Psyllid ID: psy15136


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------
VGLITRKVGASVSPVLELEKDDSGTYTLHSNSTFKNHAIKFKIGEEFDEETPDGRKVKSVITIDGDTMTHIQKGDKETKIIRVFSDDEVKMTLTVDDIVCTRIYKPL
ccHHHHHHHHccccEEEEEEccccEEEEEEccccEEEEEEEEcccEEEEEcccccEEEEEEEEEccEEEEEEEccccEEEEEEEEccEEEEEEEEccEEEEEEEEEc
ccHHHHHHHHHcccEEEEEEEEccEEEEEEEccccEEEEEEcccccEEEEcccccEEEEEEEEEccEEEEEEEEccEEEEEEEEcccEEEEEEEEccEEEEEEEEEc
vglitrkvgasvspvlelekddsgtytlhsnstfkNHAIKFKigeefdeetpdgrkvksvitidgdtmthiqkgdketKIIRVFSDDevkmtltvddivctriykpl
vglitrkvgasvspvlelekddsgtytlhsnstfknHAIKFKIGeefdeetpdgrkvksvitidgdtmthiqkgdketkiirvfsddevkmtltvddivctriykpl
VGLITRKVGASVSPVLELEKDDSGTYTLHSNSTFKNHAIKFKIGEEFDEETPDGRKVKSVITIDGDTMTHIQKGDKETKIIRVFSDDEVKMTLTVDDIVCTRIYKPL
********************************TFKNHAIKFKIG*************KSVITIDGDTMTHIQKGDKETKIIRVFSDDEVKMTLTVDDIVCTRIY***
VGLITRKVGASVSPVLELEKDDSGTYTLHSNSTFKNHAIKFKIGEEFDEETPDGRKVKSVITIDGDTMTHIQKGDKETKIIRVFSDDEVKMTLTVDDIVCTRIYKPL
VGLITRKVGASVSPVLELEKDDSGTYTLHSNSTFKNHAIKFKIGEEF********KVKSVITIDGDTMTHIQKGDKETKIIRVFSDDEVKMTLTVDDIVCTRIYKPL
VGLITRKVGASVSPVLELEKDDSGTYTLHSNSTFKNHAIKFKIGEEFDEETPDGRKVKSVITIDGDTMTHIQKGDKETKIIRVFSDDEVKMTLTVDDIVCTRIYKPL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VGLITRKVGASVSPVLELEKDDSGTYTLHSNSTFKNHAIKFKIGEEFDEETPDGRKVKSVITIDGDTMTHIQKGDKETKIIRVFSDDEVKMTLTVDDIVCTRIYKPL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query107 2.2.26 [Sep-21-2011]
P41496134 Fatty acid-binding protei N/A N/A 0.990 0.791 0.532 1e-22
P41509134 Fatty acid-binding protei N/A N/A 0.990 0.791 0.523 2e-22
O13008133 Fatty acid-binding protei N/A N/A 0.943 0.759 0.514 5e-21
Q9U5P1131 Fatty acid-binding protei N/A N/A 0.971 0.793 0.471 3e-19
Q99P61133 Fatty acid-binding protei N/A N/A 0.971 0.781 0.452 1e-18
Q05423132 Fatty acid-binding protei yes N/A 0.971 0.787 0.452 5e-18
P05413133 Fatty acid-binding protei yes N/A 0.971 0.781 0.462 6e-18
P07483133 Fatty acid-binding protei yes N/A 0.971 0.781 0.462 7e-18
Q865F7133 Fatty acid-binding protei N/A N/A 0.953 0.766 0.444 1e-17
Q17284130 Fatty acid-binding protei N/A N/A 0.990 0.815 0.425 3e-17
>sp|P41496|FABPM_SCHGR Fatty acid-binding protein, muscle OS=Schistocerca gregaria PE=1 SV=2 Back     alignment and function desciption
 Score =  104 bits (260), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 71/107 (66%), Gaps = 1/107 (0%)

Query: 1   VGLITRKVGASVSPVLELEKDDSGTYTLHSNSTFKNHAIKFKIGEEFDEETPDGRKVKSV 60
           VG I RK G ++SPV+ELE  D   + L S +  KN    FK+GEEFDEET DGRKVKS 
Sbjct: 27  VGAIERKAGLALSPVIELEILDGDKFKLTSKTAIKNTEFTFKLGEEFDEETLDGRKVKST 86

Query: 61  ITIDG-DTMTHIQKGDKETKIIRVFSDDEVKMTLTVDDIVCTRIYKP 106
           IT DG + + H QKGD  T IIR FS ++  +T+ + D+V TRIYK 
Sbjct: 87  ITQDGPNKLVHEQKGDHPTIIIREFSKEQCVITIKLGDLVATRIYKA 133




Binds fatty acids in a 1:1 molar ratio.
Schistocerca gregaria (taxid: 7010)
>sp|P41509|FABPM_LOCMI Fatty acid-binding protein, muscle OS=Locusta migratoria PE=1 SV=2 Back     alignment and function description
>sp|O13008|FABPH_ONCMY Fatty acid-binding protein, heart OS=Oncorhynchus mykiss GN=fabp3 PE=2 SV=3 Back     alignment and function description
>sp|Q9U5P1|FABP_LEPDS Fatty acid-binding protein OS=Lepidoglyphus destructor PE=1 SV=1 Back     alignment and function description
>sp|Q99P61|FABPH_SPETR Fatty acid-binding protein, heart OS=Spermophilus tridecemlineatus GN=FABP3 PE=2 SV=3 Back     alignment and function description
>sp|Q05423|FABP7_CHICK Fatty acid-binding protein, brain OS=Gallus gallus GN=FABP7 PE=2 SV=2 Back     alignment and function description
>sp|P05413|FABPH_HUMAN Fatty acid-binding protein, heart OS=Homo sapiens GN=FABP3 PE=1 SV=4 Back     alignment and function description
>sp|P07483|FABPH_RAT Fatty acid-binding protein, heart OS=Rattus norvegicus GN=Fabp3 PE=1 SV=2 Back     alignment and function description
>sp|Q865F7|FABPH_MYOLU Fatty acid-binding protein, heart OS=Myotis lucifugus GN=FABP3 PE=2 SV=3 Back     alignment and function description
>sp|Q17284|FABP_BLOTA Fatty acid-binding protein OS=Blomia tropicalis PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query107
110671468133 putative fatty acid binding protein [Dia 1.0 0.804 1.0 2e-54
60678801131 MPA13 allergen [Periplaneta americana] 0.981 0.801 0.698 3e-34
156547893132 PREDICTED: fatty acid-binding protein, m 0.971 0.787 0.647 1e-32
156547891132 PREDICTED: fatty acid-binding protein, m 0.971 0.787 0.647 2e-32
383853580134 PREDICTED: myelin P2 protein-like [Megac 0.971 0.776 0.657 6e-32
240849479135 MPA13 allergen-like [Acyrthosiphon pisum 1.0 0.792 0.623 2e-31
146285347136 MPA13-like protein [Lygus lineolaris] 0.981 0.772 0.660 2e-31
263173263109 fatty acid-binding lipocalin [Cimex lect 0.953 0.935 0.648 1e-30
350427442133 PREDICTED: myelin P2 protein-like isofor 0.971 0.781 0.609 6e-30
350427440132 PREDICTED: myelin P2 protein-like isofor 0.971 0.787 0.609 9e-30
>gi|110671468|gb|ABG81985.1| putative fatty acid binding protein [Diaphorina citri] Back     alignment and taxonomy information
 Score =  216 bits (549), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 107/107 (100%), Positives = 107/107 (100%)

Query: 1   VGLITRKVGASVSPVLELEKDDSGTYTLHSNSTFKNHAIKFKIGEEFDEETPDGRKVKSV 60
           VGLITRKVGASVSPVLELEKDDSGTYTLHSNSTFKNHAIKFKIGEEFDEETPDGRKVKSV
Sbjct: 27  VGLITRKVGASVSPVLELEKDDSGTYTLHSNSTFKNHAIKFKIGEEFDEETPDGRKVKSV 86

Query: 61  ITIDGDTMTHIQKGDKETKIIRVFSDDEVKMTLTVDDIVCTRIYKPL 107
           ITIDGDTMTHIQKGDKETKIIRVFSDDEVKMTLTVDDIVCTRIYKPL
Sbjct: 87  ITIDGDTMTHIQKGDKETKIIRVFSDDEVKMTLTVDDIVCTRIYKPL 133




Source: Diaphorina citri

Species: Diaphorina citri

Genus: Diaphorina

Family: Psyllidae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|60678801|gb|AAX33735.1| MPA13 allergen [Periplaneta americana] Back     alignment and taxonomy information
>gi|156547893|ref|XP_001608053.1| PREDICTED: fatty acid-binding protein, muscle-like isoform 2 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|156547891|ref|XP_001608047.1| PREDICTED: fatty acid-binding protein, muscle-like isoform 1 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|383853580|ref|XP_003702300.1| PREDICTED: myelin P2 protein-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|240849479|ref|NP_001155787.1| MPA13 allergen-like [Acyrthosiphon pisum] gi|239792333|dbj|BAH72520.1| ACYPI009011 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|146285347|gb|ABQ18251.1| MPA13-like protein [Lygus lineolaris] Back     alignment and taxonomy information
>gi|263173263|gb|ACY69894.1| fatty acid-binding lipocalin [Cimex lectularius] Back     alignment and taxonomy information
>gi|350427442|ref|XP_003494760.1| PREDICTED: myelin P2 protein-like isoform 2 [Bombus impatiens] Back     alignment and taxonomy information
>gi|350427440|ref|XP_003494759.1| PREDICTED: myelin P2 protein-like isoform 1 [Bombus impatiens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query107
FB|FBgn0037913157 fabp "fatty acid bindin protei 0.850 0.579 0.580 1e-22
ZFIN|ZDB-GENE-020318-2133 fabp3 "fatty acid binding prot 0.962 0.774 0.504 4.9e-21
UNIPROTKB|E1C2C7135 FABP7 "Fatty acid-binding prot 0.971 0.770 0.452 7.2e-20
UNIPROTKB|Q05423132 FABP7 "Fatty acid-binding prot 0.971 0.787 0.452 7.2e-20
UNIPROTKB|P05413133 FABP3 "Fatty acid-binding prot 0.971 0.781 0.462 9.2e-20
RGD|69048133 Fabp3 "fatty acid binding prot 0.971 0.781 0.462 1.2e-19
UNIPROTKB|O15540132 FABP7 "Fatty acid-binding prot 0.971 0.787 0.443 8.3e-19
UNIPROTKB|P10790133 FABP3 "Fatty acid-binding prot 0.971 0.781 0.443 1.1e-18
UNIPROTKB|Q09139132 FABP7 "Fatty acid-binding prot 0.971 0.787 0.433 1.1e-18
UNIPROTKB|F1NUQ3109 FABP3 "Uncharacterized protein 0.971 0.954 0.424 4.6e-18
FB|FBgn0037913 fabp "fatty acid bindin protein" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 263 (97.6 bits), Expect = 1.0e-22, P = 1.0e-22
 Identities = 54/93 (58%), Positives = 71/93 (76%)

Query:     1 VGLITRKVGASVSPVLELEKDDSGTYTLHSNSTFKNHAIKFKIGEEFDEETPDGRKVKSV 60
             VGL+TRK+G S+SP +E+  +   TYTL + STFK  AI FK+G EFDEET DGR VKS+
Sbjct:    25 VGLVTRKMGNSLSPTVEVTLEGD-TYTLTTTSTFKTSAISFKLGVEFDEETLDGRNVKSI 83

Query:    61 ITIDGDTMTHIQKGDKETKIIRVFSDDEVKMTL 93
             IT+DG+ +T  QKGDK T I+R F+D+E+ +TL
Sbjct:    84 ITLDGNKLTQEQKGDKPTTIVREFTDNEL-ITL 115




GO:0005504 "fatty acid binding" evidence=ISS
GO:0006810 "transport" evidence=IEA
GO:0005215 "transporter activity" evidence=IEA
GO:0005875 "microtubule associated complex" evidence=IDA
GO:0007616 "long-term memory" evidence=IMP
ZFIN|ZDB-GENE-020318-2 fabp3 "fatty acid binding protein 3, muscle and heart" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1C2C7 FABP7 "Fatty acid-binding protein, brain" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q05423 FABP7 "Fatty acid-binding protein, brain" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P05413 FABP3 "Fatty acid-binding protein, heart" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|69048 Fabp3 "fatty acid binding protein 3, muscle and heart" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|O15540 FABP7 "Fatty acid-binding protein, brain" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P10790 FABP3 "Fatty acid-binding protein, heart" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q09139 FABP7 "Fatty acid-binding protein, brain" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1NUQ3 FABP3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P07483FABPH_RATNo assigned EC number0.46220.97190.7819yesN/A
P10790FABPH_BOVINNo assigned EC number0.44440.95320.7669yesN/A
P11404FABPH_MOUSENo assigned EC number0.43390.97190.7819yesN/A
O01812FABP6_CAEELNo assigned EC number0.44440.96260.7629yesN/A
Q05423FABP7_CHICKNo assigned EC number0.45280.97190.7878yesN/A
P05413FABPH_HUMANNo assigned EC number0.46220.97190.7819yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 107
KOG4015|consensus133 100.0
PF14651128 Lipocalin_7: Lipocalin / cytosolic fatty-acid bind 99.98
PF00061144 Lipocalin: Lipocalin / cytosolic fatty-acid bindin 93.79
TIGR03066111 Gem_osc_para_1 Gemmata obscuriglobus paralogous fa 87.23
TIGR03067107 Planc_TIGR03067 Planctomycetes uncharacterized dom 85.36
PF13648104 Lipocalin_4: Lipocalin-like domain 82.37
>KOG4015|consensus Back     alignment and domain information
Probab=100.00  E-value=4.1e-39  Score=215.32  Aligned_cols=106  Identities=49%  Similarity=0.837  Sum_probs=104.3

Q ss_pred             CChhhhhhhhcCCCeEEEEEcCCccEEEEEeecCceeEEEEEcCceEEEeCCCCceEEEEEEEeCCEEEEEEeCCcc-eE
Q psy15136          1 VGLITRKVGASVSPVLELEKDDSGTYTLHSNSTFKNHAIKFKIGEEFDEETPDGRKVKSVITIDGDTMTHIQKGDKE-TK   79 (107)
Q Consensus         1 v~~~~Rk~~~~~~p~~~I~~~Gd~~~~i~~~t~~kt~~~~F~lGeefe~~~~dG~~~k~t~t~eg~kLv~~~~~~~~-~~   79 (107)
                      |||+.||+|+.++|+++|+|+|| +|+|++.|.+|+.+++|+||+|||+.++|||++|++++|||++|+++|+++++ .+
T Consensus        26 V~~~~Rk~a~~~kp~~~i~~~G~-~~~~~t~Stfknt~~~f~lGeeFee~t~Dgrk~kstvt~e~~~lv~~qk~~gke~~  104 (133)
T KOG4015|consen   26 VGWATRKIAKLAKPVLEITQDGD-KFTIKTLSTFKNTEISFKLGEEFEEETADGRKVKSTVTLEGGLLVHHQKGDGKETT  104 (133)
T ss_pred             CcHhHHHHHhhcCCeEEEEEcCC-EEEEEEeecccceEEEEEEeeeeccccCCCCEEEEEEEEeCCeEEEEEcCCCCceE
Confidence            78999999999999999999999 99999999999999999999999999999999999999999999999999999 99


Q ss_pred             EEEEEECCEEEEEEEECCEEEEEEEEeC
Q psy15136         80 IIRVFSDDEVKMTLTVDDIVCTRIYKPL  107 (107)
Q Consensus        80 ~~rev~g~~l~~t~~~~~v~~kR~ykr~  107 (107)
                      ++|+++||+|+++|++|||+|+|+|+|+
T Consensus       105 ~tr~l~~dkLv~~~~~~~Vvc~R~ykr~  132 (133)
T KOG4015|consen  105 ITRKLEGDKLVVTMTMNGVVCTRVYKRV  132 (133)
T ss_pred             EEEEEeCCEEEEEEEECCEEEEEEEEEc
Confidence            9999999999999999999999999995



>PF14651 Lipocalin_7: Lipocalin / cytosolic fatty-acid binding protein family; PDB: 2F73_A 3B2L_A 3B2J_A 3STN_A 3STK_A 3STM_X 3VG6_A 3VG4_A 3VG5_A 3B2K_A Back     alignment and domain information
>PF00061 Lipocalin: Lipocalin / cytosolic fatty-acid binding protein family fatty acid-binding protein signature lipocalin signature; InterPro: IPR000566 Proteins which transport small hydrophobic molecules such as steroids, bilins, retinoids, and lipids share limited regions of sequence homology and a common tertiary structure architecture [, , , , ] Back     alignment and domain information
>TIGR03066 Gem_osc_para_1 Gemmata obscuriglobus paralogous family TIGR03066 Back     alignment and domain information
>TIGR03067 Planc_TIGR03067 Planctomycetes uncharacterized domain TIGR03067 Back     alignment and domain information
>PF13648 Lipocalin_4: Lipocalin-like domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query107
1ftp_A133 Three-Dimensional Structure Of The Muscle Fatty-Aci 1e-23
2flj_A134 Fatty Acid Binding Protein From Locust Flight Muscl 1e-23
3ppt_A133 Rep1-nxsq Fatty Acid Transporter Length = 133 8e-20
3pp6_A131 Rep1-nxsq Fatty Acid Transporter Y128f Mutant Lengt 2e-19
3rsw_A158 Crystal Structure Of Heart Fatty Acid Binding Prote 4e-19
1g5w_A132 Solution Structure Of Human Heart-Type Fatty Acid B 4e-19
1fdq_A131 Crystal Structure Of Human Brain Fatty Acid Binding 3e-18
1bwy_A132 Nmr Study Of Bovine Heart Fatty Acid Binding Protei 4e-18
2a0a_A131 Solution Structure Of Der F 13, Group 13 Allergen F 2e-17
1o8v_A134 The Crystal Structure Of Echinococcus Granulosus Fa 2e-16
1g74_A131 Toward Changing Specificity: Adipocyte Lipid Bindin 5e-16
4a8z_A133 Human Myelin P2 Protein, K112q Mutant Length = 133 6e-16
4a1h_A133 Human Myelin P2 Protein, K45s Mutant Length = 133 8e-16
2wut_A133 Crystal Structure Of Human Myelin Protein P2 In Com 1e-15
3nr3_A153 Crystal Structure Of Human Peripheral Myelin Protei 1e-15
4a1y_A133 Human Myelin P2 Protein, K65q Mutant Length = 133 2e-15
1yiv_A131 Structure Of Myelin P2 Protein From Equine Spinal C 3e-15
3p6c_A139 Human Adipocyte Lipid-Binding Protein Fabp4 In Comp 3e-15
1tou_A131 Crystal Structure Of Human Adipocyte Fatty Acid Bin 4e-15
2hnx_A136 Crystal Structure Of Ap2 Length = 136 4e-15
3fr4_A132 N-Benzyl-Indolo Carboxylic Acids: Design And Synthe 4e-15
3q6l_A152 Crystal Structure Of Human Adipocyte Fatty Acid Bin 4e-15
1pmp_A131 Crystallographic Studies On A Family Of Cellular Li 9e-15
4a60_A154 Crystal Structure Of Human Testis-Specific Fatty Ac 1e-14
2poa_A133 Schistosoma Mansoni Sm14 Fatty Acid-Binding Protein 2e-14
2qm9_A155 Troglitazone Bound To Fatty Acid Binding Protein 4 2e-14
2ans_A131 Adipocyte Lipid Binding Protein Complexed With 1-an 3e-14
1a2d_A131 Pyridoxamine Modified Murine Adipocyte Lipid Bindin 3e-14
1vyf_A135 Schistosoma Mansoni Fatty Acid Binding Protein In C 5e-14
1xca_A137 Apo-Cellular Retinoic Acid Binding Protein Ii Lengt 2e-13
1lpj_A133 Human Crbp Iv Length = 133 3e-13
3cr6_A137 Crystal Structure Of The R132k:r111l:a32e Mutant Of 6e-13
1eii_A134 Nmr Structure Of Holo Cellular Retinol-Binding Prot 7e-13
2frs_A137 Crystal Structure Of The F15w Mutant Of Apo-Cellula 7e-13
2cbs_A137 Cellular Retinoic Acid Binding Protein Ii In Comple 8e-13
3f9d_A137 Crystal Structure Of The R132k:r111l:t54e Mutant Of 9e-13
1cbr_A136 Crystal Structure Of Cellular Retinoic-Acid-Binding 1e-12
2g7b_A137 Crystal Structure Of The R132k:r111l:l121e Mutant O 2e-12
1ab0_A131 C1gV32DF57H MUTANT OF MURINE ADIPOCYTE LIPID BINDIN 3e-12
3fa7_A137 Crystal Structure Of The Apo R132k:r111l:l121e:r59e 3e-12
1acd_A131 V32dF57H MUTANT OF MURINE ADIPOCYTE LIPID BINDING P 3e-12
3f8a_A137 Crystal Structure Of The R132k:r111l:l121e:r59w Mut 5e-12
3fa8_A137 Crystal Structure Of The Apo R132k:y134f:r111l:l121 7e-12
2g78_A137 Crystal Structure Of The R132k:y134f Mutant Of Cell 7e-12
3i17_B137 Crystal Structure Of The Apo R132k:l121e Mutant Of 8e-12
4exz_A133 Crystal Structure Of The Q108k:k40l Mutant Of Cellu 9e-12
3fa9_A137 Crystal Structure Of The Apo R132k:y134f:r111l:l121 1e-11
4gkc_A133 Crystal Structure Of Q108k:k40l:t51v:t53c:r58w:t29l 1e-11
4eej_A133 Crystal Structure Of The Q108k:k40l:t51v:t53c:y19w: 2e-11
3d95_A137 Crystal Structure Of The R132k:y134f:r111l:l121e:t5 2e-11
4efg_A133 Crystal Structure Of The Q108k:k40l:t51v:t53c:y19w: 2e-11
4ede_A133 Crystal Structure Of The Q108k:k40l:t51v:t53c:y19w: 2e-11
2rcq_A141 Crystal Strucure Of Human Apo Cellular Retinol Bind 2e-11
3fa6_A137 Crystal Structure Of The R132k:y134f:r111l:l121d:t5 3e-11
1kqw_A134 Crystal Structure Of Holo-Crbp From Zebrafish Lengt 1e-10
1jjj_A135 Solution Structure Of Recombinant Human Epidermal-T 2e-10
1ggl_A134 Human Cellular Retinol Binding Protein Iii Length = 5e-10
1jbh_A135 Solution Structure Of Cellular Retinol Binding Prot 4e-09
1crb_A134 Crystallographic Studies On A Family Of Cellular Li 4e-09
1mdc_A132 Crystallization, Structure Determination And Least- 3e-06
1t8v_A131 The Nmr Structure Of D34a I-Fabp: Implications For 1e-04
1ifc_A132 Refinement Of The Structure Of Recombinant Rat Inte 4e-04
1ael_A131 Nmr Structure Of Apo Intestinal Fatty Acid-Binding 4e-04
1lfo_A128 Liver Fatty Acid Binding Protein-Oleate Complex Len 6e-04
2ju3_A127 Solution-State Nmr Structures Of Apo-Lfabp (Liver F 7e-04
1p6p_A125 Crystal Structure Of Toad Liver Basic Fatty Acid-Bi 8e-04
>pdb|1FTP|A Chain A, Three-Dimensional Structure Of The Muscle Fatty-Acid- Binding Protein Isolated From The Desert Locust, Schistocerca Gregaria Length = 133 Back     alignment and structure

Iteration: 1

Score = 104 bits (259), Expect = 1e-23, Method: Compositional matrix adjust. Identities = 57/107 (53%), Positives = 71/107 (66%), Gaps = 1/107 (0%) Query: 1 VGLITRKVGASVSPVLELEKDDSGTYTLHSNSTFKNHAIKFKIGEEFDEETPDGRKVKSV 60 VG I RK G ++SPV+ELE D + L S + KN FK+GEEFDEET DGRKVKS Sbjct: 26 VGAIERKAGLALSPVIELEILDGDKFKLTSKTAIKNTEFTFKLGEEFDEETLDGRKVKST 85 Query: 61 ITIDG-DTMTHIQKGDKETKIIRVFSDDEVKMTLTVDDIVCTRIYKP 106 IT DG + + H QKGD T IIR FS ++ +T+ + D+V TRIYK Sbjct: 86 ITQDGPNKLVHEQKGDHPTIIIREFSKEQCVITIKLGDLVATRIYKA 132
>pdb|2FLJ|A Chain A, Fatty Acid Binding Protein From Locust Flight Muscle In Complex With Oleate Length = 134 Back     alignment and structure
>pdb|3PPT|A Chain A, Rep1-nxsq Fatty Acid Transporter Length = 133 Back     alignment and structure
>pdb|3PP6|A Chain A, Rep1-nxsq Fatty Acid Transporter Y128f Mutant Length = 131 Back     alignment and structure
>pdb|3RSW|A Chain A, Crystal Structure Of Heart Fatty Acid Binding Protein (Fabp3) Length = 158 Back     alignment and structure
>pdb|1G5W|A Chain A, Solution Structure Of Human Heart-Type Fatty Acid Binding Protein Length = 132 Back     alignment and structure
>pdb|1FDQ|A Chain A, Crystal Structure Of Human Brain Fatty Acid Binding Protein Length = 131 Back     alignment and structure
>pdb|1BWY|A Chain A, Nmr Study Of Bovine Heart Fatty Acid Binding Protein Length = 132 Back     alignment and structure
>pdb|2A0A|A Chain A, Solution Structure Of Der F 13, Group 13 Allergen From House Dust Mites Length = 131 Back     alignment and structure
>pdb|1O8V|A Chain A, The Crystal Structure Of Echinococcus Granulosus Fatty-Acid-Binding Protein 1 Length = 134 Back     alignment and structure
>pdb|1G74|A Chain A, Toward Changing Specificity: Adipocyte Lipid Binding Protein Mutant, Oleic Acid Bound Form Length = 131 Back     alignment and structure
>pdb|4A8Z|A Chain A, Human Myelin P2 Protein, K112q Mutant Length = 133 Back     alignment and structure
>pdb|4A1H|A Chain A, Human Myelin P2 Protein, K45s Mutant Length = 133 Back     alignment and structure
>pdb|2WUT|A Chain A, Crystal Structure Of Human Myelin Protein P2 In Complex With Palmitate Length = 133 Back     alignment and structure
>pdb|3NR3|A Chain A, Crystal Structure Of Human Peripheral Myelin Protein 2 Length = 153 Back     alignment and structure
>pdb|4A1Y|A Chain A, Human Myelin P2 Protein, K65q Mutant Length = 133 Back     alignment and structure
>pdb|1YIV|A Chain A, Structure Of Myelin P2 Protein From Equine Spinal Cord Length = 131 Back     alignment and structure
>pdb|3P6C|A Chain A, Human Adipocyte Lipid-Binding Protein Fabp4 In Complex With Citric Acid Length = 139 Back     alignment and structure
>pdb|1TOU|A Chain A, Crystal Structure Of Human Adipocyte Fatty Acid Binding Protein In Complex With A Non-Covalent Ligand Length = 131 Back     alignment and structure
>pdb|2HNX|A Chain A, Crystal Structure Of Ap2 Length = 136 Back     alignment and structure
>pdb|3FR4|A Chain A, N-Benzyl-Indolo Carboxylic Acids: Design And Synthesis Of Potent And Selective Adipocyte Fatty-Acid Binding Protein (A-Fabp) Inhibitors Length = 132 Back     alignment and structure
>pdb|3Q6L|A Chain A, Crystal Structure Of Human Adipocyte Fatty Acid Binding Protein (Fabp4) At 1.4 Ang. Resolution Length = 152 Back     alignment and structure
>pdb|1PMP|A Chain A, Crystallographic Studies On A Family Of Cellular Lipophilic Transport Proteins. Refinement Of P2 Myelin Protein And The Structure Determination And Refinement Of Cellular Retinol-binding Protein In Complex With All-trans-retinol Length = 131 Back     alignment and structure
>pdb|4A60|A Chain A, Crystal Structure Of Human Testis-Specific Fatty Acid Binding Protein 9 (Fabp9) Length = 154 Back     alignment and structure
>pdb|2POA|A Chain A, Schistosoma Mansoni Sm14 Fatty Acid-Binding Protein: Improvement Of Protein Stability By Substitution Of The Single Cys62 Residue Length = 133 Back     alignment and structure
>pdb|2QM9|A Chain A, Troglitazone Bound To Fatty Acid Binding Protein 4 Length = 155 Back     alignment and structure
>pdb|2ANS|A Chain A, Adipocyte Lipid Binding Protein Complexed With 1-anilino-8-naphthalene Sulfonate Length = 131 Back     alignment and structure
>pdb|1A2D|A Chain A, Pyridoxamine Modified Murine Adipocyte Lipid Binding Protein Length = 131 Back     alignment and structure
>pdb|1VYF|A Chain A, Schistosoma Mansoni Fatty Acid Binding Protein In Complex With Oleic Acid Length = 135 Back     alignment and structure
>pdb|1XCA|A Chain A, Apo-Cellular Retinoic Acid Binding Protein Ii Length = 137 Back     alignment and structure
>pdb|1LPJ|A Chain A, Human Crbp Iv Length = 133 Back     alignment and structure
>pdb|3CR6|A Chain A, Crystal Structure Of The R132k:r111l:a32e Mutant Of Cellular Retinoic Acid Binding Protein Type Ii Complexed With C15-Aldehyde (A Retinal Analog) At 1.22 Anstrom Resolution. Length = 137 Back     alignment and structure
>pdb|1EII|A Chain A, Nmr Structure Of Holo Cellular Retinol-Binding Protein Ii Length = 134 Back     alignment and structure
>pdb|2FRS|A Chain A, Crystal Structure Of The F15w Mutant Of Apo-Cellular Retinoic Acid Binding Protein Type Ii At 1.51 Angstroms Resolution Length = 137 Back     alignment and structure
>pdb|2CBS|A Chain A, Cellular Retinoic Acid Binding Protein Ii In Complex With A Synthetic Retinoic Acid (Ro-13 6307) Length = 137 Back     alignment and structure
>pdb|3F9D|A Chain A, Crystal Structure Of The R132k:r111l:t54e Mutant Of Cellular Retinoic Acid-Binding Protein Ii Complexed With C15- Aldehyde (A Retinal Analog) At 2.00 Angstrom Resolution Length = 137 Back     alignment and structure
>pdb|1CBR|A Chain A, Crystal Structure Of Cellular Retinoic-Acid-Binding Proteins I And Ii In Complex With All-Trans-Retinoic Acid And A Synthetic Retinoid Length = 136 Back     alignment and structure
>pdb|2G7B|A Chain A, Crystal Structure Of The R132k:r111l:l121e Mutant Of Cellular Retinoic Acid Binding Protein Type Ii In Complex With All-trans-retinal At 1.18 Angstroms Resolution Length = 137 Back     alignment and structure
>pdb|1AB0|A Chain A, C1gV32DF57H MUTANT OF MURINE ADIPOCYTE LIPID BINDING Protein At Ph 4.5 Length = 131 Back     alignment and structure
>pdb|3FA7|A Chain A, Crystal Structure Of The Apo R132k:r111l:l121e:r59e Mutant Of Cellular Retinoic Acid-Binding Protein Ii At 1.90 Angstrom Resolution Length = 137 Back     alignment and structure
>pdb|1ACD|A Chain A, V32dF57H MUTANT OF MURINE ADIPOCYTE LIPID BINDING PROTEIN Length = 131 Back     alignment and structure
>pdb|3F8A|A Chain A, Crystal Structure Of The R132k:r111l:l121e:r59w Mutant Of Cellular Retinoic Acid-Binding Protein Type Ii Complexed With C15-Aldehyde (A Retinal Analog) At 1.95 Anstrom Resolution. Length = 137 Back     alignment and structure
>pdb|3FA8|A Chain A, Crystal Structure Of The Apo R132k:y134f:r111l:l121e Mutant Of Cellular Retinoic Acid-Binding Protein Ii At 1.78 Anstrom Resolution Length = 137 Back     alignment and structure
>pdb|2G78|A Chain A, Crystal Structure Of The R132k:y134f Mutant Of Cellular Retinoic Acid Binding Protein Type Ii In Complex With All- Trans-Retinoic Acid At 1.70 Angstroms Resolution Length = 137 Back     alignment and structure
>pdb|3I17|B Chain B, Crystal Structure Of The Apo R132k:l121e Mutant Of Cellular Retinoic Acid-Binding Protein Ii At 1.68 Anstrom Resolution Length = 137 Back     alignment and structure
>pdb|4EXZ|A Chain A, Crystal Structure Of The Q108k:k40l Mutant Of Cellular Retinol Binding Protein Type Ii In Complex With All-Trans-Retinal At 1.7 Angstrom Resolution Length = 133 Back     alignment and structure
>pdb|3FA9|A Chain A, Crystal Structure Of The Apo R132k:y134f:r111l:l121d Mutant Of Cellular Retinoic Acid-Binding Protein Ii At 1.94 Angstrom Resolution Length = 137 Back     alignment and structure
>pdb|4GKC|A Chain A, Crystal Structure Of Q108k:k40l:t51v:t53c:r58w:t29l:y19w:q4a Mutant Of Cellular Retinol Binding Protein Ii Complex With All-Trans-Retinal At 1.33 Length = 133 Back     alignment and structure
>pdb|4EEJ|A Chain A, Crystal Structure Of The Q108k:k40l:t51v:t53c:y19w:r58w:t29l:q4r Mutant Of Cellular Retinol Binding Protein Type Ii In Complex With All-Trans-Retinal At 1.5 Angstrom Resolution Length = 133 Back     alignment and structure
>pdb|3D95|A Chain A, Crystal Structure Of The R132k:y134f:r111l:l121e:t54v Mutant Of Apo-Cellular Retinoic Acid Binding Protein Type Ii At 1.20 Angstroms Resolution Length = 137 Back     alignment and structure
>pdb|4EFG|A Chain A, Crystal Structure Of The Q108k:k40l:t51v:t53c:y19w:r58w:t29l Mutant Of Cellular Retinol Binding Protein Type Ii In Complex With All-Trans- Retinal At 1.58 Angstrom Resolution Length = 133 Back     alignment and structure
>pdb|4EDE|A Chain A, Crystal Structure Of The Q108k:k40l:t51v:t53c:y19w:r58w:t29l:a33w Mutant Of Cellular Retinol Binding Protein Type Ii In Complex With All-Trans-Retinal At 1.4 Angstrom Resolution Length = 133 Back     alignment and structure
>pdb|2RCQ|A Chain A, Crystal Strucure Of Human Apo Cellular Retinol Binding Protein Ii (Crbp-Ii) Length = 141 Back     alignment and structure
>pdb|3FA6|A Chain A, Crystal Structure Of The R132k:y134f:r111l:l121d:t54v Mutant Of Cellular Retinoic Acid-Binding Protein Ii Complexed With C15-Aldehyde (A Retinal Analog) At 1.54 Angstrom Resolution Length = 137 Back     alignment and structure
>pdb|1KQW|A Chain A, Crystal Structure Of Holo-Crbp From Zebrafish Length = 134 Back     alignment and structure
>pdb|1JJJ|A Chain A, Solution Structure Of Recombinant Human Epidermal-Type Fatty Acid Binding Protein Length = 135 Back     alignment and structure
>pdb|1GGL|A Chain A, Human Cellular Retinol Binding Protein Iii Length = 134 Back     alignment and structure
>pdb|1JBH|A Chain A, Solution Structure Of Cellular Retinol Binding Protein Type- I In The Ligand-Free State Length = 135 Back     alignment and structure
>pdb|1CRB|A Chain A, Crystallographic Studies On A Family Of Cellular Lipophilic Transport Proteins. Refinement Of P2 Myelin Protein And The Structure Determination And Refinement Of Cellular Retinol-Binding Protein In Complex With All-Trans-Retinol Length = 134 Back     alignment and structure
>pdb|1MDC|A Chain A, Crystallization, Structure Determination And Least-Squares Refinement To 1.75 Angstroms Resolution Of The Fatty-Acid-Binding Protein Isolated From Manduca Sexta L Length = 132 Back     alignment and structure
>pdb|1T8V|A Chain A, The Nmr Structure Of D34a I-Fabp: Implications For The Determinants Of Ligand Binding Stoichiometry Length = 131 Back     alignment and structure
>pdb|1IFC|A Chain A, Refinement Of The Structure Of Recombinant Rat Intestinal Fatty Acid- Binding Apoprotein At 1.2 Angstroms Resolution Length = 132 Back     alignment and structure
>pdb|1AEL|A Chain A, Nmr Structure Of Apo Intestinal Fatty Acid-Binding Protein, 20 Structures Length = 131 Back     alignment and structure
>pdb|1LFO|A Chain A, Liver Fatty Acid Binding Protein-Oleate Complex Length = 128 Back     alignment and structure
>pdb|2JU3|A Chain A, Solution-State Nmr Structures Of Apo-Lfabp (Liver Fatty Acid-Binding Protein) Length = 127 Back     alignment and structure
>pdb|1P6P|A Chain A, Crystal Structure Of Toad Liver Basic Fatty Acid-Binding Protein Length = 125 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query107
1ftp_A133 Muscle fatty acid binding protein; binding protein 4e-32
1o8v_A134 Fatty acid binding protein homolog; lipid binding 2e-31
1fdq_A131 Fatty acid-binding protein, brain; omega-3, long c 2e-29
3p6d_A139 Fatty acid-binding protein, adipocyte; lipocalin, 2e-29
3q6l_A152 Fatty acid-binding protein, adipocyte; lipid chape 2e-29
2lba_A136 BABP protein; ileal bIle acid binding protein, lip 4e-29
1mdc_A132 Insect fatty acid binding protein; HET: PLM; 1.75A 7e-29
3ppt_A133 Sodium-calcium exchanger; fatty acid transporter, 8e-29
3rsw_A158 Fatty acid-binding protein, heart; lipid carrier, 1e-28
1eal_A127 Gastrotropin, ileal lipid binding protein; intrace 1e-28
2wut_A133 Myelin P2 protein; transport, lipid-binding, fatty 3e-28
2a0a_A131 DER F 13; beta barrel, helix, allergen; NMR {Derma 6e-28
2qo4_A126 Liver-basic fatty acid binding protein; liver bIle 1e-27
1ifc_A132 Intestinal fatty acid binding protein; lipid-bindi 1e-27
1b56_A135 Fatty acid binding protein; lipid-binding, fatty a 1e-27
4a60_A154 Fatty acid-binding protein 9 testis lipid-binding 2e-27
1lpj_A133 Retinol-binding protein IV, cellular; cellular ret 2e-27
1p6p_A125 Fatty acid-binding protein, liver; beta barrel, li 2e-27
1mvg_A125 Liver basic fatty acid binding protein; beta-barre 5e-27
3vg7_A132 Fatty acid-binding protein, liver; lfabp, S-SAD, c 9e-27
2rcq_A141 CRBP-II, retinol-binding protein II, cellular; cel 1e-26
2f73_A149 L-FABP, fatty acid-binding protein, liver; structu 2e-26
3elx_A138 Ileal bIle acid-binding protein; ileal bIle acid-b 3e-26
1ggl_A134 Protein (cellular retinol-binding protein III); ca 3e-26
1crb_A134 Cellular retinol binding protein; cellular lipophi 5e-26
1vyf_A135 SM14, 14 kDa fatty acid binding protein; transport 2e-25
2g7b_A137 Cellular retinoic acid-binding protein 2; crabpii, 8e-22
>1ftp_A Muscle fatty acid binding protein; binding protein(fatty acid); 2.20A {Schistocerca gregaria} SCOP: b.60.1.2 PDB: 2flj_A* Length = 133 Back     alignment and structure
 Score =  108 bits (271), Expect = 4e-32
 Identities = 57/106 (53%), Positives = 70/106 (66%), Gaps = 1/106 (0%)

Query: 1   VGLITRKVGASVSPVLELEKDDSGTYTLHSNSTFKNHAIKFKIGEEFDEETPDGRKVKSV 60
           VG I RK G ++SPV+ELE  D   + L S +  KN    FK+GEEFDEET DGRKVKS 
Sbjct: 26  VGAIERKAGLALSPVIELEILDGDKFKLTSKTAIKNTEFTFKLGEEFDEETLDGRKVKST 85

Query: 61  ITIDGD-TMTHIQKGDKETKIIRVFSDDEVKMTLTVDDIVCTRIYK 105
           IT DG   + H QKGD  T IIR FS ++  +T+ + D+V TRIYK
Sbjct: 86  ITQDGPNKLVHEQKGDHPTIIIREFSKEQCVITIKLGDLVATRIYK 131


>1o8v_A Fatty acid binding protein homolog; lipid binding protein, hydatid disease, fatty-acid transport; HET: PLM; 1.60A {Echinococcus granulosus} SCOP: b.60.1.2 Length = 134 Back     alignment and structure
>1fdq_A Fatty acid-binding protein, brain; omega-3, long chain poly unsaturated fatty acid, lipid binding protein; HET: HXA; 2.10A {Homo sapiens} SCOP: b.60.1.2 PDB: 1fe3_A* 1jjx_A Length = 131 Back     alignment and structure
>3p6d_A Fatty acid-binding protein, adipocyte; lipocalin, beta barrel, lipid BI protein; HET: ZGB; 1.06A {Homo sapiens} PDB: 3p6c_A* 3p6e_A* 3p6f_A* 3p6g_A* 3p6h_A* 3rzy_A 2hnx_A* 3fr4_A* 2nnq_A* 1tow_A* 1tou_A* 3fr2_A* 3fr5_A* 1adl_A* 1alb_A 1lib_A 1lic_A* 1lid_A* 1lie_A* 1lif_A* ... Length = 139 Back     alignment and structure
>3q6l_A Fatty acid-binding protein, adipocyte; lipid chaperone, lipid binding protein; 1.40A {Homo sapiens} PDB: 2q9s_A* 2qm9_A* Length = 152 Back     alignment and structure
>2lba_A BABP protein; ileal bIle acid binding protein, lipid binding protein; HET: CHO; NMR {Gallus gallus} Length = 136 Back     alignment and structure
>1mdc_A Insect fatty acid binding protein; HET: PLM; 1.75A {Manduca sexta} SCOP: b.60.1.2 Length = 132 Back     alignment and structure
>3ppt_A Sodium-calcium exchanger; fatty acid transporter, lipid binding proteins, squid nerve, regulatory factor, beta-sandwich, fatty acid; HET: PAM; 1.28A {Loligo pealei} PDB: 3pp6_A* Length = 133 Back     alignment and structure
>3rsw_A Fatty acid-binding protein, heart; lipid carrier, molecular chaperone, heart fatty acid binding type 2 diabetes, atherosclerosis, chaperone; 2.60A {Homo sapiens} PDB: 1g5w_A 1hmr_A* 1hms_A* 1hmt_A* 2hmb_A* 1bwy_A Length = 158 Back     alignment and structure
>1eal_A Gastrotropin, ileal lipid binding protein; intracellular lipid binding protein, bIle acid binding, ileal epithelium, fatty acid binding protein; NMR {Sus scrofa} SCOP: b.60.1.2 PDB: 1eio_A* 1o1u_A 1o1v_A* Length = 127 Back     alignment and structure
>2wut_A Myelin P2 protein; transport, lipid-binding, fatty acid binding protein, peripheral membrane protein; HET: PLM; 1.85A {Homo sapiens} PDB: 1pmp_A* Length = 133 Back     alignment and structure
>2a0a_A DER F 13; beta barrel, helix, allergen; NMR {Dermatophagoides farinae} SCOP: b.60.1.2 Length = 131 Back     alignment and structure
>2qo4_A Liver-basic fatty acid binding protein; liver bIle acid-binding protein, BABP, fatty acid-binding PR FABP, cholic acid cholate, bIle acid; HET: CHD; 1.50A {Danio rerio} PDB: 2qo6_A* 2qo5_A* 2ftb_A* 2ft9_A* Length = 126 Back     alignment and structure
>1ifc_A Intestinal fatty acid binding protein; lipid-binding protein; 1.19A {Rattus norvegicus} SCOP: b.60.1.2 PDB: 1ael_A 1icm_A* 1ifb_A 1ure_A* 2ifb_A* 3akn_A* 1icn_A* 1t8v_A 1dc9_A 1a57_A 1kzx_A 1kzw_A 3akm_A* 3ifb_A 1sa8_A Length = 132 Back     alignment and structure
>1b56_A Fatty acid binding protein; lipid-binding, fatty acid transport, beta barrel, lipid binding protein; HET: PLM; 2.05A {Homo sapiens} SCOP: b.60.1.2 PDB: 1jjj_A Length = 135 Back     alignment and structure
>4a60_A Fatty acid-binding protein 9 testis lipid-binding protein, TLBP, testis-type fatty...; transport protein; 1.53A {Homo sapiens} PDB: 3nr3_A* 1yiv_A* Length = 154 Back     alignment and structure
>1lpj_A Retinol-binding protein IV, cellular; cellular retinol-binding protein, CRBP, vitamin A, ILBPS, transport protein; 2.00A {Homo sapiens} SCOP: b.60.1.2 Length = 133 Back     alignment and structure
>1p6p_A Fatty acid-binding protein, liver; beta barrel, lipid binding protein; 2.50A {Bufo arenarum} SCOP: b.60.1.2 Length = 125 Back     alignment and structure
>1mvg_A Liver basic fatty acid binding protein; beta-barrel, calycin, ten antiparallel beta strands, helix- turn-helix motif, transport protein; NMR {Gallus gallus} SCOP: b.60.1.2 PDB: 1tvq_A 1tw4_A* 1zry_A 2jn3_A* 2k62_A* Length = 125 Back     alignment and structure
>3vg7_A Fatty acid-binding protein, liver; lfabp, S-SAD, copper kalpha, palmitic acid, lipid binding PR; HET: PLM; 1.44A {Homo sapiens} PDB: 3b2i_A* 3b2j_A* 3b2k_A* 3b2l_A* 3stk_A* 3stm_X* 3stn_A 3vg2_A* 3vg3_A* 3vg4_A* 3vg5_A* 3vg6_A* 3b2h_A* 2py1_A 2l67_A 2l68_A 2lkk_A* 2ju3_A 2ju7_A 2ju8_A* ... Length = 132 Back     alignment and structure
>2rcq_A CRBP-II, retinol-binding protein II, cellular; cellular retinol binding protein II, lipid-binding protein, X-RAY, cytoplasm, transport, vitamin A; HET: TLA; 1.20A {Homo sapiens} PDB: 2rct_A* 1b4m_A 1eii_A* 1opa_A 1opb_A* 1kqw_A* 1kqx_A Length = 141 Back     alignment and structure
>2f73_A L-FABP, fatty acid-binding protein, liver; structural genomics, structural genomics consortium, SGC, lipid binding protein; 2.50A {Homo sapiens} SCOP: b.60.1.2 Length = 149 Back     alignment and structure
>3elx_A Ileal bIle acid-binding protein; ileal bIle acid-bindign protein, zebrafish, cholic acid, LIP binding, transport, lipid binding protein; 1.60A {Danio rerio} PDB: 3elz_A* 3em0_A* Length = 138 Back     alignment and structure
>1ggl_A Protein (cellular retinol-binding protein III); carrier, transport protein; 2.31A {Homo sapiens} SCOP: b.60.1.2 Length = 134 Back     alignment and structure
>1crb_A Cellular retinol binding protein; cellular lipophilic transport protein; HET: RTL; 2.10A {Rattus rattus} SCOP: b.60.1.2 PDB: 1mx7_A 1mx8_A* 1jbh_A 1kgl_A* Length = 134 Back     alignment and structure
>1vyf_A SM14, 14 kDa fatty acid binding protein; transport protein; HET: OLA; 1.85A {Schistosoma mansoni} SCOP: b.60.1.2 PDB: 1vyg_A* 2poa_A Length = 135 Back     alignment and structure
>2g7b_A Cellular retinoic acid-binding protein 2; crabpii, retinoids, beta barrel, crystallography, X-RAY, high resolution, schiff base; HET: AZE; 1.18A {Homo sapiens} PDB: 3d97_A* 3fa8_A 3i17_B 3fa7_A* 3fa9_A 3d95_A 3cwk_A 3f8a_A* 3fep_A* 3fek_B 3fa6_A 1bm5_A 1xca_A 3fel_A* 3f9d_A* 3cr6_A* 3fen_A 1blr_A 1cbq_A* 1cbs_A* ... Length = 137 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query107
4a1y_A133 Myelin P2 protein; transport; HET: PLM; 1.20A {Hom 100.0
3p6d_A139 Fatty acid-binding protein, adipocyte; lipocalin, 100.0
3ppt_A133 Sodium-calcium exchanger; fatty acid transporter, 100.0
3q6l_A152 Fatty acid-binding protein, adipocyte; lipid chape 100.0
4a60_A154 Fatty acid-binding protein 9 testis lipid-binding 100.0
1b56_A135 Fatty acid binding protein; lipid-binding, fatty a 100.0
1ifc_A132 Intestinal fatty acid binding protein; lipid-bindi 100.0
1fdq_A131 Fatty acid-binding protein, brain; omega-3, long c 100.0
3rsw_A158 Fatty acid-binding protein, heart; lipid carrier, 100.0
1o8v_A134 Fatty acid binding protein homolog; lipid binding 100.0
1vyf_A135 SM14, 14 kDa fatty acid binding protein; transport 100.0
1ftp_A133 Muscle fatty acid binding protein; binding protein 100.0
1lpj_A133 Retinol-binding protein IV, cellular; cellular ret 100.0
3vg7_A132 Fatty acid-binding protein, liver; lfabp, S-SAD, c 100.0
1ggl_A134 Protein (cellular retinol-binding protein III); ca 100.0
2a0a_A131 DER F 13; beta barrel, helix, allergen; NMR {Derma 100.0
1crb_A134 Cellular retinol binding protein; cellular lipophi 100.0
2rcq_A141 CRBP-II, retinol-binding protein II, cellular; cel 100.0
1p6p_A125 Fatty acid-binding protein, liver; beta barrel, li 100.0
1mvg_A125 Liver basic fatty acid binding protein; beta-barre 100.0
2qo4_A126 Liver-basic fatty acid binding protein; liver bIle 100.0
2g7b_A137 Cellular retinoic acid-binding protein 2; crabpii, 100.0
1mdc_A132 Insect fatty acid binding protein; HET: PLM; 1.75A 100.0
3elx_A138 Ileal bIle acid-binding protein; ileal bIle acid-b 100.0
2f73_A149 L-FABP, fatty acid-binding protein, liver; structu 100.0
1eal_A127 Gastrotropin, ileal lipid binding protein; intrace 100.0
2lba_A136 BABP protein; ileal bIle acid binding protein, lip 100.0
>4a1y_A Myelin P2 protein; transport; HET: PLM; 1.20A {Homo sapiens} PDB: 2wut_A* 4a1h_A* 1pmp_A* 1yiv_A* Back     alignment and structure
Probab=100.00  E-value=3.1e-40  Score=221.35  Aligned_cols=106  Identities=37%  Similarity=0.658  Sum_probs=104.0

Q ss_pred             CChhhhhhhhcCCCeEEEEEcCCccEEEEEeecCceeEEEEEcCceEEEeCCCCceEEEEEEEeCCEEEEEEeCCcc-eE
Q psy15136          1 VGLITRKVGASVSPVLELEKDDSGTYTLHSNSTFKNHAIKFKIGEEFDEETPDGRKVKSVITIDGDTMTHIQKGDKE-TK   79 (107)
Q Consensus         1 v~~~~Rk~~~~~~p~~~I~~~Gd~~~~i~~~t~~kt~~~~F~lGeefe~~~~dG~~~k~t~t~eg~kLv~~~~~~~~-~~   79 (107)
                      ||+++||+|+.++|+++|+|+|| +|+|++.+++++.+++|+||||||+.++||+++|++++||||+|+++|+++|+ .+
T Consensus        27 v~~~~Rk~a~~~kp~~~I~~~Gd-~~tikt~s~~k~~~~~F~lGeEfee~t~dgrk~ks~vt~eg~kLv~~qk~~gk~~~  105 (133)
T 4a1y_A           27 VGLATRKLGNLAKPTVIISKKGD-IITIRTESTFKNTEISFQLGQEFEETTADNRKTKSIVTLQRGSLNQVQRWDGKETT  105 (133)
T ss_dssp             CCHHHHHHHHHCCCEEEEEEETT-EEEEEEEETTEEEEEEECTTBCEEEECTTCCEEEEEEEEETTEEEEEEEETTEEEE
T ss_pred             CCHHHHHhHhhCCCeEEEEECCC-EEEEEEecCCccEEEEEEcCCcEEEEcCCCCEEEEEEEEcCCEEEEEEeCCCCeEE
Confidence            78999999999999999999999 99999999999999999999999999999999999999999999999999988 99


Q ss_pred             EEEEEECCEEEEEEEECCEEEEEEEEeC
Q psy15136         80 IIRVFSDDEVKMTLTVDDIVCTRIYKPL  107 (107)
Q Consensus        80 ~~rev~g~~l~~t~~~~~v~~kR~ykr~  107 (107)
                      ++||++||+|+++++++||+|+|+|+|+
T Consensus       106 ~~Re~~~~~lv~t~t~~~v~~~R~ykkv  133 (133)
T 4a1y_A          106 IKRKLVNGKMVAECKMKGVVCTRIYEKV  133 (133)
T ss_dssp             EEEEEETTEEEEEEEETTEEEEEEEEEC
T ss_pred             EEEEEECCEEEEEEEECCEEEEEEEEEC
Confidence            9999999999999999999999999996



>3p6d_A Fatty acid-binding protein, adipocyte; lipocalin, beta barrel, lipid BI protein; HET: ZGB; 1.06A {Homo sapiens} SCOP: b.60.1.2 PDB: 3p6c_A* 3p6e_A* 3p6f_A* 3p6g_A* 3p6h_A* 3rzy_A 2hnx_A* 3fr4_A* 2nnq_A* 1tow_A* 1tou_A* 3fr2_A* 3fr5_A* 1adl_A* 1alb_A 1lib_A 1lic_A* 1lid_A* 1lie_A* 1lif_A* ... Back     alignment and structure
>3ppt_A Sodium-calcium exchanger; fatty acid transporter, lipid binding proteins, squid nerve, regulatory factor, beta-sandwich, fatty acid; HET: PAM; 1.28A {Loligo pealei} SCOP: b.60.1.0 PDB: 3pp6_A* Back     alignment and structure
>3q6l_A Fatty acid-binding protein, adipocyte; lipid chaperone, lipid binding protein; 1.40A {Homo sapiens} PDB: 2q9s_A* 2qm9_A* Back     alignment and structure
>4a60_A Fatty acid-binding protein 9 testis lipid-binding protein, TLBP, testis-type fatty...; transport protein; 1.53A {Homo sapiens} PDB: 3nr3_A* Back     alignment and structure
>1b56_A Fatty acid binding protein; lipid-binding, fatty acid transport, beta barrel, lipid binding protein; HET: PLM; 2.05A {Homo sapiens} SCOP: b.60.1.2 PDB: 1jjj_A Back     alignment and structure
>1ifc_A Intestinal fatty acid binding protein; lipid-binding protein; 1.19A {Rattus norvegicus} SCOP: b.60.1.2 PDB: 1ael_A 1icm_A* 1ifb_A 1ure_A* 2ifb_A* 3akn_A* 1icn_A* 1t8v_A 1dc9_A 1a57_A 1kzx_A 1kzw_A 3akm_A* 3ifb_A 1sa8_A Back     alignment and structure
>1fdq_A Fatty acid-binding protein, brain; omega-3, long chain poly unsaturated fatty acid, lipid binding protein; HET: HXA; 2.10A {Homo sapiens} SCOP: b.60.1.2 PDB: 1fe3_A* 1jjx_A Back     alignment and structure
>3rsw_A Fatty acid-binding protein, heart; lipid carrier, molecular chaperone, heart fatty acid binding type 2 diabetes, atherosclerosis, chaperone; 2.60A {Homo sapiens} PDB: 1g5w_A 1hmr_A* 1hms_A* 1hmt_A* 2hmb_A* 1bwy_A Back     alignment and structure
>1o8v_A Fatty acid binding protein homolog; lipid binding protein, hydatid disease, fatty-acid transport; HET: PLM; 1.60A {Echinococcus granulosus} SCOP: b.60.1.2 Back     alignment and structure
>1vyf_A SM14, 14 kDa fatty acid binding protein; transport protein; HET: OLA; 1.85A {Schistosoma mansoni} SCOP: b.60.1.2 PDB: 1vyg_A* 2poa_A Back     alignment and structure
>1ftp_A Muscle fatty acid binding protein; binding protein(fatty acid); 2.20A {Schistocerca gregaria} SCOP: b.60.1.2 PDB: 2flj_A* Back     alignment and structure
>1lpj_A Retinol-binding protein IV, cellular; cellular retinol-binding protein, CRBP, vitamin A, ILBPS, transport protein; 2.00A {Homo sapiens} SCOP: b.60.1.2 Back     alignment and structure
>3vg7_A Fatty acid-binding protein, liver; lfabp, S-SAD, copper kalpha, palmitic acid, lipid binding PR; HET: PLM; 1.44A {Homo sapiens} PDB: 3b2i_A* 3b2j_A* 3b2k_A* 3b2l_A* 3stk_A* 3stm_X* 3stn_A 3vg2_A* 3vg3_A* 3vg4_A* 3vg5_A* 3vg6_A* 3b2h_A* 2py1_A 2l67_A 2l68_A 2lkk_A* 2ju3_A 2ju7_A 2ju8_A* ... Back     alignment and structure
>1ggl_A Protein (cellular retinol-binding protein III); carrier, transport protein; 2.31A {Homo sapiens} SCOP: b.60.1.2 Back     alignment and structure
>2a0a_A DER F 13; beta barrel, helix, allergen; NMR {Dermatophagoides farinae} SCOP: b.60.1.2 Back     alignment and structure
>1crb_A Cellular retinol binding protein; cellular lipophilic transport protein; HET: RTL; 2.10A {Rattus rattus} SCOP: b.60.1.2 PDB: 1mx7_A 1mx8_A* 1jbh_A 1kgl_A* Back     alignment and structure
>2rcq_A CRBP-II, retinol-binding protein II, cellular; cellular retinol binding protein II, lipid-binding protein, X-RAY, cytoplasm, transport, vitamin A; HET: TLA; 1.20A {Homo sapiens} PDB: 2rct_A* 1b4m_A 1eii_A* 1opa_A 1opb_A* 1kqw_A* 1kqx_A Back     alignment and structure
>1p6p_A Fatty acid-binding protein, liver; beta barrel, lipid binding protein; 2.50A {Bufo arenarum} SCOP: b.60.1.2 Back     alignment and structure
>1mvg_A Liver basic fatty acid binding protein; beta-barrel, calycin, ten antiparallel beta strands, helix- turn-helix motif, transport protein; NMR {Gallus gallus} SCOP: b.60.1.2 PDB: 1tvq_A 1tw4_A* 1zry_A 2jn3_A* 2k62_A* Back     alignment and structure
>2qo4_A Liver-basic fatty acid binding protein; liver bIle acid-binding protein, BABP, fatty acid-binding PR FABP, cholic acid cholate, bIle acid; HET: CHD; 1.50A {Danio rerio} PDB: 2qo6_A* 2qo5_A* 2ftb_A* 2ft9_A* Back     alignment and structure
>2g7b_A Cellular retinoic acid-binding protein 2; crabpii, retinoids, beta barrel, crystallography, X-RAY, high resolution, schiff base; HET: AZE; 1.18A {Homo sapiens} PDB: 3d97_A* 3fa8_A 3i17_B 3fa7_A* 3fa9_A 3d95_A 3cwk_A 3f8a_A* 3fep_A* 3fek_B 3fa6_A 1bm5_A 1xca_A 3fel_A* 3f9d_A* 3cr6_A* 3fen_A 1blr_A 1cbq_A* 1cbs_A* ... Back     alignment and structure
>1mdc_A Insect fatty acid binding protein; HET: PLM; 1.75A {Manduca sexta} SCOP: b.60.1.2 Back     alignment and structure
>3elx_A Ileal bIle acid-binding protein; ileal bIle acid-bindign protein, zebrafish, cholic acid, LIP binding, transport, lipid binding protein; 1.60A {Danio rerio} SCOP: b.60.1.0 PDB: 3elz_A* 3em0_A* Back     alignment and structure
>2f73_A L-FABP, fatty acid-binding protein, liver; structural genomics, structural genomics consortium, SGC, lipid binding protein; 2.50A {Homo sapiens} SCOP: b.60.1.2 Back     alignment and structure
>1eal_A Gastrotropin, ileal lipid binding protein; intracellular lipid binding protein, bIle acid binding, ileal epithelium, fatty acid binding protein; NMR {Sus scrofa} SCOP: b.60.1.2 PDB: 1eio_A* 1o1u_A 1o1v_A* Back     alignment and structure
>2lba_A BABP protein; ileal bIle acid binding protein, lipid binding protein; HET: CHO; NMR {Gallus gallus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 107
d1ftpa_133 b.60.1.2 (A:) Fatty acid-binding protein {Desert l 1e-31
d1o8va_133 b.60.1.2 (A:) Fatty acid-binding protein homolog 1 3e-31
d1fdqa_131 b.60.1.2 (A:) Brain fatty acid binding protein {Hu 2e-30
d1lpja_133 b.60.1.2 (A:) Cellular retinol-binding protein IV 2e-30
d2hnxa1131 b.60.1.2 (A:1-131) Adipocyte lipid-binding protein 4e-30
d1mdca_131 b.60.1.2 (A:) Fatty acid-binding protein {Tobacco 6e-30
d1hmsa_131 b.60.1.2 (A:) Muscle fatty acid binding protein (m 2e-29
d2a0aa1131 b.60.1.2 (A:1-131) Der f 13 allergen {House dust m 3e-29
d1yiva1131 b.60.1.2 (A:1-131) P2 myelin protein {Horse (Equus 4e-29
d1ggla_134 b.60.1.2 (A:) Cellular retinol-binding protein III 2e-28
d1kqwa_134 b.60.1.2 (A:) Cellular retinol-binding protein II 3e-28
d1ifca_131 b.60.1.2 (A:) Intestinal fatty acid binding protei 4e-28
d1b56a_133 b.60.1.2 (A:) Epidermal fatty acid binding protein 6e-28
d1crba_134 b.60.1.2 (A:) Cellular retinol-binding protein II 7e-28
d1lfoa_127 b.60.1.2 (A:) Liver fatty acid binding protein {Ra 1e-27
d1p6pa_125 b.60.1.2 (A:) Liver basic fatty acid binding prote 2e-27
d1o1va_127 b.60.1.2 (A:) Ileal lipid-binding protein {Human ( 2e-26
d1tw4a_125 b.60.1.2 (A:) Liver basic fatty acid binding prote 9e-26
d1vyfa_135 b.60.1.2 (A:) Fatty acid-binding protein Sm14 {Blo 8e-25
d2fs6a1136 b.60.1.2 (A:2-137) Cellular retinoic-acid-binding 2e-23
>d1ftpa_ b.60.1.2 (A:) Fatty acid-binding protein {Desert locust (Schistocerca gregaria) [TaxId: 7010]} Length = 133 Back     information, alignment and structure

class: All beta proteins
fold: Lipocalins
superfamily: Lipocalins
family: Fatty acid binding protein-like
domain: Fatty acid-binding protein
species: Desert locust (Schistocerca gregaria) [TaxId: 7010]
 Score =  106 bits (265), Expect = 1e-31
 Identities = 57/106 (53%), Positives = 70/106 (66%), Gaps = 1/106 (0%)

Query: 1   VGLITRKVGASVSPVLELEKDDSGTYTLHSNSTFKNHAIKFKIGEEFDEETPDGRKVKSV 60
           VG I RK G ++SPV+ELE  D   + L S +  KN    FK+GEEFDEET DGRKVKS 
Sbjct: 26  VGAIERKAGLALSPVIELEILDGDKFKLTSKTAIKNTEFTFKLGEEFDEETLDGRKVKST 85

Query: 61  ITIDGDT-MTHIQKGDKETKIIRVFSDDEVKMTLTVDDIVCTRIYK 105
           IT DG   + H QKGD  T IIR FS ++  +T+ + D+V TRIYK
Sbjct: 86  ITQDGPNKLVHEQKGDHPTIIIREFSKEQCVITIKLGDLVATRIYK 131


>d1o8va_ b.60.1.2 (A:) Fatty acid-binding protein homolog 1 {Flat worm (Echinococcus granulosus) [TaxId: 6210]} Length = 133 Back     information, alignment and structure
>d1fdqa_ b.60.1.2 (A:) Brain fatty acid binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 131 Back     information, alignment and structure
>d1lpja_ b.60.1.2 (A:) Cellular retinol-binding protein IV {Human (Homo sapiens) [TaxId: 9606]} Length = 133 Back     information, alignment and structure
>d2hnxa1 b.60.1.2 (A:1-131) Adipocyte lipid-binding protein, ALBP {Human (Homo sapiens) [TaxId: 9606]} Length = 131 Back     information, alignment and structure
>d1mdca_ b.60.1.2 (A:) Fatty acid-binding protein {Tobacco hornworm (Manduca sexta) [TaxId: 7130]} Length = 131 Back     information, alignment and structure
>d1hmsa_ b.60.1.2 (A:) Muscle fatty acid binding protein (m-fabp) {Human (Homo sapiens) [TaxId: 9606]} Length = 131 Back     information, alignment and structure
>d2a0aa1 b.60.1.2 (A:1-131) Der f 13 allergen {House dust mite (Dermatophagoides farinae) [TaxId: 6954]} Length = 131 Back     information, alignment and structure
>d1yiva1 b.60.1.2 (A:1-131) P2 myelin protein {Horse (Equus caballus) [TaxId: 9796]} Length = 131 Back     information, alignment and structure
>d1ggla_ b.60.1.2 (A:) Cellular retinol-binding protein III {Human (Homo sapiens) [TaxId: 9606]} Length = 134 Back     information, alignment and structure
>d1kqwa_ b.60.1.2 (A:) Cellular retinol-binding protein II (CRBP) {Zebrafish (Danio rerio) [TaxId: 7955]} Length = 134 Back     information, alignment and structure
>d1ifca_ b.60.1.2 (A:) Intestinal fatty acid binding protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 131 Back     information, alignment and structure
>d1b56a_ b.60.1.2 (A:) Epidermal fatty acid binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 133 Back     information, alignment and structure
>d1crba_ b.60.1.2 (A:) Cellular retinol-binding protein II (CRBP) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 134 Back     information, alignment and structure
>d1lfoa_ b.60.1.2 (A:) Liver fatty acid binding protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 127 Back     information, alignment and structure
>d1p6pa_ b.60.1.2 (A:) Liver basic fatty acid binding protein, LB_FABP {Argentine common toad (Bufo arenarum) [TaxId: 38577]} Length = 125 Back     information, alignment and structure
>d1o1va_ b.60.1.2 (A:) Ileal lipid-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 127 Back     information, alignment and structure
>d1tw4a_ b.60.1.2 (A:) Liver basic fatty acid binding protein, LB_FABP {Chicken (Gallus gallus) [TaxId: 9031]} Length = 125 Back     information, alignment and structure
>d1vyfa_ b.60.1.2 (A:) Fatty acid-binding protein Sm14 {Blood fluke (Schistosoma mansoni) [TaxId: 6183]} Length = 135 Back     information, alignment and structure
>d2fs6a1 b.60.1.2 (A:2-137) Cellular retinoic-acid-binding protein (CRABP) {Human (Homo sapiens), CRABP-II [TaxId: 9606]} Length = 136 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query107
d1lpja_133 Cellular retinol-binding protein IV {Human (Homo s 100.0
d1hmsa_131 Muscle fatty acid binding protein (m-fabp) {Human 100.0
d1fdqa_131 Brain fatty acid binding protein {Human (Homo sapi 100.0
d2hnxa1131 Adipocyte lipid-binding protein, ALBP {Human (Homo 100.0
d1p6pa_125 Liver basic fatty acid binding protein, LB_FABP {A 100.0
d1o8va_133 Fatty acid-binding protein homolog 1 {Flat worm (E 100.0
d1tw4a_125 Liver basic fatty acid binding protein, LB_FABP {C 100.0
d1ifca_131 Intestinal fatty acid binding protein {Rat (Rattus 100.0
d1b56a_133 Epidermal fatty acid binding protein {Human (Homo 100.0
d1yiva1131 P2 myelin protein {Horse (Equus caballus) [TaxId: 100.0
d1crba_134 Cellular retinol-binding protein II (CRBP) {Rat (R 100.0
d1vyfa_135 Fatty acid-binding protein Sm14 {Blood fluke (Schi 100.0
d1mdca_131 Fatty acid-binding protein {Tobacco hornworm (Mand 100.0
d1ftpa_133 Fatty acid-binding protein {Desert locust (Schisto 100.0
d2a0aa1131 Der f 13 allergen {House dust mite (Dermatophagoid 100.0
d1kqwa_134 Cellular retinol-binding protein II (CRBP) {Zebraf 100.0
d1ggla_134 Cellular retinol-binding protein III {Human (Homo 100.0
d1lfoa_127 Liver fatty acid binding protein {Rat (Rattus norv 100.0
d1o1va_127 Ileal lipid-binding protein {Human (Homo sapiens) 100.0
d2fs6a1136 Cellular retinoic-acid-binding protein (CRABP) {Hu 100.0
>d1lpja_ b.60.1.2 (A:) Cellular retinol-binding protein IV {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: Lipocalins
superfamily: Lipocalins
family: Fatty acid binding protein-like
domain: Cellular retinol-binding protein IV
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=1.3e-38  Score=211.78  Aligned_cols=106  Identities=33%  Similarity=0.622  Sum_probs=102.6

Q ss_pred             CChhhhhhhhcCCCeEEEEEcCCccEEEEEeecCceeEEEEEcCceEEEeC--CCCceEEEEEEEeCCEEEEEEeCCcc-
Q psy15136          1 VGLITRKVGASVSPVLELEKDDSGTYTLHSNSTFKNHAIKFKIGEEFDEET--PDGRKVKSVITIDGDTMTHIQKGDKE-   77 (107)
Q Consensus         1 v~~~~Rk~~~~~~p~~~I~~~Gd~~~~i~~~t~~kt~~~~F~lGeefe~~~--~dG~~~k~t~t~eg~kLv~~~~~~~~-   77 (107)
                      ||+++|++|+.++|+++|+|+|| +|+|++.++.++.+++|+||+|||+.+  +||+++|++++||||+|+++|+++++ 
T Consensus        25 v~~~~Rk~a~~~~pt~~I~~~Gd-~~~ikt~t~~kt~~~~F~lGeefee~~~~~dg~~~k~~~t~eg~klv~~qk~~~~~  103 (133)
T d1lpja_          25 IDFATRKIAKLLKPQKVIEQNGD-SFTIHTNSSLRNYFVKFKVGEEFDEDNRGLDNRKCKSLVIWDNDRLTCIQKGEKKN  103 (133)
T ss_dssp             CCHHHHHHHTTCCCEEEEEEETT-EEEEEEECSSCCEEEEEETTCCEEEECTTTTCCEEEEEEEEETTEEEEEEEESSSS
T ss_pred             CCHHHHHHhhcCCCeEEEEEcCC-EEEEEEEccceEEEEEEECCCcEEEeccCCCCCEEEEEEEEECCEEEEEEeCCCCc
Confidence            78999999999999999999999 999999999999999999999999987  69999999999999999999998888 


Q ss_pred             eEEEEEEECCEEEEEEEECCEEEEEEEEeC
Q psy15136         78 TKIIRVFSDDEVKMTLTVDDIVCTRIYKPL  107 (107)
Q Consensus        78 ~~~~rev~g~~l~~t~~~~~v~~kR~ykr~  107 (107)
                      ..++||++||+|+++|+++||+|+|+|+|+
T Consensus       104 ~~~~Re~~~~~lv~t~~~~~v~~~R~ykka  133 (133)
T d1lpja_         104 RGWTHWIEGDKLHLEMFCEGQVCKQTFQRA  133 (133)
T ss_dssp             EEEEEEEETTEEEEEEEETTEEEEEEEEEC
T ss_pred             eEEEEEEECCEEEEEEEECCEEEEEEEEcC
Confidence            999999999999999999999999999996



>d1hmsa_ b.60.1.2 (A:) Muscle fatty acid binding protein (m-fabp) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fdqa_ b.60.1.2 (A:) Brain fatty acid binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hnxa1 b.60.1.2 (A:1-131) Adipocyte lipid-binding protein, ALBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p6pa_ b.60.1.2 (A:) Liver basic fatty acid binding protein, LB_FABP {Argentine common toad (Bufo arenarum) [TaxId: 38577]} Back     information, alignment and structure
>d1o8va_ b.60.1.2 (A:) Fatty acid-binding protein homolog 1 {Flat worm (Echinococcus granulosus) [TaxId: 6210]} Back     information, alignment and structure
>d1tw4a_ b.60.1.2 (A:) Liver basic fatty acid binding protein, LB_FABP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ifca_ b.60.1.2 (A:) Intestinal fatty acid binding protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1b56a_ b.60.1.2 (A:) Epidermal fatty acid binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yiva1 b.60.1.2 (A:1-131) P2 myelin protein {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1crba_ b.60.1.2 (A:) Cellular retinol-binding protein II (CRBP) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vyfa_ b.60.1.2 (A:) Fatty acid-binding protein Sm14 {Blood fluke (Schistosoma mansoni) [TaxId: 6183]} Back     information, alignment and structure
>d1mdca_ b.60.1.2 (A:) Fatty acid-binding protein {Tobacco hornworm (Manduca sexta) [TaxId: 7130]} Back     information, alignment and structure
>d1ftpa_ b.60.1.2 (A:) Fatty acid-binding protein {Desert locust (Schistocerca gregaria) [TaxId: 7010]} Back     information, alignment and structure
>d2a0aa1 b.60.1.2 (A:1-131) Der f 13 allergen {House dust mite (Dermatophagoides farinae) [TaxId: 6954]} Back     information, alignment and structure
>d1kqwa_ b.60.1.2 (A:) Cellular retinol-binding protein II (CRBP) {Zebrafish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1ggla_ b.60.1.2 (A:) Cellular retinol-binding protein III {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lfoa_ b.60.1.2 (A:) Liver fatty acid binding protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1o1va_ b.60.1.2 (A:) Ileal lipid-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fs6a1 b.60.1.2 (A:2-137) Cellular retinoic-acid-binding protein (CRABP) {Human (Homo sapiens), CRABP-II [TaxId: 9606]} Back     information, alignment and structure