin-like region Back     alignment and domain information
>gnl|CDD|220708 pfam10349, WWbp, WW-domain ligand protein Back     alignment and domain information
>gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) Back     alignment and domain information
>gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) Back     alignment and domain information
>gnl|CDD|218146 pfam04554, Extensin_2, Extensin-like region Back     alignment and domain information
>gnl|CDD|220708 pfam10349, WWbp, WW-domain ligand protein Back     alignment and domain information
>gnl|CDD|114709 pfam06003, SMN, Survival motor neuron protein (SMN) Back     alignment and domain information
>gnl|CDD|221581 pfam12446, DUF3682, Protein of unknown function (DUF3682) Back     alignment and domain information
>gnl|CDD|152960 pfam12526, DUF3729, Protein of unknown function (DUF3729) Back     alignment and domain information
>gnl|CDD|218146 pfam04554, Extensin_2, Extensin-like region Back     alignment and domain information
>gnl|CDD|218621 pfam05518, Totivirus_coat, Totivirus coat protein Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|165539 PHA03282, PHA03282, envelope glycoprotein E; Provisional Back     alignment and domain information
>gnl|CDD|218146 pfam04554, Extensin_2, Extensin-like region Back     alignment and domain information
>gnl|CDD|219569 pfam07777, MFMR, G-box binding protein MFMR Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|197891 smart00818, Amelogenin, Amelogenins, cell adhesion proteins, play a role in the biomineralisation of teeth Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|222828 PHA01732, PHA01732, proline-rich protein Back     alignment and domain information
>gnl|CDD|218108 pfam04487, CITED, CITED Back     alignment and domain information
>gnl|CDD|218146 pfam04554, Extensin_2, Extensin-like region Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|197891 smart00818, Amelogenin, Amelogenins, cell adhesion proteins, play a role in the biomineralisation of teeth Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|218350 pfam04959, ARS2, Arsenite-resistance protein 2 Back     alignment and domain information
>gnl|CDD|171499 PRK12438, PRK12438, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|220950 pfam11029, DAZAP2, DAZ associated protein 2 (DAZAP2) Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|221526 pfam12316, Dsh_C, Segment polarity protein dishevelled (Dsh) C terminal Back     alignment and domain information
>gnl|CDD|197891 smart00818, Amelogenin, Amelogenins, cell adhesion proteins, play a role in the biomineralisation of teeth Back     alignment and domain information
>gnl|CDD|197891 smart00818, Amelogenin, Amelogenins, cell adhesion proteins, play a role in the biomineralisation of teeth Back     alignment and domain information
>gnl|CDD|220603 pfam10152, DUF2360, Predicted coiled-coil domain-containing protein (DUF2360) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 927
KOG1924|consensus1102 100.0
KOG1923|consensus830 100.0
KOG1924|consensus 1102 100.0
smart00498432 FH2 Formin Homology 2 Domain. FH proteins control 100.0
PF02181370 FH2: Formin Homology 2 Domain; InterPro: IPR015425 100.0
PF06367197 Drf_FH3: Diaphanous FH3 Domain; InterPro: IPR01047 99.97
PF06371187 Drf_GBD: Diaphanous GTPase-binding Domain; InterPr 99.96
KOG1925|consensus817 99.92
KOG1922|consensus833 99.91
PF06371187 Drf_GBD: Diaphanous GTPase-binding Domain; InterPr 98.54
PF11841160 DUF3361: Domain of unknown function (DUF3361) 96.72
PF0634515 Drf_DAD: DRF Autoregulatory Domain; InterPro: IPR0 96.39
KOG1923|consensus 830 95.17
KOG0212|consensus675 92.77
KOG2391|consensus365 92.18
PHA03247 3151 large tegument protein UL36; Provisional 91.15
KOG4849|consensus498 90.98
PRK13729475 conjugal transfer pilus assembly protein TraB; Pro 89.47
KOG3671|consensus569 89.24
PHA03247 3151 large tegument protein UL36; Provisional 88.76
KOG1925|consensus817 84.36
smart00498432 FH2 Formin Homology 2 Domain. FH proteins control 83.79
PF05308253 Mito_fiss_reg: Mitochondrial fission regulator; In 83.71
KOG0132|consensus894 82.75
PF05004309 IFRD: Interferon-related developmental regulator ( 81.67
>KOG1924|consensus Back     alignment and domain information
Probab=100.00  E-value=2.3e-168  Score=1406.09  Aligned_cols=807  Identities=43%  Similarity=0.728  Sum_probs=713.1

Q ss_pred             chhhhhhhhhhccccccccccccc-----hhhhccCCCHHHHHHHHHHHHHhCCCChhhhhhhhCCChHhHHHHHHHHHh
Q psy15122         47 PLANKKKMLLMHYKGTVTSYENKK-----QENMLEKLNPEQLNQKFEDMLNDMNLSDEKKEPLRRQPLANKKKMLLMHYK  121 (927)
Q Consensus        47 ~~~~K~~m~~~~~~~~~~~~~~~~-----~~~~~~~~~~~ei~~~F~~lle~lnl~~~k~~~L~~~p~~~K~~li~~~~~  121 (927)
                      ...+|.++...|...++.+...-+     +++ ...++++++...|+.++++|||++++|++|++.+...|.+||.||..
T Consensus        48 ~~~~~sk~~~~H~~~ss~sn~d~pt~q~~q~~-~~~ls~~e~~~~F~~~~~dmni~eekr~pll~K~~~ek~kmis~~l~  126 (1102)
T KOG1924|consen   48 AADFKSKPSPAHLRSSSASNNDYPTAQGLQDI-GFSLSSNEVLELFELMGEDMNINEEKRKPLLDKDLPEKRKMISQYLQ  126 (1102)
T ss_pred             hcccccCCCcccCCCccccccCCcccccHHHH-hhhccHHHHHHHHHHHhhhccccHhhhhhhhhcCchHHHHHHHHHHH
Confidence            456777888889866554443322     333 45689999999999999999999999999999999999999999987


Q ss_pred             ccccc-cccccCCCChHHHHHHhcCCccchhhhhhhHHHHHHHhccCCchhHHHHhhhhhhhhhhcchhhhcCcC-CCCC
Q psy15122        122 GTVTS-YENKSKFDKPIEYIQYLSQPELSVNKMYSCIESLRIALTNHPLSWVNEFVLQDNKNFRKYPIAFLYPRF-PSRS  199 (927)
Q Consensus       122 ~~~~~-~~~~~~~~~P~~~i~~L~~~~~~~~~~~~~l~~Lrv~L~t~~~sWv~~F~~~Gl~~Ll~~~l~~ll~~l-~~~~  199 (927)
                      .+... ...+....++.+||++|+++ ++++++++||.+|||+|++||||||.+|+.+|++.++++     +.+| +++.
T Consensus       127 ~k~~~~~s~ne~~~~s~eyV~~l~~g-l~t~~l~~CleslRVsL~~npVSwvn~Fgvegl~ll~~~-----Lkrl~dsk~  200 (1102)
T KOG1924|consen  127 MKMMIRKSDNEAKGSSPEYVVELRSG-LSTKKLLECLESLRVSLTSNPVSWVNKFGVEGLGLLLDV-----LKRLRDSKV  200 (1102)
T ss_pred             HHHHHhhhhhhhccCChHHHHHHHcc-cccccHHHHHHHHhhhhcCCccHHHHHhhhhhHHHHHHH-----HHHHHhhhh
Confidence            76511 22356778999999999998 888999999999999999999999999999999999885     4555 2222


Q ss_pred             CCcchhhHHHHHHHHHHHHHHhcHhhHHHHhcchhHHHHHHHhcCCCChhHHHHHHHHhhhhcccCCC-chHHHHHHHHh
Q psy15122        200 RNDSRYDRVQYECVRCIRAIMNNTVGLKQMFGQKEALTIVARSLDPNKPTVMLEAVKVLAAVCLIPPD-GHDKVIKAITM  278 (927)
Q Consensus       200 ~~~~~~~~~~~e~vkCLkaimN~~~Gl~~vl~~~~~i~~la~sl~~~~~~~~~~vlelLaalc~~~~~-Gh~~VL~Al~~  278 (927)
                       ....+.+.++|+|+||||+|||++|+..||...+.+..++++++++.+.+|++|+++|+++|++.+. |.++||+||+.
T Consensus       201 -~~~~~~k~~~eiIrClka~mNn~~Gl~~vL~~e~~lllla~aldpr~pnmm~dvvkllsalciV~ee~~~ekvl~aiT~  279 (1102)
T KOG1924|consen  201 -GSKLDIKNLQEIIRCLKAFMNNKFGLVLVLRRERSLLLLARALDPREPNMMTDVVKLLSALCIVGEENGLEKVLEAITT  279 (1102)
T ss_pred             -hhhhHHHHHHHHHHHHHHHhccccceeeeecCCccHHHHHHhcCccCccHHHHHHHHHHHHheeehhhHHHHHHHHHHH
Confidence             2334677899999999999999999999999999999999999999999999999999999999854 99999999999


Q ss_pred             hcccccCcChHHHHHHHhccCCCHHHHHHHHHHHHHHHcCchhHHHHHHHHHHHHHhChHHHHHHHhhcCChhHHHHHHH
Q psy15122        279 SGELKGKERFQPVVQGLMVKGNNEALRTACLQLINAIVATPDDLEFRLHLRNEIMRVGLYDLLDALEKDASEDVSVQLKV  358 (927)
Q Consensus       279 ~~~~~e~~RF~~lv~~L~~~~~~~~~~~~~m~lIN~Lv~s~~dl~~Ri~lR~Ef~~~GL~eil~~L~~~~~~~L~~ql~~  358 (927)
                      .++.....||+|||++| .+.....+.++||+|||+|+++++||+||+|||+||+++||+++|+.|+.++++.+++|+++
T Consensus       280 ~ae~~~veRF~piv~gl-~~~e~~~l~vacmq~INal~t~p~dldfRlhlR~E~mr~gL~~~l~~l~~i~n~~ldvqlkv  358 (1102)
T KOG1924|consen  280 IAEAKPVERFRPIVEGL-DFLEKQQLQVACMQFINALVTSPSDLDFRLHLRSEFMRDGLHKYLPDLTEINNDILDVQLKV  358 (1102)
T ss_pred             HHhhcchhhhhhHHHHH-hccchHHHHHHHHHHHHHhcCCHHHhhHHHHHHHHHHHHhHHHHHHHhhhhccHHHHHHHHH
Confidence            99999999999999999 56679999999999999999999999999999999999999999999999999999999999


Q ss_pred             HhhhhHhHHHHHHHhchhcccccCCHHHHHHHHHHHhhcCCCchhhHHHHHhhhhccccchhhhhhhhhhhHHHHHHHhh
Q psy15122        359 FIEHKEEDYYEFIQRFDNVRMEIDDVNDCFETVRNMVMDSACEPYLLSILQHLLFIRDDQNMVMDSACEPYLLSILQHLL  438 (927)
Q Consensus       359 f~~~~~~D~~el~~r~~~~~~d~~~~~~~f~~l~~~v~~t~a~~~f~sil~~ll~~~~~~~~~~~~~~~p~~lSilQhll  438 (927)
                      |++++++|.++|++|+++++.++||+.+||++|++.|++|.+++||                          |||||||+
T Consensus       359 fdE~~e~Dl~el~~rledir~emDd~~~~f~lL~n~vkdT~aE~yf--------------------------LSILQhll  412 (1102)
T KOG1924|consen  359 FDEHKEDDLEELSGRLEDIRAEMDDANEVFELLANTVKDTGAEPYF--------------------------LSILQHLL  412 (1102)
T ss_pred             HhhhhhhhHHHHHhHHHhhhhhhccHHHHHHHHHHhhhhccccchH--------------------------HHHHHHHH
Confidence            9999999999999999999999999999999999999999999999                          99999999


Q ss_pred             hccchhhHHHHHHHHHHHHHHHHHhccCCCCCCccccccccccchHHHHHHHHhhh-hhHhHHHHHHHHHHHHHHHHHHH
Q psy15122        439 FIRDDQYVRLAYYKLLEECVSQIVLHRGGCDPDFRSSRRFQLDVQPLVEHLAEKSK-TEEDRRVEDLSAKLEEAIMLRQE  517 (927)
Q Consensus       439 li~~d~~~~~~~~~Lid~~v~qivl~r~g~d~d~~~~~~~~~dv~~ll~~l~~~~~-~~~~k~~~el~~kle~~~~~~qe  517 (927)
                      +||+|+.+|++||+|||+||||||+|++|+||||.++.+|++|+..+||.++++++ ++.++++.++.++++++.+++||
T Consensus       413 lirnDy~~rpqYykLIEecISqIvlHr~~~DPdf~yr~~l~id~~~liD~~vdkak~eeseqkA~e~~kk~~ke~ta~qe  492 (1102)
T KOG1924|consen  413 LIRNDYYIRPQYYKLIEECISQIVLHRTGMDPDFKYRFRLDIDLTELIDKMVDKAKAEESEQKAAELEKKFDKELTARQE  492 (1102)
T ss_pred             HHhhhhhhhHHHHHHHHHHHHHHHHhcCCCCCCcchhhcccCcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHH
Confidence            99999999999999999999999999999999999999999999999999999998 77778999999999999999999


Q ss_pred             HHHHHHHHhhhhhcccCCC---------------CCCCCCCCC---------C--cC-CCCCCCCCCCC------CCCCC
Q psy15122        518 AEAKLVQAQKTLEDLSSGR---------------PVEKNRLDE---------V--KA-QVAAGIPTGPK------GGPPP  564 (927)
Q Consensus       518 ~ea~~~~le~~i~~l~~~~---------------~~~~~~~p~---------~--~~-~~~~~~ppppp------~~ppp  564 (927)
                      +++++++.+.+|..++++.               +++||++||         |  || |+++|||||||      |+|||
T Consensus       493 ~qael~k~e~Ki~~l~ae~~al~s~~~~~~~~~~iP~PP~~pp~gG~g~pppPppPPlpggag~PPPPpplPg~aG~PPp  572 (1102)
T KOG1924|consen  493 AQAELQKHEEKIKLLEAEKQALSSPSQLLPIDGGIPPPPPLPPTGGTGPPPPPPPPPLPGGAGPPPPPPPLPGIAGGPPP  572 (1102)
T ss_pred             HHHHHHHhhhhcccCchhhhhccCcccCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCccCCCCCcccCCCCc
Confidence            9999999999998887651               111111110         0  00 00111111111      12333


Q ss_pred             CCCCCC-CCCCCCCCCCC----CCCCCCCC-------CC-----------------------------------------
Q psy15122        565 PPPPPG-GMGPPPPPMPG----MPGPPPPP-------MP-----------------------------------------  591 (927)
Q Consensus       565 ppp~pg-~~~ppppp~pg----~p~pp~p~-------lp-----------------------------------------  591 (927)
                      |||||| +||||||||+|    +||||+|-       ||                                         
T Consensus       573 Pppppg~~gppPPPpp~g~~Gg~ppPP~~gm~pmaPvlP~gLkpKK~~k~e~~Mrr~nW~kI~p~d~s~~cFWvkv~Edk  652 (1102)
T KOG1924|consen  573 PPPPPGGGGPPPPPPPGGFLGGPPPPPPPGMFPMAPVLPFGLKPKKVYKPEVPMRRFNWSKIVPRDLSENCFWVKVNEDK  652 (1102)
T ss_pred             cCCCCCCCCCCCcCCCCCCCCCCCCCCCCCcccccccCCCCCCccccCCCCCccccCCccccCccccCccceeeecchhh
Confidence            333333 23333333322    22222210       22                                         


Q ss_pred             --------------------------------------------------------------------------------
Q psy15122        592 --------------------------------------------------------------------------------  591 (927)
Q Consensus       592 --------------------------------------------------------------------------------  591 (927)
                                                                                                      
T Consensus       653 ~en~dlfakL~~~Fatq~k~~k~~e~~eekkt~~kKk~kel~ilDsKtaQnLsIflgS~rmpyeeik~~ILevne~vLse  732 (1102)
T KOG1924|consen  653 LENDDLFAKLALKFATQPKVKKEQEGGEEKKTGTKKKVKELRILDSKTAQNLSIFLGSFRMPYEEIKNVILEVNEDVLSE  732 (1102)
T ss_pred             ccchHHHHHHHHHhhccccccccccccccccchhhhhhhhheecchHHHHHHHHHHhhccCCHHHHHHHHhhccHHHHHH
Confidence                                                                                            


Q ss_pred             -----------------------------------------------------------ccccccccccccccccchhhh
Q psy15122        592 -----------------------------------------------------------EMYTDCHKNIINGKQACEEVK  612 (927)
Q Consensus       592 -----------------------------------------------------------e~v~~i~~~i~~v~~A~~el~  612 (927)
                                                                                 |.|++|+|+|.+|++||+||+
T Consensus       733 ~~iqnLik~lPe~E~l~~L~e~Kaeye~l~e~EQF~vvm~~vkrL~pRL~~ilFKl~fse~vnniKP~i~avt~ACEE~r  812 (1102)
T KOG1924|consen  733 SMIQNLIKHLPEQEQLNKLSELKAEYEDLPEPEQFVVVMSQVKRLRPRLSAILFKLTFSEQVNNIKPDIVAVTAACEELR  812 (1102)
T ss_pred             HHHHHHHHhCCCHHHHHHHHHHHHhccCCCCHHHHhHHHhhccccChhHHHHHHHhhHHHHHhhcChHHHHHHHHHHHHH
Confidence                                                                       889999999999999999999


Q ss_pred             hchhHHHHHHHHHHhcccccCCCCCcccceeeecccccccccccCCCCcchhHHHHHHHHhhCCccCchhhhhhhHHHhh
Q psy15122        613 QSKKLAKILELILLMGNYMNSGSRNGGAFGFEINFLTKLSSTKDIENKTTLLHYLVDTIEQKFPECLKFGDELLHVDRAA  692 (927)
Q Consensus       613 ~S~~f~~lL~~IL~iGNymN~gs~~g~A~GFkLssL~KL~dtKs~d~k~TLLh~l~~~v~~~~p~ll~f~~eL~~v~~As  692 (927)
                      +|++|.++|++||.+|||||+||++.+||||+|++|+||.||||+|+|+||||||+++|+++||++++|.+||.||++||
T Consensus       813 kSesFs~lLeLvLl~GNyMn~gSrNa~afgF~is~L~kL~dTKsaDqk~TLLHfLae~~e~kypd~l~F~ddl~hv~kaS  892 (1102)
T KOG1924|consen  813 KSESFSKLLELVLLVGNYMNSGSRNAQAFGFNISFLCKLRDTKSADQKTTLLHFLAEICEEKYPDILKFPDDLEHVEKAS  892 (1102)
T ss_pred             hhhhHHHHHHHHHHHhcccccccccchhhccchHHHHhhccccccchhhHHHHHHHHHHHHhChhhhcchhhHHHHHhhc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccCHHHHHHHHHHHHHHHHHHHHHHhhhccCCCCCcchhHHHHHhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccCC
Q psy15122        693 RVSTDVIQNSIRQMENNIKNLETDIQNCKQAPVANENDKFLEIMEPFAKEVRQKITLLSNMSKNMMTLYGDLAEFYTFDK  772 (927)
Q Consensus       693 kvs~~~l~~~~~~L~~~l~~l~~~l~~~~~~~~~~~~D~f~~~m~~F~~~a~~~~~~L~~~~~~~~~~~~~l~~yfgEd~  772 (927)
                      |||.+.|.+.+.+|...+++++.+++.++..  .+++|.|.++|..|.++|++++..|..++.+|++.|+++.+||.+|+
T Consensus       893 rvnad~ikK~~~~m~~~ik~Le~dlk~~~~~--~~e~dkF~ekM~~F~e~a~eq~~~ls~M~~~M~~lye~L~eYyaFd~  970 (1102)
T KOG1924|consen  893 RVNADEIKKNLQQMENQIKKLERDLKNFKIA--GNEHDKFVEKMTSFHEKAREQYSKLSSMHGNMEKLYESLGEYYAFDP  970 (1102)
T ss_pred             cccHHHHHHHHHHHHHHHHHHHHHHHhcCCC--CcchhhHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHeecCc
Confidence            9999999999999999999999999999887  78999999999999999999999999999999999999999999999


Q ss_pred             CCCcccchhccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhccCCCCCCccchHHHHHHHH
Q psy15122        773 NIYTLEEFFTDIKTFKDSFYQAWQENIKLREAEEKSIRVREAREKAENEKKDKAARKKALIDMTTDQTQQGVMDSLLEAL  852 (927)
Q Consensus       773 ~~~~~eefF~~~~~F~~~f~~a~~en~~~~e~eek~rr~~~akekaerek~er~~~kk~~~~~~~~~~~~~v~D~Ll~~L  852 (927)
                      +++++||||++|.+|.++|..|++||+++|+++|+.||+++|+|++++|++|||+|+++++||++.+|++||||+||++|
T Consensus       971 kkysmEEFFaDi~tFrnaf~ea~~en~krRee~Ek~rr~k~a~eqseqEr~erQqrk~alIdm~a~~de~GVmDslLeaL 1050 (1102)
T KOG1924|consen  971 KKYSMEEFFADIRTFRNAFLEAVAENEKRREEEEKERRAKLAKEQSEQERLERQQRKKALIDMNAEGDETGVMDSLLEAL 1050 (1102)
T ss_pred             ccCcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhHHHhccccccchhhhHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hcCCCCCCCCCCCCCCCCCCccccccchhhHHHhhhhcCCCCCcHHHHhhhhhcccCCCcccccc
Q psy15122        853 QTGRPKKTGSSIKSVGCPSHSALQTGSAFTREQRRKRQNDRPMGAERRAQLNRSRSRNGIVITRE  917 (927)
Q Consensus       853 rsg~p~~~~~~~~~~~~~~~~~~~~~~af~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  917 (927)
                      +|                       |+||+.||+|.+.+++  |  ||.+|.|||||+..+.+..
T Consensus      1051 qs-----------------------gaafr~rrk~~prq~~--~--r~g~l~rsrsrh~~a~gql 1088 (1102)
T KOG1924|consen 1051 QS-----------------------GAAFRTRRKRLPRQTR--G--RRGCLDRSRSRHQNALGQL 1088 (1102)
T ss_pred             Hh-----------------------hccccCcccccCCCCc--c--cccchhhhhHhhhhhhhHH
Confidence            99                       9999988887643322  2  9999999999988776543



>KOG1923|consensus Back     alignment and domain information
>KOG1924|consensus Back     alignment and domain information
>smart00498 FH2 Formin Homology 2 Domain Back     alignment and domain information
>PF02181 FH2: Formin Homology 2 Domain; InterPro: IPR015425 Formin homology (FH) proteins play a crucial role in the reorganisation of the actin cytoskeleton, which mediates various functions of the cell cortex including motility, adhesion, and cytokinesis [] Back     alignment and domain information
>PF06367 Drf_FH3: Diaphanous FH3 Domain; InterPro: IPR010472 Formin homology (FH) proteins play a crucial role in the reorganisation of the actin cytoskeleton, which mediates various functions of the cell cortex including motility, adhesion, and cytokinesis [] Back     alignment and domain information
>PF06371 Drf_GBD: Diaphanous GTPase-binding Domain; InterPro: IPR010473 Diaphanous-related formins (Drfs) are a family of formin homology (FH) proteins that act as effectors of Rho small GTPases during growth factor-induced cytoskeletal remodelling, stress fibre formation, and cell division [] Back     alignment and domain information
>KOG1925|consensus Back     alignment and domain information
>KOG1922|consensus Back     alignment and domain information
>PF06371 Drf_GBD: Diaphanous GTPase-binding Domain; InterPro: IPR010473 Diaphanous-related formins (Drfs) are a family of formin homology (FH) proteins that act as effectors of Rho small GTPases during growth factor-induced cytoskeletal remodelling, stress fibre formation, and cell division [] Back     alignment and domain information
>PF11841 DUF3361: Domain of unknown function (DUF3361) Back     alignment and domain information
>PF06345 Drf_DAD: DRF Autoregulatory Domain; InterPro: IPR010465 This domain is found in Diaphanous-related formins (Drfs) Back     alignment and domain information
>KOG1923|consensus Back     alignment and domain information
>KOG0212|consensus Back     alignment and domain information
>KOG2391|consensus Back     alignment and domain information
>PHA03247 large tegument protein UL36; Provisional Back     alignment and domain information
>KOG4849|consensus Back     alignment and domain information
>PRK13729 conjugal transfer pilus assembly protein TraB; Provisional Back     alignment and domain information
>KOG3671|consensus Back     alignment and domain information
>PHA03247 large tegument protein UL36; Provisional Back     alignment and domain information
>KOG1925|consensus Back     alignment and domain information
>smart00498 FH2 Formin Homology 2 Domain Back     alignment and domain information
>PF05308 Mito_fiss_reg: Mitochondrial fission regulator; InterPro: IPR007972 This family consists of several uncharacterised eukaryotic proteins of unknown function Back     alignment and domain information
>KOG0132|consensus Back     alignment and domain information
>PF05004 IFRD: Interferon-related developmental regulator (IFRD); InterPro: IPR007701 Interferon-related developmental regulator (IFRD1) is the human homologue of the Rattus norvegicus early response protein PC4 and its murine homologue TIS7 [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query927
3eg5_B383 Crystal Structure Of Mdia1-Tsh Gbd-Fh3 In Complex W 8e-78
1z2c_B383 Crystal Structure Of Mdia1 Gbd-Fh3 In Complex With 8e-77
2bnx_A386 Crystal Structure Of The Dimeric Regulatory Domain 1e-73
3obv_A327 Autoinhibited Formin Mdia1 Structure Length = 327 5e-69
3o4x_A330 Crystal Structure Of Complex Between Amino And Carb 5e-69
2bap_B317 Crystal Structure Of The N-Terminal Mdia1 Armadillo 1e-67
3obv_E457 Autoinhibited Formin Mdia1 Structure Length = 457 1e-52
3o4x_E467 Crystal Structure Of Complex Between Amino And Carb 2e-52
1v9d_A340 Crystal Structure Of The Core Fh2 Domain Of Mouse M 8e-46
2f31_A233 Crystal Structure Of The Autoinhibitory Switch In F 7e-43
2z6e_A419 Crystal Structure Of Human Daam1 Fh2 Length = 419 2e-16
2j1d_G483 Crystallization Of Hdaam1 C-Terminal Fragment Lengt 2e-16
4eah_A402 Crystal Structure Of The Formin Homology 2 Domain O 8e-11
1y64_B443 Bni1p Formin Homology 2 Domain Complexed With Atp-a 5e-07
1ux5_A411 Crystal Structures Of A Formin Homology-2 Domain Re 7e-07
1ux4_A410 Crystal Structures Of A Formin Homology-2 Domain Re 8e-07
>pdb|3EG5|B Chain B, Crystal Structure Of Mdia1-Tsh Gbd-Fh3 In Complex With Cdc42-Gmppnp Length = 383 Back     alignment and structure

Iteration: 1

Score = 288 bits (738), Expect = 8e-78, Method: Compositional matrix adjust. Identities = 156/410 (38%), Positives = 245/410 (59%), Gaps = 36/410 (8%) Query: 75 LEKLNPEQLNQKFEDMLNDMNLSDEKKEPLRRQPLANKKKMLLMHYKGTVTSYENKSKFD 134 L+ ++ EQ+ FE ML DMNL++EK++PLR + + K++M+ + + K Sbjct: 7 LQDISDEQVLVLFEQMLVDMNLNEEKQQPLREKDIVIKREMVSQYLHTSKAGMNQKESSR 66 Query: 135 KPIEYIQYLSQPELSVNKMYSCIESLRIALTNHPLSWVNEFVLQDNKNFRKYPIAFLYPR 194 + YIQ L + L + SC+ESLR++LT+HP+SWV F + + + L Sbjct: 67 SAMMYIQEL-RSGLRDMHLLSCLESLRVSLTSHPVSWVQTFGAEGLASL----LDILKRL 121 Query: 195 FPSRSRNDSRYD-RVQYECVRCIRAIMNNTVGLKQMFGQKEALTIVARSLDPNKPTVMLE 253 + YD R Q+E +RC++A MNN G+K M +E + ++ R++DP P +M++ Sbjct: 122 HDEKEETSGNYDSRNQHEIIRCLKAFMNNKFGIKTMLETEEGILLLVRAMDPAVPNMMID 181 Query: 254 AVKVLAAVCLIP--PDGHDKVIKAITMSGELKGKERFQPVVQGLMVKGNNEALRTACLQL 311 A K+L+A+C++P D +++V++A+T E+ ERFQP++ GL G + AL+ CLQL Sbjct: 182 AAKLLSALCILPQPEDMNERVLEAMTERAEMDEVERFQPLLDGLK-SGTSIALKVGCLQL 240 Query: 312 INAIVATPDDLEFRLHLRNEIMRVGLYDLLDALEKDASEDVSVQLKVFIEHKEEDYYEFI 371 INA++ ++L+FR+H+R+E+MR+GL+ +L L + +ED+ VQL VF E +ED+++ Sbjct: 241 INALITPAEELDFRVHIRSELMRLGLHQVLQELREIENEDMKVQLCVFDEQGDEDFFDLK 300 Query: 372 QRFDNVRMEIDDVNDCFETVRNMVMDSACEPYLLSILQHLLFIRDDQNMVMDSACEPYLL 431 R D++RME+DD + F+ + N V DS EP+ LSILQHLL +R+D Sbjct: 301 GRLDDIRMEMDDFGEVFQIILNTVKDSKAEPHFLSILQHLLLVRNDYE------------ 348 Query: 432 SILQHLLFIRDDQYVRLAYYKLLEECVSQIVLHRGGCDPDFRSSRRFQLD 481 R YYKL+EECVSQIVLH+ G DPDF+ R Q+D Sbjct: 349 --------------ARPQYYKLIEECVSQIVLHKNGTDPDFK-CRHLQID 383
>pdb|1Z2C|B Chain B, Crystal Structure Of Mdia1 Gbd-Fh3 In Complex With Rhoc- Gmppnp Length = 383 Back     alignment and structure
>pdb|2BNX|A Chain A, Crystal Structure Of The Dimeric Regulatory Domain Of Mouse Diaphaneous-Related Formin (Drf), Mdia1 Length = 386 Back     alignment and structure
>pdb|3OBV|A Chain A, Autoinhibited Formin Mdia1 Structure Length = 327 Back     alignment and structure
>pdb|3O4X|A Chain A, Crystal Structure Of Complex Between Amino And Carboxy Terminal Fragments Of Mdia1 Length = 330 Back     alignment and structure
>pdb|2BAP|B Chain B, Crystal Structure Of The N-Terminal Mdia1 Armadillo Repeat Region And Dimerisation Domain In Complex With The Mdia1 Autoregulatory Domain (Dad) Length = 317 Back     alignment and structure
>pdb|3OBV|E Chain E, Autoinhibited Formin Mdia1 Structure Length = 457 Back     alignment and structure
>pdb|3O4X|E Chain E, Crystal Structure Of Complex Between Amino And Carboxy Terminal Fragments Of Mdia1 Length = 467 Back     alignment and structure
>pdb|1V9D|A Chain A, Crystal Structure Of The Core Fh2 Domain Of Mouse Mdia1 Length = 340 Back     alignment and structure
>pdb|2F31|A Chain A, Crystal Structure Of The Autoinhibitory Switch In Formin Mdia1; The DidDAD COMPLEX Length = 233 Back     alignment and structure
>pdb|2Z6E|A Chain A, Crystal Structure Of Human Daam1 Fh2 Length = 419 Back     alignment and structure
>pdb|2J1D|G Chain G, Crystallization Of Hdaam1 C-Terminal Fragment Length = 483 Back     alignment and structure
>pdb|4EAH|A Chain A, Crystal Structure Of The Formin Homology 2 Domain Of Fmnl3 Bound To Actin Length = 402 Back     alignment and structure
>pdb|1Y64|B Chain B, Bni1p Formin Homology 2 Domain Complexed With Atp-actin Length = 443 Back     alignment and structure
>pdb|1UX5|A Chain A, Crystal Structures Of A Formin Homology-2 Domain Reveal A Flexibly Tethered Dimer Architecture Length = 411 Back     alignment and structure
>pdb|1UX4|A Chain A, Crystal Structures Of A Formin Homology-2 Domain Reveal A Tethered-Dimer Architecture Length = 410 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query927
3eg5_B383 Protein diaphanous homolog 1; protein-protein comp 8e-87
3eg5_B383 Protein diaphanous homolog 1; protein-protein comp 2e-09
3obv_E457 Protein diaphanous homolog 1; autoinhibition, acti 3e-79
2j1d_G483 DAAM1, disheveled-associated activator of morphoge 2e-72
1v9d_A340 Diaphanous protein homolog 1; helix bundle, protei 9e-71
2bnx_A386 Diaphanous protein homolog 1; autoinhibition, acti 1e-70
1ux5_A411 BNI1 protein; structural protein, FH2 actin cytosk 7e-61
2f31_A233 Diaphanous protein homolog 1; formin,MDIA1, protei 1e-52
3dad_A339 FH1/FH2 domain-containing protein 1; formin, FHOD1 3e-23
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-17
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-13
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-05
3pgw_B231 SM B; protein-RNA complex, U1 snRNA, SM fold, SM c 2e-08
3pgw_B231 SM B; protein-RNA complex, U1 snRNA, SM fold, SM c 2e-08
3pgw_B231 SM B; protein-RNA complex, U1 snRNA, SM fold, SM c 2e-08
3pgw_B231 SM B; protein-RNA complex, U1 snRNA, SM fold, SM c 4e-08
3pgw_B231 SM B; protein-RNA complex, U1 snRNA, SM fold, SM c 5e-08
3pgw_B231 SM B; protein-RNA complex, U1 snRNA, SM fold, SM c 1e-07
3pgw_B231 SM B; protein-RNA complex, U1 snRNA, SM fold, SM c 2e-07
3pgw_B231 SM B; protein-RNA complex, U1 snRNA, SM fold, SM c 2e-07
3pgw_B231 SM B; protein-RNA complex, U1 snRNA, SM fold, SM c 3e-07
3pgw_B231 SM B; protein-RNA complex, U1 snRNA, SM fold, SM c 5e-07
3pgw_B231 SM B; protein-RNA complex, U1 snRNA, SM fold, SM c 6e-07
3pgw_B231 SM B; protein-RNA complex, U1 snRNA, SM fold, SM c 7e-07
3pgw_B231 SM B; protein-RNA complex, U1 snRNA, SM fold, SM c 8e-07
3pgw_B231 SM B; protein-RNA complex, U1 snRNA, SM fold, SM c 3e-06
3pgw_B231 SM B; protein-RNA complex, U1 snRNA, SM fold, SM c 4e-06
3pgw_B231 SM B; protein-RNA complex, U1 snRNA, SM fold, SM c 8e-06
3pgw_B231 SM B; protein-RNA complex, U1 snRNA, SM fold, SM c 8e-06
1ei8_A29 Collagen-like peptide (Pro-HYP-Gly)4-PG-(Pro-HYP- 1e-07
1ei8_A29 Collagen-like peptide (Pro-HYP-Gly)4-PG-(Pro-HYP- 2e-06
1ei8_A29 Collagen-like peptide (Pro-HYP-Gly)4-PG-(Pro-HYP- 3e-04
1cag_A30 Collagen-like peptide; 1.85A {} SCOP: k.3.1.1 PDB: 3e-07
1cag_A30 Collagen-like peptide; 1.85A {} SCOP: k.3.1.1 PDB: 2e-06
1cag_A30 Collagen-like peptide; 1.85A {} SCOP: k.3.1.1 PDB: 1e-04
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 3e-07
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 5e-07
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 9e-07
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 1e-06
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 1e-06
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 1e-06
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 2e-06
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 2e-06
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 2e-06
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 2e-06
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 2e-06
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 2e-06
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 2e-06
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 2e-06
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 2e-06
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 2e-06
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 2e-06
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 2e-06
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 3e-06
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 3e-06
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 3e-06
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 3e-06
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 3e-06
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 4e-06
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 4e-06
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 4e-06
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 4e-06
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 4e-06
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 4e-06
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 4e-06
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 4e-06
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 4e-06
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 4e-06
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 4e-06
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 5e-06
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 5e-06
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 5e-06
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 5e-06
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 5e-06
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 5e-06
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 6e-06
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 6e-06
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 7e-06
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 7e-06
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 7e-06
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 7e-06
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 7e-06
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 8e-06
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 8e-06
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 8e-06
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 8e-06
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 9e-06
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 9e-06
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 1e-05
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 1e-05
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 1e-05
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 1e-05
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 1e-05
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 1e-05
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 1e-05
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 1e-05
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 1e-05
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 1e-05
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 2e-05
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 2e-05
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 2e-05
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 2e-05
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 2e-05
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 2e-05
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 2e-05
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 2e-05
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 2e-05
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 2e-05
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 2e-05
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 2e-05
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 2e-05
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 2e-05
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 2e-05
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 2e-05
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 2e-05
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 3e-05
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 3e-05
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 3e-05
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 3e-05
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 3e-05
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 3e-05
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 3e-05
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 3e-05
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 3e-05
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 3e-05
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 4e-05
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 4e-05
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 4e-05
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 4e-05
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 4e-05
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 4e-05
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 4e-05
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 4e-05
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 4e-05
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 4e-05
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 5e-05
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 5e-05
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 5e-05
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 5e-05
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 5e-05
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 5e-05
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 6e-05
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 7e-05
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 7e-05
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 7e-05
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 1e-04
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 1e-04
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 1e-04
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 1e-04
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 1e-04
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 1e-04
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 1e-04
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 2e-04
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 2e-04
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 2e-04
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 2e-04
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 2e-04
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 2e-04
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 2e-04
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 3e-04
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 3e-04
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 3e-04
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 4e-04
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 7e-04
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 9e-04
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 3e-07
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 4e-07
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 4e-07
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 5e-07
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 8e-07
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 1e-06
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 1e-06
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 1e-06
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 1e-06
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 2e-06
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 2e-06
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 2e-06
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 2e-06
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 2e-06
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 3e-06
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 3e-06
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 3e-06
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 3e-06
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 3e-06
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 3e-06
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 3e-06
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 3e-06
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 3e-06
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 3e-06
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 4e-06
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 4e-06
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 5e-06
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 5e-06
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 5e-06
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 5e-06
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 5e-06
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 6e-06
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 6e-06
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 6e-06
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 6e-06
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 6e-06
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 6e-06
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 7e-06
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 8e-06
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 8e-06
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 8e-06
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 9e-06
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 9e-06
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 9e-06
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 9e-06
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 9e-06
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 9e-06
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 1e-05
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 1e-05
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 1e-05
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 1e-05
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 1e-05
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 1e-05
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 1e-05
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 1e-05
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 1e-05
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 1e-05
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 1e-05
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 1e-05
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 1e-05
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 1e-05
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 1e-05
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 2e-05
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 2e-05
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 2e-05
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 2e-05
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 2e-05
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 2e-05
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 2e-05
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 2e-05
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 2e-05
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 2e-05
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 2e-05
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 2e-05
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 2e-05
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 3e-05
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 3e-05
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 3e-05
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 3e-05
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 3e-05
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 3e-05
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 3e-05
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 3e-05
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 3e-05
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 3e-05
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 3e-05
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 3e-05
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 3e-05
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 4e-05
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 4e-05
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 4e-05
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 4e-05
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 4e-05
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 5e-05
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 5e-05
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 5e-05
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 5e-05
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 6e-05
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 6e-05
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 6e-05
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 6e-05
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 6e-05
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 6e-05
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 6e-05
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 6e-05
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 6e-05
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 7e-05
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 7e-05
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 7e-05
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 8e-05
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 8e-05
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 8e-05
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 9e-05
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 1e-04
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 1e-04
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 1e-04
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 1e-04
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 1e-04
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 1e-04
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 1e-04
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 2e-04
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 2e-04
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 2e-04
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 2e-04
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 2e-04
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 2e-04
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 2e-04
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 2e-04
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 4e-04
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 4e-04
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 5e-04
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 5e-04
3q2s_C229 Cleavage and polyadenylation specificity factor S; 7e-07
3q2s_C229 Cleavage and polyadenylation specificity factor S; 1e-04
3q2s_C229 Cleavage and polyadenylation specificity factor S; 2e-04
3pod_A26 MBL collagen-like peptide; collagen peptide, compl 7e-07
3pon_A29 MBL collagen-like peptide; collagen peptide, MBL c 8e-07
3pon_A29 MBL collagen-like peptide; collagen peptide, MBL c 3e-05
2kpy_A108 Major pollen allergen ART V 1; defensin-like, poly 8e-07
2kpy_A108 Major pollen allergen ART V 1; defensin-like, poly 2e-05
3a0m_A27 Collagen-like peptide; triple-helix, model peptide 3e-06
3a0m_A27 Collagen-like peptide; triple-helix, model peptide 2e-05
3a0m_A27 Collagen-like peptide; triple-helix, model peptide 2e-04
3a1h_A27 Collagen-like peptide; collagen helix, HOST-guest 5e-06
3a1h_A27 Collagen-like peptide; collagen helix, HOST-guest 1e-05
3a1h_A27 Collagen-like peptide; collagen helix, HOST-guest 2e-04
1dx0_A219 Prion protein; brain, repeat; NMR {Bos taurus} SCO 5e-06
1dx0_A219 Prion protein; brain, repeat; NMR {Bos taurus} SCO 3e-05
1dx0_A219 Prion protein; brain, repeat; NMR {Bos taurus} SCO 3e-05
1dx0_A219 Prion protein; brain, repeat; NMR {Bos taurus} SCO 4e-05
1dx0_A219 Prion protein; brain, repeat; NMR {Bos taurus} SCO 9e-05
1dx0_A219 Prion protein; brain, repeat; NMR {Bos taurus} SCO 9e-05
1dx0_A219 Prion protein; brain, repeat; NMR {Bos taurus} SCO 2e-04
1dx0_A219 Prion protein; brain, repeat; NMR {Bos taurus} SCO 4e-04
1dx0_A219 Prion protein; brain, repeat; NMR {Bos taurus} SCO 5e-04
1dx0_A219 Prion protein; brain, repeat; NMR {Bos taurus} SCO 6e-04
1dx0_A219 Prion protein; brain, repeat; NMR {Bos taurus} SCO 7e-04
1dx0_A219 Prion protein; brain, repeat; NMR {Bos taurus} SCO 8e-04
4dmu_A87 Collagen III derived triple-helical peptide; dinuc 6e-06
4dmu_A87 Collagen III derived triple-helical peptide; dinuc 6e-06
4dmu_A87 Collagen III derived triple-helical peptide; dinuc 1e-05
4dmu_A87 Collagen III derived triple-helical peptide; dinuc 1e-04
4dmu_A87 Collagen III derived triple-helical peptide; dinuc 7e-04
3adm_A27 Collagen-like peptide; triple helix, model peptide 7e-06
3adm_A27 Collagen-like peptide; triple helix, model peptide 1e-05
3adm_A27 Collagen-like peptide; triple helix, model peptide 2e-04
1qsu_A30 Protein ((Pro-HYP-Gly)4- Glu-Lys-Gly(Pro-HYP- Gly) 8e-06
3ah9_A27 Collagen-like peptide; triple helix, model peptide 1e-05
3dmw_A42 Collagen alpha-1(III) chain; collagen III, cystine 1e-05
3dmw_A42 Collagen alpha-1(III) chain; collagen III, cystine 3e-04
3abn_A27 Collagen-like peptide; collagen-helix, structural 1e-05
3abn_A27 Collagen-like peptide; collagen-helix, structural 2e-05
3abn_A27 Collagen-like peptide; collagen-helix, structural 2e-04
4auo_C40 Triple-helical collagen peptide; hydrolase-peptide 2e-05
4auo_C40 Triple-helical collagen peptide; hydrolase-peptide 8e-05
2pne_A81 6.5 kDa glycine-rich antifreeze protein; chemical 2e-05
2pne_A81 6.5 kDa glycine-rich antifreeze protein; chemical 6e-04
2pne_A81 6.5 kDa glycine-rich antifreeze protein; chemical 7e-04
2pne_A81 6.5 kDa glycine-rich antifreeze protein; chemical 9e-04
2f6a_E30 Collagen; CNA, mscramm, adhesion, ECM, cell adhesi 2e-05
2f6a_E30 Collagen; CNA, mscramm, adhesion, ECM, cell adhesi 3e-05
2y5t_F38 C1; immune system, antibody, rheumatoid arthritis; 3e-05
1deq_A390 Fibrinogen (alpha chain); coiled-coil, blood clott 6e-05
1deq_A390 Fibrinogen (alpha chain); coiled-coil, blood clott 8e-05
1deq_A390 Fibrinogen (alpha chain); coiled-coil, blood clott 2e-04
1deq_A390 Fibrinogen (alpha chain); coiled-coil, blood clott 4e-04
1deq_A390 Fibrinogen (alpha chain); coiled-coil, blood clott 4e-04
1deq_A390 Fibrinogen (alpha chain); coiled-coil, blood clott 4e-04
1deq_A390 Fibrinogen (alpha chain); coiled-coil, blood clott 5e-04
1deq_A390 Fibrinogen (alpha chain); coiled-coil, blood clott 5e-04
1deq_A390 Fibrinogen (alpha chain); coiled-coil, blood clott 5e-04
1deq_A390 Fibrinogen (alpha chain); coiled-coil, blood clott 5e-04
2v8f_C26 MDIA1, profilin IIA; alternative splicing, protein 1e-04
2v8f_C26 MDIA1, profilin IIA; alternative splicing, protein 4e-04
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 1e-04
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 1e-04
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 2e-04
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 2e-04
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 2e-04
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 3e-04
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 4e-04
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 8e-04
4dmt_A32 Collagen III derived peptide; collagen triple heli 1e-04
3b0s_A27 Collagen-like peptide; triple helix, structural pr 1e-04
2y5t_E34 C1; immune system, antibody, rheumatoid arthritis; 2e-04
1nay_A56 CCP4, collagen-like peptide; collagen assembly, st 3e-04
3u29_A26 Triple helical peptide; triple helix, biosynthetic 3e-04
3t4f_A26 Collagen mimetic peptide; triple helix, biosynthet 3e-04
1x1k_F30 HOST-guest peptide (Pro-Pro-Gly)4-(Pro-allohyp- Gl 4e-04
1bkv_A30 T3-785; collagen, hydroxyproline, hydrogen bonding 5e-04
2g66_A31 Collagen; 3(S)hydroxyproline, 4(R)hydroxyproline, 7e-04
>3eg5_B Protein diaphanous homolog 1; protein-protein complex, RHO proteins, formins, armadillo repeat, G-protein, GTPase, alternative splicing; HET: GNP; 2.70A {Mus musculus} PDB: 1z2c_B* Length = 383 Back     alignment and structure
 Score =  282 bits (721), Expect = 8e-87
 Identities = 155/412 (37%), Positives = 244/412 (59%), Gaps = 34/412 (8%)

Query: 72  ENMLEKLNPEQLNQKFEDMLNDMNLSDEKKEPLRRQPLANKKKMLLMHYKGTVTSYENKS 131
              L+ ++ EQ+   FE ML DMNL++EK++PLR + +  K++M+  +   +      K 
Sbjct: 4   AQSLQDISDEQVLVLFEQMLVDMNLNEEKQQPLREKDIVIKREMVSQYLHTSKAGMNQKE 63

Query: 132 KFDKPIEYIQYLSQPELSVNKMYSCIESLRIALTNHPLSWVNEFVLQDNKNFRKYPIAFL 191
                + YIQ L +  L    + SC+ESLR++LT+HP+SWV  F  +   +         
Sbjct: 64  SSRSAMMYIQEL-RSGLRDMHLLSCLESLRVSLTSHPVSWVQTFGAEGLASLLDILKRLH 122

Query: 192 YPRFPSRSRNDSRYDRVQYECVRCIRAIMNNTVGLKQMFGQKEALTIVARSLDPNKPTVM 251
             +  +    DSR    Q+E +RC++A MNN  G+K M   +E + ++ R++DP  P +M
Sbjct: 123 DEKEETSGNYDSR---NQHEIIRCLKAFMNNKFGIKTMLETEEGILLLVRAMDPAVPNMM 179

Query: 252 LEAVKVLAAVCLI--PPDGHDKVIKAITMSGELKGKERFQPVVQGLMVKGNNEALRTACL 309
           ++A K+L+A+C++  P D +++V++A+T   E+   ERFQP++ GL   G + AL+  CL
Sbjct: 180 IDAAKLLSALCILPQPEDMNERVLEAMTERAEMDEVERFQPLLDGLK-SGTSIALKVGCL 238

Query: 310 QLINAIVATPDDLEFRLHLRNEIMRVGLYDLLDALEKDASEDVSVQLKVFIEHKEEDYYE 369
           QLINA++   ++L+FR+H+R+E+MR+GL+ +L  L +  +ED+ VQL VF E  +ED+++
Sbjct: 239 QLINALITPAEELDFRVHIRSELMRLGLHQVLQELREIENEDMKVQLCVFDEQGDEDFFD 298

Query: 370 FIQRFDNVRMEIDDVNDCFETVRNMVMDSACEPYLLSILQHLLFIRDDQNMVMDSACEPY 429
              R D++RME+DD  + F+ + N V DS  EP+ LSILQHLL +R+D            
Sbjct: 299 LKGRLDDIRMEMDDFGEVFQIILNTVKDSKAEPHFLSILQHLLLVRNDYEA--------- 349

Query: 430 LLSILQHLLFIRDDQYVRLAYYKLLEECVSQIVLHRGGCDPDFRSSRRFQLD 481
                            R  YYKL+EECVSQIVLH+ G DPDF+  R  Q+D
Sbjct: 350 -----------------RPQYYKLIEECVSQIVLHKNGTDPDFK-CRHLQID 383


>3eg5_B Protein diaphanous homolog 1; protein-protein complex, RHO proteins, formins, armadillo repeat, G-protein, GTPase, alternative splicing; HET: GNP; 2.70A {Mus musculus} PDB: 1z2c_B* Length = 383 Back     alignment and structure
>3obv_E Protein diaphanous homolog 1; autoinhibition, actin, nucleation, cytoskeleton, structural; HET: SUC; 2.75A {Mus musculus} PDB: 3o4x_E 2bap_D Length = 457 Back     alignment and structure
>2j1d_G DAAM1, disheveled-associated activator of morphogenesis; actin assembly, protein binding; 2.55A {Homo sapiens} PDB: 2z6e_A Length = 483 Back     alignment and structure
>1v9d_A Diaphanous protein homolog 1; helix bundle, protein binding; 2.60A {Mus musculus} SCOP: a.207.1.1 Length = 340 Back     alignment and structure
>2bnx_A Diaphanous protein homolog 1; autoinhibition, actin, nucleation, cytoskeleton, structural; 2.4A {Mus musculus} SCOP: a.118.1.23 PDB: 3o4x_A 3obv_A* 2bap_B Length = 386 Back     alignment and structure
>1ux5_A BNI1 protein; structural protein, FH2 actin cytoskeleton; 2.5A {Saccharomyces cerevisiae} SCOP: a.207.1.1 PDB: 1y64_B* 1ux4_A Length = 411 Back     alignment and structure
>2f31_A Diaphanous protein homolog 1; formin,MDIA1, protein-protein complex, armadillo repeats, structural protein; 2.10A {Mus musculus} Length = 233 Back     alignment and structure
>3dad_A FH1/FH2 domain-containing protein 1; formin, FHOD1, GTPase-binding domain, ubiquitin-superfold, armadillo repeats, actin-binding, coiled coil; 2.30A {Homo sapiens} Length = 339 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 Back     alignment and structure
>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 Back     alignment and structure
>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 Back     alignment and structure
>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 Back     alignment and structure
>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 Back     alignment and structure
>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 Back     alignment and structure
>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 Back     alignment and structure
>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 Back     alignment and structure
>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 Back     alignment and structure
>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 Back     alignment and structure
>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 Back     alignment and structure
>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 Back     alignment and structure
>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 Back     alignment and structure
>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 Back     alignment and structure
>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 Back     alignment and structure
>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 Back     alignment and structure
>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 Back     alignment and structure
>1ei8_A Collagen-like peptide (Pro-HYP-Gly)4-PG-(Pro-HYP- Gly)5; triple helix, contractIle protein; 2.00A {Synthetic} SCOP: k.3.1.1 Length = 29 Back     alignment and structure
>1ei8_A Collagen-like peptide (Pro-HYP-Gly)4-PG-(Pro-HYP- Gly)5; triple helix, contractIle protein; 2.00A {Synthetic} SCOP: k.3.1.1 Length = 29 Back     alignment and structure
>1ei8_A Collagen-like peptide (Pro-HYP-Gly)4-PG-(Pro-HYP- Gly)5; triple helix, contractIle protein; 2.00A {Synthetic} SCOP: k.3.1.1 Length = 29 Back     alignment and structure
>1cag_A Collagen-like peptide; 1.85A {} SCOP: k.3.1.1 PDB: 1cgd_A Length = 30 Back     alignment and structure
>1cag_A Collagen-like peptide; 1.85A {} SCOP: k.3.1.1 PDB: 1cgd_A Length = 30 Back     alignment and structure
>1cag_A Collagen-like peptide; 1.85A {} SCOP: k.3.1.1 PDB: 1cgd_A Length = 30 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 Back     alignment and structure
>3pod_A MBL collagen-like peptide; collagen peptide, complement proteins, lectin pathway of COM MAsp-1 CUB1 and CUB2 domains, bloodstream, unknown function; 1.50A {Synthetic} Length = 26 Back     alignment and structure
>3pon_A MBL collagen-like peptide; collagen peptide, MBL collagen-like region, complement prote lectin pathway of complement; 1.50A {Synthetic} PDB: 3pob_B Length = 29 Back     alignment and structure
>3pon_A MBL collagen-like peptide; collagen peptide, MBL collagen-like region, complement prote lectin pathway of complement; 1.50A {Synthetic} PDB: 3pob_B Length = 29 Back     alignment and structure
>2kpy_A Major pollen allergen ART V 1; defensin-like, poly-proline; NMR {Artemisia vulgaris} Length = 108 Back     alignment and structure
>2kpy_A Major pollen allergen ART V 1; defensin-like, poly-proline; NMR {Artemisia vulgaris} Length = 108 Back     alignment and structure
>3a0m_A Collagen-like peptide; triple-helix, model peptide, twinned crystal, STRU protein; 1.02A {Synthetic} Length = 27 Back     alignment and structure
>3a0m_A Collagen-like peptide; triple-helix, model peptide, twinned crystal, STRU protein; 1.02A {Synthetic} Length = 27 Back     alignment and structure
>3a0m_A Collagen-like peptide; triple-helix, model peptide, twinned crystal, STRU protein; 1.02A {Synthetic} Length = 27 Back     alignment and structure
>3a1h_A Collagen-like peptide; collagen helix, HOST-guest peptide, twinned crystal, structu protein; 1.08A {Synthetic} Length = 27 Back     alignment and structure
>3a1h_A Collagen-like peptide; collagen helix, HOST-guest peptide, twinned crystal, structu protein; 1.08A {Synthetic} Length = 27 Back     alignment and structure
>3a1h_A Collagen-like peptide; collagen helix, HOST-guest peptide, twinned crystal, structu protein; 1.08A {Synthetic} Length = 27 Back     alignment and structure
>1dx0_A Prion protein; brain, repeat; NMR {Bos taurus} SCOP: d.6.1.1 PDB: 1dx1_A 1qlx_A 1qlz_A Length = 219 Back     alignment and structure
>1dx0_A Prion protein; brain, repeat; NMR {Bos taurus} SCOP: d.6.1.1 PDB: 1dx1_A 1qlx_A 1qlz_A Length = 219 Back     alignment and structure
>1dx0_A Prion protein; brain, repeat; NMR {Bos taurus} SCOP: d.6.1.1 PDB: 1dx1_A 1qlx_A 1qlz_A Length = 219 Back     alignment and structure
>1dx0_A Prion protein; brain, repeat; NMR {Bos taurus} SCOP: d.6.1.1 PDB: 1dx1_A 1qlx_A 1qlz_A Length = 219 Back     alignment and structure
>1dx0_A Prion protein; brain, repeat; NMR {Bos taurus} SCOP: d.6.1.1 PDB: 1dx1_A 1qlx_A 1qlz_A Length = 219 Back     alignment and structure
>1dx0_A Prion protein; brain, repeat; NMR {Bos taurus} SCOP: d.6.1.1 PDB: 1dx1_A 1qlx_A 1qlz_A Length = 219 Back     alignment and structure
>1dx0_A Prion protein; brain, repeat; NMR {Bos taurus} SCOP: d.6.1.1 PDB: 1dx1_A 1qlx_A 1qlz_A Length = 219 Back     alignment and structure
>1dx0_A Prion protein; brain, repeat; NMR {Bos taurus} SCOP: d.6.1.1 PDB: 1dx1_A 1qlx_A 1qlz_A Length = 219 Back     alignment and structure
>1dx0_A Prion protein; brain, repeat; NMR {Bos taurus} SCOP: d.6.1.1 PDB: 1dx1_A 1qlx_A 1qlz_A Length = 219 Back     alignment and structure
>1dx0_A Prion protein; brain, repeat; NMR {Bos taurus} SCOP: d.6.1.1 PDB: 1dx1_A 1qlx_A 1qlz_A Length = 219 Back     alignment and structure
>1dx0_A Prion protein; brain, repeat; NMR {Bos taurus} SCOP: d.6.1.1 PDB: 1dx1_A 1qlx_A 1qlz_A Length = 219 Back     alignment and structure
>1dx0_A Prion protein; brain, repeat; NMR {Bos taurus} SCOP: d.6.1.1 PDB: 1dx1_A 1qlx_A 1qlz_A Length = 219 Back     alignment and structure
>4dmu_A Collagen III derived triple-helical peptide; dinucleotide binding fold, collagen binding, platelet activa hemostasis, plasma, structural protein-protein binding COMP; 2.80A {Synthetic} Length = 87 Back     alignment and structure
>4dmu_A Collagen III derived triple-helical peptide; dinucleotide binding fold, collagen binding, platelet activa hemostasis, plasma, structural protein-protein binding COMP; 2.80A {Synthetic} Length = 87 Back     alignment and structure
>4dmu_A Collagen III derived triple-helical peptide; dinucleotide binding fold, collagen binding, platelet activa hemostasis, plasma, structural protein-protein binding COMP; 2.80A {Synthetic} Length = 87 Back     alignment and structure
>4dmu_A Collagen III derived triple-helical peptide; dinucleotide binding fold, collagen binding, platelet activa hemostasis, plasma, structural protein-protein binding COMP; 2.80A {Synthetic} Length = 87 Back     alignment and structure
>4dmu_A Collagen III derived triple-helical peptide; dinucleotide binding fold, collagen binding, platelet activa hemostasis, plasma, structural protein-protein binding COMP; 2.80A {Synthetic} Length = 87 Back     alignment and structure
>3adm_A Collagen-like peptide; triple helix, model peptide, structural protein; HET: HYP; 1.18A {Synthetic} Length = 27 Back     alignment and structure
>3adm_A Collagen-like peptide; triple helix, model peptide, structural protein; HET: HYP; 1.18A {Synthetic} Length = 27 Back     alignment and structure
>3adm_A Collagen-like peptide; triple helix, model peptide, structural protein; HET: HYP; 1.18A {Synthetic} Length = 27 Back     alignment and structure
>1qsu_A Protein ((Pro-HYP-Gly)4- Glu-Lys-Gly(Pro-HYP- Gly)5); triple helix, structural protein; 1.75A {Synthetic} SCOP: k.3.1.1 Length = 30 Back     alignment and structure
>3ah9_A Collagen-like peptide; triple helix, model peptide, structural protein; 1.08A {Synthetic} PDB: 2cuo_A 2d3f_A 2d3h_A 3a19_A 1x1k_A 3ai6_A* Length = 27 Back     alignment and structure
>3dmw_A Collagen alpha-1(III) chain; collagen III, cystine knot, triple helix, glycine, MAD phasing, alternative splicing, disease mutation; 2.30A {Synthetic} Length = 42 Back     alignment and structure
>3dmw_A Collagen alpha-1(III) chain; collagen III, cystine knot, triple helix, glycine, MAD phasing, alternative splicing, disease mutation; 2.30A {Synthetic} Length = 42 Back     alignment and structure
>3abn_A Collagen-like peptide; collagen-helix, structural protein; HET: HYP; 1.02A {Synthetic} Length = 27 Back     alignment and structure
>3abn_A Collagen-like peptide; collagen-helix, structural protein; HET: HYP; 1.02A {Synthetic} Length = 27 Back     alignment and structure
>3abn_A Collagen-like peptide; collagen-helix, structural protein; HET: HYP; 1.02A {Synthetic} Length = 27 Back     alignment and structure
>4auo_C Triple-helical collagen peptide; hydrolase-peptide complex; 3.00A {Synthetic construct} Length = 40 Back     alignment and structure
>4auo_C Triple-helical collagen peptide; hydrolase-peptide complex; 3.00A {Synthetic construct} Length = 40 Back     alignment and structure
>2pne_A 6.5 kDa glycine-rich antifreeze protein; chemical protein synthesis, native chemical ligation; 0.98A {Synthetic} PDB: 3boi_A 3bog_A* 3bog_C* Length = 81 Back     alignment and structure
>2pne_A 6.5 kDa glycine-rich antifreeze protein; chemical protein synthesis, native chemical ligation; 0.98A {Synthetic} PDB: 3boi_A 3bog_A* 3bog_C* Length = 81 Back     alignment and structure
>2pne_A 6.5 kDa glycine-rich antifreeze protein; chemical protein synthesis, native chemical ligation; 0.98A {Synthetic} PDB: 3boi_A 3bog_A* 3bog_C* Length = 81 Back     alignment and structure
>2pne_A 6.5 kDa glycine-rich antifreeze protein; chemical protein synthesis, native chemical ligation; 0.98A {Synthetic} PDB: 3boi_A 3bog_A* 3bog_C* Length = 81 Back     alignment and structure
>2f6a_E Collagen; CNA, mscramm, adhesion, ECM, cell adhesion/structural protein complex; 3.29A {Staphylococcus aureus} Length = 30 Back     alignment and structure
>2f6a_E Collagen; CNA, mscramm, adhesion, ECM, cell adhesion/structural protein complex; 3.29A {Staphylococcus aureus} Length = 30 Back     alignment and structure
>2y5t_F C1; immune system, antibody, rheumatoid arthritis; 2.20A {Mus musculus} Length = 38 Back     alignment and structure
>2v8f_C MDIA1, profilin IIA; alternative splicing, protein-binding, cytoplasm, acetylation, cytoskeleton, actin-binding; 1.1A {Mus musculus} Length = 26 Back     alignment and structure
>2v8f_C MDIA1, profilin IIA; alternative splicing, protein-binding, cytoplasm, acetylation, cytoskeleton, actin-binding; 1.1A {Mus musculus} Length = 26 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>4dmt_A Collagen III derived peptide; collagen triple helix, VON willebrand factor, structural Pro; 1.39A {Synthetic} Length = 32 Back     alignment and structure
>3b0s_A Collagen-like peptide; triple helix, structural protein; HET: HYP; 1.45A {Synthetic} PDB: 1ym8_A* Length = 27 Back     alignment and structure
>2y5t_E C1; immune system, antibody, rheumatoid arthritis; 2.20A {Mus musculus} Length = 34 Back     alignment and structure
>1nay_A CCP4, collagen-like peptide; collagen assembly, structural protein; 2.60A {Synthetic} SCOP: k.3.1.1 Length = 56 Back     alignment and structure
>3u29_A Triple helical peptide; triple helix, biosynthetic protein; 2.00A {Synthetic construct} Length = 26 Back     alignment and structure
>3t4f_A Collagen mimetic peptide; triple helix, biosynthetic protein; 1.68A {Synthetic construct} Length = 26 Back     alignment and structure
>1x1k_F HOST-guest peptide (Pro-Pro-Gly)4-(Pro-allohyp- Gly)-(Pro-Pro-Gly)4; non-natural amino acid, collagen model peptide, puckering, triple-helix stability; 1.10A {Synthetic} PDB: 1wzb_A 1k6f_A 2klw_C* Length = 30 Back     alignment and structure
>1bkv_A T3-785; collagen, hydroxyproline, hydrogen bonding; 2.00A {} SCOP: k.3.1.1 Length = 30 Back     alignment and structure
>2g66_A Collagen; 3(S)hydroxyproline, 4(R)hydroxyproline, UP pucker, DOWN pucker, structural protein; 1.80A {Synthetic} Length = 31 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query927
3eg5_B383 Protein diaphanous homolog 1; protein-protein comp 100.0
2bnx_A386 Diaphanous protein homolog 1; autoinhibition, acti 100.0
3obv_E457 Protein diaphanous homolog 1; autoinhibition, acti 100.0
2j1d_G483 DAAM1, disheveled-associated activator of morphoge 100.0
1v9d_A340 Diaphanous protein homolog 1; helix bundle, protei 100.0
2f31_A233 Diaphanous protein homolog 1; formin,MDIA1, protei 100.0
1ux5_A411 BNI1 protein; structural protein, FH2 actin cytosk 100.0
4eah_A402 Formin-like protein 3, actin, alpha skeletal muscl 100.0
3eg5_B383 Protein diaphanous homolog 1; protein-protein comp 99.73
3dad_A339 FH1/FH2 domain-containing protein 1; formin, FHOD1 99.56
4dvg_B353 Diaphanous protein; cytoskeleton, armadillo repeat 99.16
2bnx_A386 Diaphanous protein homolog 1; autoinhibition, acti 98.35
2f31_A233 Diaphanous protein homolog 1; formin,MDIA1, protei 97.46
2v8f_C26 MDIA1, profilin IIA; alternative splicing, protein 94.93
3iot_A449 Maltose-binding protein, huntingtin fusion protei; 93.91
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 93.88
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 93.77
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 93.61
3grl_A651 General vesicular transport factor P115; vesicle t 92.45
3iot_A449 Maltose-binding protein, huntingtin fusion protei; 91.38
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 90.88
3tpo_A529 Importin subunit alpha-2; nuclear import, protein 90.73
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 89.86
3ul1_B510 Importin subunit alpha-2; arm repeat, armadillo re 89.69
4b8j_A528 Importin subunit alpha-1A; transport protein, nucl 85.76
3grl_A651 General vesicular transport factor P115; vesicle t 85.16
3tpo_A529 Importin subunit alpha-2; nuclear import, protein 84.63
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 84.57
4b8j_A528 Importin subunit alpha-1A; transport protein, nucl 81.23
3ul1_B510 Importin subunit alpha-2; arm repeat, armadillo re 81.05
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 80.83
>3eg5_B Protein diaphanous homolog 1; protein-protein complex, RHO proteins, formins, armadillo repeat, G-protein, GTPase, alternative splicing; HET: GNP; 2.70A {Mus musculus} SCOP: a.118.1.23 PDB: 1z2c_B* Back     alignment and structure
Probab=100.00  E-value=3.7e-72  Score=634.88  Aligned_cols=374  Identities=41%  Similarity=0.727  Sum_probs=314.9

Q ss_pred             hhccCCCHHHHHHHHHHHHHhCCCChhhhhhhhCCChHhHHHHHHHHHhccc-cccccccCCCChHHHHHHhcCCccchh
Q psy15122         73 NMLEKLNPEQLNQKFEDMLNDMNLSDEKKEPLRRQPLANKKKMLLMHYKGTV-TSYENKSKFDKPIEYIQYLSQPELSVN  151 (927)
Q Consensus        73 ~~~~~~~~~ei~~~F~~lle~lnl~~~k~~~L~~~p~~~K~~li~~~~~~~~-~~~~~~~~~~~P~~~i~~L~~~~~~~~  151 (927)
                      ..+..|++++|+++|++||++||++++||++|+++|.++||+||+||.+... ++.+ .+...+|+|||++|+++ .+..
T Consensus         5 ~~~~~~se~ev~~~F~~mL~~mnl~~ek~~~l~~~~~e~Kw~mi~~~~~~~~~~~~~-~~~~~sP~~yi~~L~~~-~~~~   82 (383)
T 3eg5_B            5 QSLQDISDEQVLVLFEQMLVDMNLNEEKQQPLREKDIVIKREMVSQYLHTSKAGMNQ-KESSRSAMMYIQELRSG-LRDM   82 (383)
T ss_dssp             ----------CCHHHHHHHHHTTCCHHHHHHHHSSCHHHHHHHHHHHHHHC----------CCCHHHHHHHHTTT-CCHH
T ss_pred             hhcccCCHHHHHHHHHHHHHHcCCCHHHHHHHHhCCHHHHHHHHHHHHHHhhhcccc-ccCCCCHHHHHHHHHhc-ccch
Confidence            4466789999999999999999999999999999999999999999986532 1222 34578999999999987 4566


Q ss_pred             hhhhhHHHHHHHhccCCchhHHHHhhhhhhhhhhcchhhhcCcCCCCCC--CcchhhHHHHHHHHHHHHHHhcHhhHHHH
Q psy15122        152 KMYSCIESLRIALTNHPLSWVNEFVLQDNKNFRKYPIAFLYPRFPSRSR--NDSRYDRVQYECVRCIRAIMNNTVGLKQM  229 (927)
Q Consensus       152 ~~~~~l~~Lrv~L~t~~~sWv~~F~~~Gl~~Ll~~~l~~ll~~l~~~~~--~~~~~~~~~~e~vkCLkaimN~~~Gl~~v  229 (927)
                      +++++|.+|||+|||+|++||++|+.+|+.+|+++ |..+..    +..  ....+...||+||+|||||||+++|++.|
T Consensus        83 kl~~~L~sL~v~Lrt~~~sWV~~F~~~Gl~~Ll~i-L~~~~~----~~~~~~~~~d~~~q~~~l~CLkalmN~~~G~~~v  157 (383)
T 3eg5_B           83 HLLSCLESLRVSLTSHPVSWVQTFGAEGLASLLDI-LKRLHD----EKEETSGNYDSRNQHEIIRCLKAFMNNKFGIKTM  157 (383)
T ss_dssp             HHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHHHHH-HHHHHT----CC-------CHHHHHHHHHHHHHHTSSHHHHHHH
T ss_pred             hHHHHHHHHHHHHhhCccHHHHHHHHccHHHHHHH-HHHHhh----ccccccchhhHHHHHHHHHHHHHHhcchhhHHHH
Confidence            78899999999999999999999999999999995 332221    111  12445688999999999999999999999


Q ss_pred             hcchhHHHHHHHhcCCCChhHHHHHHHHhhhhcccCC-C-chHHHHHHHHhhcccccCcChHHHHHHHhccCCCHHHHHH
Q psy15122        230 FGQKEALTIVARSLDPNKPTVMLEAVKVLAAVCLIPP-D-GHDKVIKAITMSGELKGKERFQPVVQGLMVKGNNEALRTA  307 (927)
Q Consensus       230 l~~~~~i~~la~sl~~~~~~~~~~vlelLaalc~~~~-~-Gh~~VL~Al~~~~~~~e~~RF~~lv~~L~~~~~~~~~~~~  307 (927)
                      +.|+++|..|+.|+++.+++++++|+|||+++|+++. . ||++||+||++++..++..||++||..| ....+++|+++
T Consensus       158 l~~~~~i~~l~~~L~s~~~~~~~~aleLL~~lc~~~~~~gG~~~VL~Al~~~~~~~e~~RF~~lv~~L-~~~~~~e~~~~  236 (383)
T 3eg5_B          158 LETEEGILLLVRAMDPAVPNMMIDAAKLLSALCILPQPEDMNERVLEAMTERAEMDEVERFQPLLDGL-KSGTSIALKVG  236 (383)
T ss_dssp             HTCSSHHHHHHHTCCTTSHHHHHHHHHHHHHHHTCCSSTTHHHHHHHHHHHHHHHHTSCTTHHHHHTT-STTSCHHHHHH
T ss_pred             HcChHHHHHHHHHhCCCchHHHHHHHHHHHHHHhCcCcCCcHHHHHHHHHHHHHhCCCCcHHHHHHHH-HccCcHHHHHH
Confidence            9999999999999999999999999999999999985 3 6999999999999888999999999999 45589999999


Q ss_pred             HHHHHHHHHcCchhHHHHHHHHHHHHHhChHHHHHHHhhcCChhHHHHHHHHhhhhHhHHHHHHHhchhcccccCCHHHH
Q psy15122        308 CLQLINAIVATPDDLEFRLHLRNEIMRVGLYDLLDALEKDASEDVSVQLKVFIEHKEEDYYEFIQRFDNVRMEIDDVNDC  387 (927)
Q Consensus       308 ~m~lIN~Lv~s~~dl~~Ri~lR~Ef~~~GL~eil~~L~~~~~~~L~~ql~~f~~~~~~D~~el~~r~~~~~~d~~~~~~~  387 (927)
                      ||.|||+||++++|+++|+|||+||.++||.+++++|+..++++|.+||++|++.+++|++|+.+|++++++|++|+.+|
T Consensus       237 ~m~lIN~li~~~~dl~~R~~lR~ef~~~Gl~~il~~lr~~~~~~L~~Qi~~fe~~~~eD~~el~~r~~~~~~d~~d~~~~  316 (383)
T 3eg5_B          237 CLQLINALITPAEELDFRVHIRSELMRLGLHQVLQELREIENEDMKVQLCVFDEQGDEDFFDLKGRLDDIRMEMDDFGEV  316 (383)
T ss_dssp             HHHHHHHHHTTCCCHHHHHHHHHHHHHTTHHHHHHHHTTSCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCSHHHH
T ss_pred             HHHHHHHHHcCCCCHHHHHHHHHHHHHCChHHHHHHHhcCCChhHHHHHHHHHHHHHHhHHHHHhhccccCcCcCCHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHhhcCCCchhhHHHHHhhhhccccchhhhhhhhhhhHHHHHHHhhhccchhhHHHHHHHHHHHHHHHHHhccCC
Q psy15122        388 FETVRNMVMDSACEPYLLSILQHLLFIRDDQNMVMDSACEPYLLSILQHLLFIRDDQYVRLAYYKLLEECVSQIVLHRGG  467 (927)
Q Consensus       388 f~~l~~~v~~t~a~~~f~sil~~ll~~~~~~~~~~~~~~~p~~lSilQhllli~~d~~~~~~~~~Lid~~v~qivl~r~g  467 (927)
                      |++|++++++|++++||                          +||||||++|++|...+.+||+|||+||+|||+|++|
T Consensus       317 ~~~l~~~~~~t~a~~~f--------------------------lSiLQhLlli~~d~~~~~~~~~Lid~~v~qivl~~~g  370 (383)
T 3eg5_B          317 FQIILNTVKDSKAEPHF--------------------------LSILQHLLLVRNDYEARPQYYKLIEECVSQIVLHKNG  370 (383)
T ss_dssp             HHHHHHHTTTSTTHHHH--------------------------HHHHHHTTCSCSSCTTHHHHHHHHHHHHHHHHCC---
T ss_pred             HHHHHHHhcCCcchHHH--------------------------HHHHHHHHhccCCchhHHHHHHHHHHHHHHHHhccCC
Confidence            99999999999999999                          9999999999999888999999999999999999999


Q ss_pred             CCCCcccccccccc
Q psy15122        468 CDPDFRSSRRFQLD  481 (927)
Q Consensus       468 ~d~d~~~~~~~~~d  481 (927)
                      .||||+++ +|++|
T Consensus       371 ~dpd~~~~-~~~~~  383 (383)
T 3eg5_B          371 TDPDFKCR-HLQID  383 (383)
T ss_dssp             --------------
T ss_pred             CCCCCCcc-CCCCC
Confidence            99999877 67665



>2bnx_A Diaphanous protein homolog 1; autoinhibition, actin, nucleation, cytoskeleton, structural; 2.4A {Mus musculus} SCOP: a.118.1.23 PDB: 3o4x_A 3obv_A* 2bap_B Back     alignment and structure
>3obv_E Protein diaphanous homolog 1; autoinhibition, actin, nucleation, cytoskeleton, structural; HET: SUC; 2.75A {Mus musculus} PDB: 3o4x_E 2bap_D Back     alignment and structure
>2j1d_G DAAM1, disheveled-associated activator of morphogenesis; actin assembly, protein binding; 2.55A {Homo sapiens} PDB: 2z6e_A Back     alignment and structure
>1v9d_A Diaphanous protein homolog 1; helix bundle, protein binding; 2.60A {Mus musculus} SCOP: a.207.1.1 Back     alignment and structure
>2f31_A Diaphanous protein homolog 1; formin,MDIA1, protein-protein complex, armadillo repeats, structural protein; 2.10A {Mus musculus} Back     alignment and structure
>1ux5_A BNI1 protein; structural protein, FH2 actin cytoskeleton; 2.5A {Saccharomyces cerevisiae} SCOP: a.207.1.1 PDB: 1y64_B* 1ux4_A Back     alignment and structure
>4eah_A Formin-like protein 3, actin, alpha skeletal muscle; ATP binding, cytoskeleton, FMNL3, protein BIN; HET: ATP; 3.40A {Mus musculus} Back     alignment and structure
>3eg5_B Protein diaphanous homolog 1; protein-protein complex, RHO proteins, formins, armadillo repeat, G-protein, GTPase, alternative splicing; HET: GNP; 2.70A {Mus musculus} SCOP: a.118.1.23 PDB: 1z2c_B* Back     alignment and structure
>3dad_A FH1/FH2 domain-containing protein 1; formin, FHOD1, GTPase-binding domain, ubiquitin-superfold, armadillo repeats, actin-binding, coiled coil; 2.30A {Homo sapiens} Back     alignment and structure
>4dvg_B Diaphanous protein; cytoskeleton, armadillo repeat, GTPase-binding domain, nucle binding, signaling protein, lipoprotein; HET: GSP; 2.60A {Entamoeba histolytica} Back     alignment and structure
>2bnx_A Diaphanous protein homolog 1; autoinhibition, actin, nucleation, cytoskeleton, structural; 2.4A {Mus musculus} SCOP: a.118.1.23 PDB: 3o4x_A 3obv_A* 2bap_B Back     alignment and structure
>2f31_A Diaphanous protein homolog 1; formin,MDIA1, protein-protein complex, armadillo repeats, structural protein; 2.10A {Mus musculus} Back     alignment and structure
>2v8f_C MDIA1, profilin IIA; alternative splicing, protein-binding, cytoplasm, acetylation, cytoskeleton, actin-binding; 1.1A {Mus musculus} Back     alignment and structure
>3iot_A Maltose-binding protein, huntingtin fusion protei; HTT-EX1, HD, sugar transport, transport, apoptos disease mutation, nucleus; 3.50A {Escherichia coli k-12} PDB: 3io6_A 3io4_A 3ior_A 3iou_A 3iov_A 3iow_A Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Back     alignment and structure
>3iot_A Maltose-binding protein, huntingtin fusion protei; HTT-EX1, HD, sugar transport, transport, apoptos disease mutation, nucleus; 3.50A {Escherichia coli k-12} PDB: 3io6_A 3io4_A 3ior_A 3iou_A 3iov_A 3iow_A Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Back     alignment and structure
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 927
d2bnxa1343 a.118.1.23 (A:133-475) Diaphanous protein homolog 4e-88
d1v9da_332 a.207.1.1 (A:) Diaphanous protein homolog 1, dia1 4e-57
d1ux5a_411 a.207.1.1 (A:) Bni1 {Baker's yeast (Saccharomyces 3e-49
d1jvra_137 a.61.1.2 (A:) HTLV-II matrix protein {Human T-cell 0.003
d1jvra_137 a.61.1.2 (A:) HTLV-II matrix protein {Human T-cell 0.004
>d2bnxa1 a.118.1.23 (A:133-475) Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 343 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: Diap1 N-terninal region-like
domain: Diaphanous protein homolog 1, Diap1 (Dia1, DRF1)
species: Mouse (Mus musculus) [TaxId: 10090]
 Score =  282 bits (724), Expect = 4e-88
 Identities = 140/372 (37%), Positives = 225/372 (60%), Gaps = 35/372 (9%)

Query: 136 PIEYIQYLSQPELSVNKMYSCIESLRIALTNHPLSWVNEFVLQDNKNFRKYPIAFLYPRF 195
            + YIQ L +  L    + SC+ESLR++L N+P+SWV  F  +   +     +  L+   
Sbjct: 4   AMMYIQEL-RSGLRDMHLLSCLESLRVSLNNNPVSWVQTFGAEGLASLLDI-LKRLHDE- 60

Query: 196 PSRSRNDSRYDRVQYECVRCIRAIMNNTVGLKQMFGQKEALTIVARSLDPNKPTVMLEAV 255
                + +   R Q+E +RC++A MNN  G+K M   +E + ++ R++DP  P +M++A 
Sbjct: 61  -KEETSGNYDSRNQHEIIRCLKAFMNNKFGIKTMLETEEGILLLVRAMDPAVPNMMIDAA 119

Query: 256 KVLAAVCLI--PPDGHDKVIKAITMSGELKGKERFQPVVQGLMVKGNNEALRTACLQLIN 313
           K+L+A+C++  P D +++V++A+T   E+   ERFQP++ GL   G + AL+  CLQLIN
Sbjct: 120 KLLSALCILPQPEDMNERVLEAMTERAEMDEVERFQPLLDGLK-SGTSIALKVGCLQLIN 178

Query: 314 AIVATPDDLEFRLHLRNEIMRVGLYDLLDALEKDASEDVSVQLKVFIEHKEEDYYEFIQR 373
           A++   ++L+FR+H+R+E+MR+GL+ +L  L +  +ED+ VQL VF E  +ED+++   R
Sbjct: 179 ALITPAEELDFRVHIRSELMRLGLHQVLQELREIENEDMKVQLCVFDEQGDEDFFDLKGR 238

Query: 374 FDNVRMEIDDVNDCFETVRNMVMDSACEPYLLSILQHLLFIRDDQNMVMDSACEPYLLSI 433
            D++RME+DD  + F+ + N V DS  EP+ LSI                          
Sbjct: 239 LDDIRMEMDDFGEVFQIILNTVKDSKAEPHFLSI-------------------------- 272

Query: 434 LQHLLFIRDDQYVRLAYYKLLEECVSQIVLHRGGCDPDFRSSRRFQLDVQPLVEHLAEKS 493
           LQHLL +R+D   R  YYKL+EECVSQIVLH+ G DPDF+  R  Q+D++ LV+ + +K+
Sbjct: 273 LQHLLLVRNDYEARPQYYKLIEECVSQIVLHKNGTDPDFK-CRHLQIDIERLVDQMIDKT 331

Query: 494 KTEEDR-RVEDL 504
           K E+   +  +L
Sbjct: 332 KVEKSEAKATEL 343


>d1v9da_ a.207.1.1 (A:) Diaphanous protein homolog 1, dia1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 332 Back     information, alignment and structure
>d1ux5a_ a.207.1.1 (A:) Bni1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 411 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query927
d2bnxa1343 Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) { 100.0
d1v9da_332 Diaphanous protein homolog 1, dia1 {Mouse (Mus mus 100.0
d1ux5a_411 Bni1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 100.0
d2bnxa1343 Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) { 97.38
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 94.37
d1wa5b_503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 86.97
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 83.03
d1wa5b_503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 82.28
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 80.42
>d2bnxa1 a.118.1.23 (A:133-475) Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: Diap1 N-terninal region-like
domain: Diaphanous protein homolog 1, Diap1 (Dia1, DRF1)
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=100.00  E-value=1.1e-59  Score=523.97  Aligned_cols=328  Identities=42%  Similarity=0.774  Sum_probs=297.6

Q ss_pred             CChHHHHHHhcCCccchhhhhhhHHHHHHHhccCCchhHHHHhhhhhhhhhhcchhhhcCcCCCCCCCcchhhHHHHHHH
Q psy15122        134 DKPIEYIQYLSQPELSVNKMYSCIESLRIALTNHPLSWVNEFVLQDNKNFRKYPIAFLYPRFPSRSRNDSRYDRVQYECV  213 (927)
Q Consensus       134 ~~P~~~i~~L~~~~~~~~~~~~~l~~Lrv~L~t~~~sWv~~F~~~Gl~~Ll~~~l~~ll~~l~~~~~~~~~~~~~~~e~v  213 (927)
                      .+|.|||++|+++ ...+++++||++|||+|||+|++||++|..+|+.+|+++ |..+...  +.......+...||+||
T Consensus         2 ~s~~~yv~~l~~~-~~~~~~~~~L~sL~v~Lrt~~~sWv~~F~~~G~~~L~~~-L~~l~~~--~~~~~~~~d~~~e~e~l   77 (343)
T d2bnxa1           2 RSAMMYIQELRSG-LRDMHLLSCLESLRVSLNNNPVSWVQTFGAEGLASLLDI-LKRLHDE--KEETSGNYDSRNQHEII   77 (343)
T ss_dssp             CCHHHHHHHHTSC-CCHHHHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHHHHH-HHHHHTC--CTTTCCTTHHHHHHHHH
T ss_pred             CCHHHHHHHHHhc-CCccHHHHHHHHHHHHHhcCCchHHHHHHhccHHHHHHH-HHHHHhh--cccccccccHHHHHHHH
Confidence            4899999999886 567788999999999999999999999988999999985 4333221  11112345677899999


Q ss_pred             HHHHHHHhcHhhHHHHhcchhHHHHHHHhcCCCChhHHHHHHHHhhhhcccCC--CchHHHHHHHHhhcccccCcChHHH
Q psy15122        214 RCIRAIMNNTVGLKQMFGQKEALTIVARSLDPNKPTVMLEAVKVLAAVCLIPP--DGHDKVIKAITMSGELKGKERFQPV  291 (927)
Q Consensus       214 kCLkaimN~~~Gl~~vl~~~~~i~~la~sl~~~~~~~~~~vlelLaalc~~~~--~Gh~~VL~Al~~~~~~~e~~RF~~l  291 (927)
                      +|||||||++.|++.|+.++.+|+.|+.|+.+++++++++|+|+|+++|+++.  +||.+||+||+++++.++..||++|
T Consensus        78 ~CLkalmn~~~G~~~vl~~~~~i~~l~~~L~s~~~~tr~~a~elL~~lc~~~~~~~g~~~vL~Al~~~~~~~e~~RF~~l  157 (343)
T d2bnxa1          78 RCLKAFMNNKFGIKTMLETEEGILLLVRAMDPAVPNMMIDAAKLLSALCILPQPEDMNERVLEAMTERAEMDEVERFQPL  157 (343)
T ss_dssp             HHHHHHTSSHHHHHHHHHSSSHHHHHHHTCCTTSHHHHHHHHHHHHHHHTCCSSTTHHHHHHHHHHHHHHHHTSCTTHHH
T ss_pred             HHHHHHhccHHHHHHHHcChHHHHHHHHccCCCchHHHHHHHHHHHHHHhccCCCchHHHHHHHHHHHHHhcCCCcHHHH
Confidence            99999999999999999999999999999999999999999999999999974  5999999999999988999999999


Q ss_pred             HHHHhccCCCHHHHHHHHHHHHHHHcCchhHHHHHHHHHHHHHhChHHHHHHHhhcCChhHHHHHHHHhhhhHhHHHHHH
Q psy15122        292 VQGLMVKGNNEALRTACLQLINAIVATPDDLEFRLHLRNEIMRVGLYDLLDALEKDASEDVSVQLKVFIEHKEEDYYEFI  371 (927)
Q Consensus       292 v~~L~~~~~~~~~~~~~m~lIN~Lv~s~~dl~~Ri~lR~Ef~~~GL~eil~~L~~~~~~~L~~ql~~f~~~~~~D~~el~  371 (927)
                      |+.| ....+.+|+++||.|||+||++++|+++|+|||+||.++||.+++++|+..+++.|.+||++|++.+++|++++.
T Consensus       158 v~~l-~~~~~~ey~~a~m~lIN~li~~~~dl~~R~~lR~E~~~~Gl~~il~~l~~~~~~~L~~Qi~~f~~~~~~D~~el~  236 (343)
T d2bnxa1         158 LDGL-KSGTSIALKVGCLQLINALITPAEELDFRVHIRSELMRLGLHQVLQELREIENEDMKVQLCVFDEQGDEDFFDLK  236 (343)
T ss_dssp             HHHT-STTSCHHHHHHHHHHHHHHHTTCSCHHHHHHHHHHHHHTTHHHHHHHHTTCCCHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHH-hccccHHHHHHHHHHHHHHHcCcccHHHHHHHHHHHHHCChHHHHHHHHccCChHHHHHHHHHHHHHHhHHHHHH
Confidence            9999 567789999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HhchhcccccCCHHHHHHHHHHHhhcCCCchhhHHHHHhhhhccccchhhhhhhhhhhHHHHHHHhhhccchhhHHHHHH
Q psy15122        372 QRFDNVRMEIDDVNDCFETVRNMVMDSACEPYLLSILQHLLFIRDDQNMVMDSACEPYLLSILQHLLFIRDDQYVRLAYY  451 (927)
Q Consensus       372 ~r~~~~~~d~~~~~~~f~~l~~~v~~t~a~~~f~sil~~ll~~~~~~~~~~~~~~~p~~lSilQhllli~~d~~~~~~~~  451 (927)
                      ++++++.+|++|+.++|+.|++++++|++++||                          +||+|||+++++|...+.+||
T Consensus       237 ~~~~~~~~d~~~~~~~~~~l~~~~~~t~~e~~f--------------------------lSilQhLll~~~~~~~~~~~~  290 (343)
T d2bnxa1         237 GRLDDIRMEMDDFGEVFQIILNTVKDSKAEPHF--------------------------LSILQHLLLVRNDYEARPQYY  290 (343)
T ss_dssp             HHHHHHHHHCCCHHHHHHHHHHHHTTSTHHHHH--------------------------HHHHHHHTTSCCCTTTHHHHH
T ss_pred             hcccccccccCCHHHHHHHHHHHhcCCccHHHH--------------------------HHHHHHHHcCCcCcchHHHHH
Confidence            999999999999999999999999999999999                          999999999999988899999


Q ss_pred             HHHHHHHHHHHhccCCCCCCccccccccccchHHHHHHHHhh
Q psy15122        452 KLLEECVSQIVLHRGGCDPDFRSSRRFQLDVQPLVEHLAEKS  493 (927)
Q Consensus       452 ~Lid~~v~qivl~r~g~d~d~~~~~~~~~dv~~ll~~l~~~~  493 (927)
                      +|||+||+||+++++|.||||.. ++|+++|+++++.+.+..
T Consensus       291 ~Lid~~v~~i~l~~~~~d~d~~~-~~l~~~i~~l~d~l~~~~  331 (343)
T d2bnxa1         291 KLIEECVSQIVLHKNGTDPDFKC-RHLQIDIERLVDQMIDKT  331 (343)
T ss_dssp             HHHHHHHHHHHTCGGGCCCCTTC-SCCCCCCTTTC-----CT
T ss_pred             HHHHHHHHHHHHhhcCCCCCchh-hhhhhhHHHHHHHHhhHH
Confidence            99999999999999999999964 489999999999888764



>d1v9da_ a.207.1.1 (A:) Diaphanous protein homolog 1, dia1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ux5a_ a.207.1.1 (A:) Bni1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bnxa1 a.118.1.23 (A:133-475) Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure